[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for bsub0:CAB14191.1

[Show Plain Result]


## Summary of Sequence Search
    1::233
    2::234     5e-57  43%  234 aa  PF01209 Ubie_methyltran "ubiE/COQ5 methyltransferase family"
    1::95      3e-13  37%   96 aa  PF08241 Methyltransf_11 "Methyltransferase domain"
    1::100     1e-07  29%  100 aa  PF08242 Methyltransf_12 "Methyltransferase domain"
   92::199     6e-06  21%  243 aa  PF08704 GCD14 "tRNA methyltransferase complex GCD14 subunit"
   34::140     4e-05  30%  191 aa  PF01596 Methyltransf_3 "O-methyltransferase"
   24::129     4e-05  34%  197 aa  PF02390 Methyltransf_4 "Putative methyltransferase "
   11::161     2e-04  27%  189 aa  PF07021 MetW "Methionine biosynthesis protein MetW"
    3::146     3e-04  28%  148 aa  PF05401 NodS "Nodulation protein S (NodS)"
    1::233

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQDSKEQRVHGVFEKIYKNYDQMNSVISFQQHKKWRDKTMRIMNVKEGAKALDVCCGTADWTIALAKAAG
PF01209         VEEEKEEKVAEVFDSVASKYDLMNDLMSFGIHRLWKRFTIDLLGVRPGQRVLDLAGGTGDLAFRLARAVG
PF08241         ---------------------------------------------------LDLGCGTGRLARALAR---
PF08242         ---------------------------------------------------LDIGCGTGNLLIPLLEA-N
PF08704         ------------------------------------------LDIRPGSRVLEAGTGSGSLTHALARAVG
PF01596         -----------------------------------------------GAKILEIGTYTGYSALWLALALP
PF02390         ---------------------------------------------------LEIGCGKGEFLVALAKANP
PF07021         --------------------------------------------IEPGSRVLDLGCGDGELLALLREEKG
PF05401         ------------FDLLYANDDPWGFDTSWYERRKYRATLLAALPRPRYARALEVGCANGVLTERLAP---


                         .         .         *         .         .         .         .:140
query           KSGEIKGLDFSENMLSVGEQKVKDGGFSQIELLHGNAMELPFDDDTFDYVTIGFGLRNVPDYLTVLKEMR
PF01209         PTGKVVGLDISESMLKVGREKLRDLGLKNVEFVQGDAEALPFPDNSFDAVTIAFGLRNVTDKDKALREMY
PF08241         RGGRVTGVDISPEMLELARERAAEAGLEN-RFVVGDAEDLPFPDGSFDLVLSSHVLEHLEDPEAALREIA
PF08242         PGAEYTGIDISPAALEAARERFARLGFERLDFEQLDIEDLDLEAGSFDLVVASNVLHHLEDLKAVLRNLR
PF08704         PTGKVYSFEFHEQRAEKAREEFEEHGLDNVTVTHRDVCNDGFGEGLEGSADAVF--LDLPAPWLALPHAV
PF01596         EDGKITTIEINPERAEIARENIEKAGLARIDLREGDALELEEGEGTFDFIFIDADKDN---YLNYLELAL
PF02390         DTNFL-GIEIREPGVAAALKKIEELGLTNLRVIRADAMELPFADGSLSKVFIFFHKRRLPEFLALYA---
PF07021         VDGYGIEIDDAGVLACVA----RGLNVIQGDLEDGLAL---FPDQSFDYVILSQTLQALHNPDAVLREML
PF05401         RCDRLTAVDVSPRALERARERL-------AELPHVSVADVPWPEGKFDLIVVS----EVLYYLTDAAELR


                         +         .         .         .         .         *         .:210
query           RVVKPGGQVVCLETSQPEMFGFRQAYFMYFKYIMPFFGKLFAKSYKEYSWLQESARDFPGMKELAGLFEE
PF01209         RVLKPGGRLLVLEFSKPTNPPLRKLYDLYSFKVLPLIGKLVAGDADSYRYLAESIRMFPDQEELKAMMED
PF08241         RVLKPGGRLV------------------------------------------------------------
PF08242         KLLKPGGRL-------------------------------------------------------------
PF08704         KALKPGGRICC-----------------------------------------------------------
PF01596         RLLRPGGVIV------------------------------------------------------------
PF02390         RVLKPGG---------------------------------------------------------------
PF07021         RV---GREAI---VSFPNFGHWRHRLSLLLRGRMPVSKSL------PYQWYNTPNIHFCTIKDFEALCRE
PF05401         RAIRPGGTLVFAAHWRPEL---------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AGLKNVKYHSFTGGVAATHIGWK
PF01209         AGFERVKYRNLTGGIVALHSGYK
PF08241         -----------------------
PF08242         -----------------------
PF08704         -----------------------
PF01596         -----------------------
PF02390         -----------------------
PF07021         VGIR-------------------
PF05401         -----------------------