[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for bsub0:CAB15681.1

[Show Plain Result]


## Summary of Sequence Search
    1::569
    2::119     2e-42  72%  119 aa  PF00449 Urease_alpha "Urease alpha-subunit, N-terminal domain"
  136::209     6e-05  28%  225 aa  PF04452 Methyltrans_RNA "RNA methyltransferase"
  243::271     5e-04  59%  271 aa  PF01979 Amidohydro_1 "Amidohydrolase family"
    1::569

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xKMSREEYAELFGPTTGDKIRLGDTDLWIEVEKDFTVYGEEMIFGGGKTIRDGMGQNGRITGKDGALDLV
PF00449         -KISREAYAEMFGPTTGDRVRLADTDLIIEVEKDLTTYGEEVKFGGGKVIRDGMGQS-QTTRADGALDTV
PF04452         ----------------------------------------------------------------------
PF01979         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ITNVVLLDYTGIVKADVGVKDGRIVGVGKSGNPDIMDGVDPHMVIGAGTEVIxxxxxxxxxxxxxxxxxx
PF00449         ITNALIVDHTGIYKADIGIKDGRIVGIGKAGNPDTQDGVD--IIIGPGTEVI------------------
PF04452         ----------------------------------------------------------------------
PF01979         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00449         ----------------------------------------------------------------------
PF04452         ----------------------------------------------------------------------
PF01979         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxPSAIKTCMEVVDEADIQVAIHTDTINEAGFLENTLDAIGDRVIHTYHIEGAG
PF00449         ----------------------------------------------------------------------
PF04452         ------------------PISLKDLLKELPDADLRLVLHEEAAKSLGELAELLAALRRRVL---LLIGPE
PF01979         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GGHAPDIMKLASYANILPSSTTPTIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00449         ----------------------------------------------------------------------
PF04452         GGFSPEEIELLRAAGFQPVSLGPRI---------------------------------------------
PF01979         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTINPAITHGLS
PF00449         ----------------------------------------------------------------------
PF04452         ----------------------------------------------------------------------
PF01979         -----------------------------------------------------------TINPARALGLD


                         .         .         +         .         .         .         .:490
query           HEVGSVEKGKLADLVLWDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00449         ----------------------------------------------------------------------
PF04452         ----------------------------------------------------------------------
PF01979         DRKGSLEPGKDADLVVLD----------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00449         ----------------------------------------------------------------------
PF04452         ----------------------------------------------------------------------
PF01979         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxx
PF00449         ---------
PF04452         ---------
PF01979         ---------