[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for bsub0:CAB12237.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1xhbA2.bssp"
#ERROR : Can't open dsspfile "1h7lA.bssp"
#ERROR : Can't open dsspfile "2bo4A1.bssp"
#ERROR : Can't open dsspfile "1omxA.bssp"
#ERROR : Can't open dsspfile "2dm9A1.bssp"
#ERROR : Can't open dsspfile "3dcxA1.bssp"

## Summary of PDB Search
:420
    1e-24  17%  1xhbA2 [c.68.1.17] POLYPEPTIDE N-ACETYLGALACTOSAMINYLTRANSFERASE 1
    4e-22  15%  1h7lA  [c.68.1.1] SPORE COAT POLYSACCHARIDE BIOSYNTHESIS PROTEIN
    9e-21  14%  2bo4A1 [c.68.1.18] MANNOSYLGLYCERATE SYNTHASE A:2 -- 382
    1e-14  13%  1omxA  [c.68.1.15] ALPHA-1,4-N-ACETYLHEXOSAMINYLTRANSFERASE EXTL2
    1e-11  10%  2dm9A1 [d.81.4.1] V-TYPE ATP SYNTHASE SUBUNIT E A:81 -- 198
    7e-04   9%  3dcxA1 [b.55.1.13] PROTEIN OF UNKNOWN FUNCTION (DUF1696) WITH A:9
:420

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxRHYMTFERNIPKWRENMKELPKVSVLIPAHNEEVVIRQTLKA
1xhbA2          ----------------------------RSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVH
1h7lA           ------------------------------------------------PKVSVIMTSYNKSDYVAKSISS
2bo4A1          ---------------------------------------------------LVVFPFKHEHPEVLLHNVR
1omxA           -----------------------------------------------LDSFTLIMQTYNRTDLLLRLLNH
2dm9A1          ------------------------------------------------------------------IISS
3dcxA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           MVNLYYPKDRLEIIVVNDNSSDRTGDIVNEFSEKYDFIKMVITKPPNAGKGKSSALNSGFAESNGDVICV
1xhbA2          SVNRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLK-VPVHVIRMEQRSGLIRARLKGAAVSRGQVITF
1h7lA           ILSQTFSD--FELFIMDDNSNEETLNVIRPFLNDNRVSDISGVKERTEKTRYAALINQAIEMAEGEYITY
2bo4A1          VAAAHPR---VHEVLCIGYERDQTYEAVERAAPEVRLQERLGTLRPGKGDGMNTALRYFLEETQWERIHF
1omxA           YQAVPSLH---KVIVVWNNVKGPE-ELWNSLGPHPIPVIFKPQT-----ANKMRNRLQVFPEVETNAVLM
2dm9A1          VLEEVKR--RLETMSEDEYFESVKALLKEAIKELNEKKVRVMSNEKT--LGLIASRIEEIKSELGDVSIE
3dcxA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           YDADNTPEKMAVYYLVLGLMNDEKAGAVVGKFRVINAAKTLLTRFINIETICFQWMAQGGRWKWFKIATI
1xhbA2          LDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGRWYPVPQREMDRRKGDRTLPVRTPTM
1h7lA           ATDDNIYMPDRLLKMVRELDTHPEKAVIYSAS-----------KTYHLNDIVKETVRPAAQVTWNAPCAI
2bo4A1          YDADITSFGPDWITKAEEAADFG-YGLVRHYFPRASTDAMITWMITRTGFALLWP-----HTELSWIEQP
1omxA           VDDDTLISAQDLVFAF------------------------------------------------------
2dm9A1          LGETVDTMGGVIVETEDGRIRID--NTFEARMERFE----------------------------------
3dcxA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PGTNFAIRRSIIEKLGGWDDKALAEDTELTIRVYNLGYHIRFFPAAITWEQEPETWKVWWRQRTRWARGN
1xhbA2          AGGLFSIDRDYFQEIGTYDAGWGGENLEISFRIWQCGGTLEIVTCSHVGHVFGQIINKNNRRLAEVWMDE
1h7lA           DHCSVMHRYSVLEKVKEKPAFYRIGDARFFWRVNHFYPFYPLDEELDLNYITNEFVRNLPPQRNCRELRE
2bo4A1          LGGELLMRREVAAMLYEDERSDWGIDTLYTFVTVQQGVSIYECYIPEGKAHRLYGGLDDLRTMLVECFAA
1omxA           ----------------------------------------------------------------------
2dm9A1          ----------------------------------------------------------------------
3dcxA1          -----NAAEVNLDELAQELGPGDNEQLALAYRVIRDXF---VFTNKRLILIDKQGVTGKKVSYHSVPYKA


                         .         *         .         .         .         .         +:350
query           QYVVLKFLAQFFKLKRKRIIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1xhbA2          FKNFFYIISPGVTKVDYGDI--------------------------------------------------
1h7lA           SL--------------------------------------------------------------------
2bo4A1          IQSLQHEVVGQPAIHR------------------------------------------------------
1omxA           ----------------------------------------------------------------------
2dm9A1          ----------------------------------------------------------------------
3dcxA1          ITHFEV----------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1xhbA2          ----------------------------------------------------------------------
1h7lA           ----------------------------------------------------------------------
2bo4A1          ----------------------------------------------------------------------
1omxA           ----------------------------------------------------------------------
2dm9A1          ----------------------------------------------------------------------
3dcxA1          ----------------------------------------------------------------------