[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for bsub0:CAB13082.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1khbA1.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "1pv4A3.bssp"
#ERROR : Can't open dsspfile "2iqhA1.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "1kgdA.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "1ohcA1.bssp"
#ERROR : Can't open dsspfile "2gx8A1.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1udwA.bssp"
#ERROR : Can't open dsspfile "1bs2A1.bssp"
#ERROR : Can't open dsspfile "1rkbA.bssp"
#ERROR : Can't open dsspfile "1poiA.bssp"
#ERROR : Can't open dsspfile "1qhlA.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "2qgmA1.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "1mm8A.bssp"
#ERROR : Can't open dsspfile "1g6oA.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1urjA.bssp"
#ERROR : Can't open dsspfile "2gk3A1.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"
#ERROR : Can't open dsspfile "1xbtA1.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "1dnpA2.bssp"
#ERROR : Can't open dsspfile "1qhdA1.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1dhyA1.bssp"
#ERROR : Can't open dsspfile "1f8xA.bssp"
#ERROR : Can't open dsspfile "1f2t.1.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "1jb1A.bssp"
#ERROR : Can't open dsspfile "1np6A.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1sbxA.bssp"
#ERROR : Can't open dsspfile "1esmA.bssp"
#ERROR : Can't open dsspfile "1ak2A1.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1f46A.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "2vgmA3.bssp"
#ERROR : Can't open dsspfile "1l7lA.bssp"
#ERROR : Can't open dsspfile "1em8A.bssp"
#ERROR : Can't open dsspfile "1jbkA.bssp"
#ERROR : Can't open dsspfile "1i1qA.bssp"
#ERROR : Can't open dsspfile "1o7d.2.bssp"
#ERROR : Can't open dsspfile "1j1zA2.bssp"
#ERROR : Can't open dsspfile "1t3wA.bssp"
#ERROR : Can't open dsspfile "1v47A1.bssp"
#ERROR : Can't open dsspfile "2fggA1.bssp"
#ERROR : Can't open dsspfile "3cddA1.bssp"
#ERROR : Can't open dsspfile "2gtlM1.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "2pa7A1.bssp"
#ERROR : Can't open dsspfile "1a4iA2.bssp"
#ERROR : Can't open dsspfile "1s9hA.bssp"
#ERROR : Can't open dsspfile "1zs3A1.bssp"
#ERROR : Can't open dsspfile "2f9hA1.bssp"
#ERROR : Can't open dsspfile "1l3aA.bssp"
#ERROR : Can't open dsspfile "1vhhA.bssp"
#ERROR : Can't open dsspfile "1es6A2.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1tljA.bssp"
#ERROR : Can't open dsspfile "1viaA.bssp"
#ERROR : Can't open dsspfile "1fl9A.bssp"
#ERROR : Can't open dsspfile "2je6I3.bssp"
#ERROR : Can't open dsspfile "1uouA3.bssp"
#ERROR : Can't open dsspfile "2ancF1.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "1mi8A.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "1g8yA.bssp"
#ERROR : Can't open dsspfile "1ovmA2.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "2vnuD1.bssp"
#ERROR : Can't open dsspfile "1ii8.1.bssp"
#ERROR : Can't open dsspfile "1iqrA2.bssp"
#ERROR : Can't open dsspfile "1l1oA.bssp"
#ERROR : Can't open dsspfile "1yvuA2.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "3cddA2.bssp"
#ERROR : Can't open dsspfile "1gm5A1.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1b77A2.bssp"
#ERROR : Can't open dsspfile "1jqjA3.bssp"
#ERROR : Can't open dsspfile "1tueA.bssp"
#ERROR : Can't open dsspfile "1odfA.bssp"
#ERROR : Can't open dsspfile "1g31A.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "1g8fA3.bssp"
#ERROR : Can't open dsspfile "1cd5A.bssp"
#ERROR : Can't open dsspfile "1q3tA.bssp"
#ERROR : Can't open dsspfile "1yj5A2.bssp"
#ERROR : Can't open dsspfile "1atrA1.bssp"
#ERROR : Can't open dsspfile "2gujA1.bssp"
#ERROR : Can't open dsspfile "1zbsA1.bssp"
#ERROR : Can't open dsspfile "1pgsA2.bssp"
#ERROR : Can't open dsspfile "1t9hA2.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "1mkyA1.bssp"
#ERROR : Can't open dsspfile "1iioA.bssp"
#ERROR : Can't open dsspfile "1xl3C1.bssp"
#ERROR : Can't open dsspfile "1tf7A1.bssp"
#ERROR : Can't open dsspfile "1jqjA2.bssp"
#ERROR : Can't open dsspfile "1v37A.bssp"
#ERROR : Can't open dsspfile "1j90A.bssp"
#ERROR : Can't open dsspfile "1xkpA1.bssp"
#ERROR : Can't open dsspfile "1e6vC.bssp"
#ERROR : Can't open dsspfile "1p5zB.bssp"
#ERROR : Can't open dsspfile "1bifA1.bssp"
#ERROR : Can't open dsspfile "1heiB1.bssp"
#ERROR : Can't open dsspfile "1ye8A1.bssp"

## Summary of PDB Search
:250
    8e-40  29%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE
    5e-37  18%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-36  23%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER
    3e-35  25%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    1e-31  22%  1ji0A  [c.37.1.12] ABC TRANSPORTER
    3e-31  14%  1ex6A  [c.37.1.1] GUANYLATE KINASE
    5e-31  12%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    2e-30  10%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
    2e-29  20%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN
    8e-29   9%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN
    7e-27  31%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564
    2e-25  13%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278
    4e-25  11%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
    8e-25  11%  1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-24   9%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB
    1e-24  14%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE
    1e-23  11%  1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 --
    4e-23  12%  2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489
    5e-23  14%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3
    1e-22   6%  1kgdA  [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK
    3e-22  14%  1ffhA2 [c.37.1.10] FFH A:89 -- 295
    2e-21  11%  1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198
    2e-21  11%  2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373
    9e-21  11%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    2e-20   6%  1udwA  [c.37.1.6] URIDINE-CYTIDINE KINASE 2
    7e-20  13%  1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607
    1e-19  12%  1rkbA  [c.37.1.1] PROTEIN AD-004
    2e-19  10%  1poiA  [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE
    3e-19  12%  1qhlA  [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)
    4e-19  22%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN
    3e-18   9%  2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445
    3e-18  11%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    4e-18  14%  1mm8A  [c.55.3.4] TN5 TRANSPOSASE
    9e-18  15%  1g6oA  [c.37.1.11] CAG-ALPHA
    1e-17  12%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2
    1e-17  12%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
    5e-17  13%  1urjA  [e.58.1.1] MAJOR DNA-BINDING PROTEIN
    6e-17   7%  2gk3A1 [c.23.16.9] PUTATIVE CYTOPLASMIC PROTEIN A:8 -- 253
    1e-16  11%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379
    1e-16   9%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
    2e-16   8%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173
    2e-16  18%  1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150
    2e-16   9%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
    2e-16  14%  1dnpA2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 200
    1e-15  10%  1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397
    1e-15  12%  1d6jA  [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE
    2e-15  11%  1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132
    2e-15  10%  1f8xA  [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
    2e-15  31%  1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    3e-15   9%  1tmkA  [c.37.1.1] THYMIDYLATE KINASE
    7e-15  14%  1jb1A  [c.91.1.2] HPRK PROTEIN
    7e-15  14%  1np6A  [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    8e-15  13%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
    1e-14  11%  1ckvA  [d.137.1.1] PROTEIN (PROTEIN B)
    1e-14  12%  1sbxA  [a.6.1.4] SKI ONCOGENE
    2e-14   9%  1esmA  [c.37.1.6] PANTOTHENATE KINASE
    2e-14  10%  1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --
    2e-14   8%  1e6cA  [c.37.1.2] SHIKIMATE KINASE
    3e-14  11%  1f46A  [d.129.4.1] CELL DIVISION PROTEIN ZIPA
    3e-14  14%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    4e-14  16%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE
    5e-14  10%  2vgmA3 [d.79.3.2] DOM34 A:278 -- 381
    6e-14   4%  1l7lA  [b.18.1.16] PA-I GALACTOPHILIC LECTIN
    6e-14  16%  1em8A  [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT
    7e-14  10%  1jbkA  [c.37.1.20] CLPB PROTEIN
    1e-13   9%  1i1qA  [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I
    1e-13   9%  1o7d.2 [b.30.5.6] LYSOSOMAL ALPHA-MANNOSIDASE C:488 -- 585 D:603 --
    2e-13  13%  1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395
    2e-13  13%  1t3wA  [a.236.1.1] DNA PRIMASE
    3e-13   9%  1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135
    6e-13  18%  2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87
    8e-13   7%  3cddA1 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:181 -- 348
    9e-13   5%  2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225
    1e-12  20%  1g6hA  [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    2e-12  15%  2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 --
    2e-12   8%  1a4iA2 [c.58.1.2] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:2 --
    2e-12   9%  1s9hA  [c.37.1.20] REP 40 PROTEIN
    2e-12  18%  1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173
    2e-12  13%  2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123
    3e-12  13%  1l3aA  [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2
    3e-12  13%  1vhhA  [d.65.1.2] SONIC HEDGEHOG
    6e-12  15%  1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321
    7e-12  11%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    8e-12   7%  1tljA  [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622
    1e-11  15%  1viaA  [c.37.1.2] SHIKIMATE KINASE
    1e-11  11%  1fl9A  [c.37.1.18] HYPOTHETICAL PROTEIN HI0065
    3e-11  18%  2je6I3 [d.51.1.1] EXOSOME COMPLEX RNA-BINDING PROTEIN 1 I:153 --
    4e-11   7%  1uouA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:374 -- 480
    5e-11  15%  2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206
    5e-11  14%  1ckeA  [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    6e-11   7%  1mi8A  [b.86.1.2] DNAB INTEIN
    9e-11  24%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
    1e-10  12%  1g8yA  [c.37.1.11] REGULATORY PROTEIN REPA
    2e-10   9%  1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180
    2e-10  11%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800
    2e-10  10%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    3e-10  13%  2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494
    4e-10  24%  1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    6e-10  11%  1iqrA2 [c.28.1.1] PHOTOLYASE A:2 -- 171
    7e-10   8%  1l1oA  [b.40.4.3] REPLICATION PROTEIN A 14 KDA SUBUNIT
    1e-09  17%  1yvuA2 [c.55.3.10] HYPOTHETICAL PROTEIN AQ_1447 A:315 -- 706
    1e-09  12%  1d8jA  [a.4.5.18] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    3e-09  11%  1e2hA  [c.37.1.1] THYMIDINE KINASE
    3e-09  13%  3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180
    5e-09  18%  1gm5A1 [a.24.21.1] RECG A:7 -- 105
    5e-09  10%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    7e-09  11%  1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228
    2e-08   8%  1jqjA3 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:245 -- 366
    6e-08  10%  1tueA  [c.37.1.20] REPLICATION PROTEIN E1
    7e-08  18%  1odfA  [c.37.1.6] HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2
    8e-08  13%  1g31A  [b.35.1.1] GP31
    8e-08   8%  1dwmA  [d.40.1.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    1e-07  10%  1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511
    1e-07  13%  1cd5A  [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)
    1e-07  18%  1q3tA  [c.37.1.1] CYTIDYLATE KINASE
    1e-07  10%  1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351 --
    1e-07  19%  1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188
    1e-06  15%  2gujA1 [b.106.1.3] PHAGE-LIKE ELEMENT PBSX PROTEIN XKDM A:5 -- 143
    2e-06  10%  1zbsA1 [c.55.1.5] HYPOTHETICAL PROTEIN PG1100 A:108 -- 283
    2e-06   7%  1pgsA2 [b.121.1.1] PEPTIDE-N(4)-(N-ACETYL-BETA-D-GLUCOSAMINYL)
    3e-06  11%  1t9hA2 [c.37.1.8] PROBABLE GTPASE ENGC A:68 -- 298
    3e-06  10%  1bccF  [f.27.1.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    5e-06  10%  1mkyA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:2 -- 172
    5e-06  10%  1iioA  [a.39.4.1] CONSERVED HYPOTHETICAL PROTEIN MTH865
    7e-06  16%  1xl3C1 [a.243.1.1] PROTEIN TYPE A C:2 -- 92
    1e-05  18%  1tf7A1 [c.37.1.11] KAIC A:14 -- 255
    3e-05  14%  1jqjA2 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:123 -- 244
    4e-05  11%  1v37A  [c.60.1.1] PHOSPHOGLYCERATE MUTASE
    4e-05  32%  1j90A  [c.37.1.1] DEOXYRIBONUCLEOSIDE KINASE
    8e-05  18%  1xkpA1 [a.243.1.3] PUTATIVE MEMBRANE-BOUND YOP TARGETING PROTEIN
    1e-04  12%  1e6vC  [d.58.31.1] METHYL-COENZYME M REDUCTASE I GAMMA SUBUNIT
    2e-04  14%  1p5zB  [c.37.1.1] DEOXYCYTIDINE KINASE
    3e-04  17%  1bifA1 [c.37.1.7] 6-PHOSPHOFRUCTO-2-KINASE/ FRUCTOSE-2,6- A:37 --
    3e-04  17%  1heiB1 [c.37.1.14] HCV HELICASE B:188 -- 325
    0.001  23%  1ye8A1 [c.37.1.11] HYPOTHETICAL UPF0334 KINASE-LIKE PROTEIN
:250

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEANDQTQNIPAISFRSVRKSYKQDGQTYDVLQDVTGDIQQGAIVAVLGPSGSGKSTLLSMCNLMRTPDS
1b0uA           ------------LHVIDLHKRY--GGHE--VLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSE
1q3hA           --------GELLEKVSFSHLCL--VGNP--VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASE
1sgwA           ------------LEIRDLSVGYDKP-----VLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLK
1l7vC           -----------------------QDVAESTRLGPLSGEVRAGEILHLVGPNGAGKSTLLARX-AGXTSGK
1ji0A           ------------LEVQSLHVYY---GAIH-AIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQK
1ex6A           -------------------------------------------PIVISGPSGTGKSTLLKKLFAEYPDSF
1m3eA1          ----------------------------YTDAVEAVKDIPNGATVLVGGFGLCGIPENLIGALLKTGVKE
1nijA1          -----------------------------------------IAVTLLTGFLGAGKTTLLRHILNEQHGYK
1e69A           ------------------------------SFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKF
1t06A           ---------------------------DFKTVMQELEALGKERTKKIYISNGAHEPVFGVATGAMKPIAK
1pf4A1          ----------GEVDVKDVTFTYQGKEKP--ALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDS
1jalA1          -----------------------------------------GFKCGIVGLPNVGKSTLFNALTKAGPFCT
2yyeA2          -------------------------------------GAQVGQLLILTKPIGTGILIKGLKEGILKEEDI
1khbA1          ------------------------------LVLGITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKV
1e9rA           ----------SGGKLKRMTREKAKQ----VTVAGVPMPRDAEPHLLVNGATGTGKSVLLRELAYTGLLRG
1jjvA           -----------------------------------------TYIVGLTGGIGSGKTTIANLFTDLGVPLV
1pv4A3          ------------ILFENLTPLHGSTEDLTARVLDLASPIGRGQRGLIVAPPKAGKTXLLQNIAQSIAYNH
2iqhA1          ----------DKEEIRRIWRQANNGDDATAMIWHSNLNDATYQRTRALVRTG-MDPRMCSLMQGSTLPRR
1mukA           -------AEMDETLMRARRHSYS----SFSKLLEAYLLVKW-----RMCEAREPSVDLLPLCAGID-PLN
1kgdA           ---------------------------------------HMRKTLVLLGAHGVGRRHIKNTLITKHPDRF
1ffhA2          --------------------------------------LKDRNLWFLVGLQGSGKTTTAAKLALYYKGKG
1ohcA1          -------------------------------------------------------------------DPQ
2gx8A1          ---------------------------------------------GAGHIGNYSHCTFSSEGTGTFVPQQ
1n25A           --------------------------------------IPKKRYWLFKGPIDSGKTTLAAALLELCGGKA
1udwA           ----------------------------------------EPFLIGVSGGTASGKSSVCAKIVQLLQKQV
1bs2A1          ----------------------------------------------------------------------
1rkbA           --------------------------------------LMLLPNILLTGTPGVGKTTLGKE--LASKSGL
1poiA           ---------------------------VMTLKDAIAKYVHSGDHIALGGFTTDRKPYAAVFEILRQTDLT
1qhlA           ------------GKFRSLTLINWN------GFFARTFDLDEL-VTTLSGGNGAGKSTTMAAFVTALIPDL
1vplA           -----------AVVVKDLRKRI--GKKE--ILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSS
2qgmA1          ----------------------------------------------------------------------
1grqA           -----------------------------------------TRMIILNGGSSAGKSGIVRCLQSVLPEPW
1mm8A           ----------------------------------------------------------------------
1g6oA           ----------YPHSFFEEQGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGTGSGKTTYIKSIXEFIPKEE
1c4oA1          ------------FRYRGPSPKGDQP----KAIAGLVEALRGERFVTLLGATGTGKTVTMAKVIEALGRPA
2axpA1          -------------------------------------------LIILEGPDCCFKSTVAAKLSKELKYPI
1urjA           ------------TTGEALCERLGLDPDRAVVTEGFKEAVCINNTFLHLG--GSDKVTIGGAEVHRIPVYP
2gk3A1          ----------------------------------------------------------------------
1bmfA3          -------KAPGIIPRISVREPM----QTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFN
1mjgM           --------ETRGIKLTKIKLDL--PINF--GPAFEGESIRKGDMYVEMGGNRTPAFELVRTVSESEITDG
1bgxT2          ------------------------------------------------------------------EPKG
1xbtA1          ----------------------------------------RGQIQVILGPMFSGKSTELMRRVRRFQIAQ
2v3jA1          ------------------------------APPVLTSKDKITKRXIVVLAXASLETHKIYVLLNCD-DHQ
1dnpA2          ----------------------------------------------------------------------
1qhdA1          ------------------------------YIENWNLQNRRQRTSVLADASETMLANVTSVRQEYA-IPV
1d6jA           -----------------------HASAL-TRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDR
1dhyA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1tmkA           ----------------------------------------RGKLILIEGLDRTGKTTQCNILYKKLQPNC
1jb1A           ------------------------------SXHGVLVDIY-GLGVLITGDSGVGKSETALELVQRGHRLI
1np6A           -----------------------------------------IPLLAFAAWSGTGKTTLLKKLIPALCARG
1zp6A1          -----------------------------------------GNILLLSGHPGSGKSTIAEALANLPGVPK
1ckvA           ------------AYDAGIMGLKGKDFADQ-FFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKN
1sbxA           ----------------------------------------------------------------------
1esmA           ----------PLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWP
1ak2A1          -----------------------------------------GVRAVLLGPPGAGKGTQAPKLAKNFCVCH
1e6cA           -------------------------------------------PIFMVGARGCGMTTVGRELARALGYEF
1f46A           ---------------------------------------------------------------IMNVAAH
1lw7A2          --------------------------------------PFFAKTVAILGGESSGKSVLVNKLAAVFNTTS
1cr0A           ------------------------------GINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAM
2vgmA3          ----------------------------------------------------------------------
1l7lA           -------------------------------KGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQK
1em8A           ----------------------------------------------------------------------
1jbkA           MQALKKYTIDLTERAEQGKLDPVIGRDE--EIRRTIQVRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGE
1i1qA           ------------DRYSYVMHLVSRVVGE--LRHDLDALHAYRACMNMGTLSGAPKVRAMQLIADAEGQRR
1o7d.2          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1t3wA           ------------------------------------------------------KRTTXRILILVQNPEL
1v47A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
2gtlM1          ----------IVTITAAHRKSFFPNRVWLRATLSYELDEHDHTVSTTQLRGFYNFGKRELLLAPLKGQSE
1g6hA           ----------EILRTENIVKYF--GEFK--ALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADE
2pa7A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1s9hA           ------------------------------FLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYG
1zs3A1          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1l3aA           ---------------------------------------------------------------------V
1vhhA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1ni3A1          ------------------------------------GRPGNNLKTGIVGXPNVGKSTFFRAITKSVLGNP
1tljA           ------------------------------ALNKIYHDKEIGYLDPDILGFLLAFYRVYTQSSCSGRITI
1viaA           -------------------------------------------NIVFIGFXGSGKSTLARALAKDLDLVF
1fl9A           ------ESLTQYIPDEFSMLRFGKK----FAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQG
2je6I3          ---------------------------------GIVIDIMPVKVPRVIGKNKSMYETLTSKSIFV--ANN
1uouA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYD
1ckeA           -----------------------------------------APVITIDGPSGAGKGTLCKAMAEWHLLDS
1mi8A           ----------KRVSIKDLLDEK---DFEIWAINEQTMKLESAKVSRV-FMTGKKLVYILKTRLGRTIKAT
1w1wA           -------------------------------------GFGESNFTSIIGPNGSGKSNMMVLKDLIRGPQS
1g8yA           ------------HKPINILEAFAAAPP---PLDYVLPNMVAGTVGALVSPGGAGKSMLALQL--------
1ovmA2          ------------IDSPDICWVGCANELN--ASYAADGYARCKGFAALLTTFGVGELSAMNGIAGSYAEHV
1e3mA2          ----------PGIRITEGRHPVVEQVLNEPFIANPLNLSPQRRXLIITGPNXGGKSTYXRQTALIALXAY
1afrA           ------------------------------VHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQ
2vnuD1          ----------VRIRTRRAAELLDKRIVISIDSWPTTHKYPLGHFVRDLGTIESAQAETEALLLEHDVEYR
1ii8.1          -------------------------------HSDTVVEFKEG-INLIIGQNGSGKSSLLDAILVGLYWPL
1iqrA2          ----------------------------------------------------------------------
1l1oA           ------------------------------RINAGMLAQFIDKPVCFVGRLEKIHPTGKMFI--LSDGEG
1yvuA2          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1e2hA           --------------------------------------MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVP
3cddA2          ----------IVLKAGGKIYQGWTKIGITRSLEAXSGAFDLEXTYKFLGNDAQYKAFIEPIKQGQACTVD
1gm5A1          ----------------------------------------------------------------------
1yr6A1          -------------------------------------------IVVFVGTAGSGKTTLTGEFGRYLEDNY
1b77A2          -------------------------------VASVITEIKAEDLQQLL-----RVSRGLQIDTIAITNKD
1jqjA3          -----------------------------EKFRGVRLYVSENQLKITANNPEQEEAEEILDV--------
1tueA           -----------------------------GALKSFLKGTPKKNCLVFCGPANTGKSYFGMS--FIHFIQG
1odfA           ---------------------------------------KCPLFIFFSGPQGSGKSFTSQIYNHLMEKYG
1g31A           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1g8fA3          --------------------------------------PKQGFSIVLGNSLTVSREQLSIALLSTFLQFG
1cd5A           ----------GQVSFKHVVTFN---MDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDID
1q3tA           ----------------------------------------KTIQIAIDGPASSGKSTVAKIIAKFTYLDT
1yj5A2          -------------------------------------------VVAV-GFPGAGKSTFIQEHLVSAGYVH
1atrA1          --------------------------------KGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPS
2gujA1          --------------------------------------------------VKKGSDPYFTLQAVLDDQSS
1zbsA1          ----------------------------------------------------------------------
1pgsA2          ----------NKSSIDGVPYGKAHTLGLKKNIQLPTNTEKAYLRTTISGWGHAKPYDAGSRGCAEWCFRT
1t9hA2          ---------------------------------------------------GVGKSSLLNAISPTRHVES
1bccF           ----------------------------------------------------------------------
1mkyA1          --------------------------------------------VLIVGRPNVGKSTLFNKLVKDPVQDT
1iioA           ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1tf7A1          ------------------------------------GGLPIGRSTLVSGTSGTGKTLFSILYNGIIEFDE
1jqjA2          ----------------------------------------------------------------------
1v37A           ----------------------------------------------------------------------
1j90A           ----------------------------------------QPFTVLIEGNIGSGKTTYLNHFCLLTEPVE
1xkpA1          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1p5zB           ----------------------------------------RIKKISIEGNIAAGKSTFVNILEVVPEPVA
1bifA1          ------------------------------------------TLIVMVGLPARGKTYISKLTRYLNF---
1heiB1          --------------------------------------PQSFQVAHLHAPTGSGKSTKVPAA--YAAQGY
1ye8A1          --------------------------------------------IIITGEPGVGKTTLVK--KIVERLGK


                         .         .         *         .         .         .         .:140
query           GEVNIYGKEVREWNVNELRRTAALAFQSAPVLDGTVRDNLSLVQRLHQSQLYSPEKLASLAGLPPELLDR
1b0uA           GAIIVNGQNINLVRDKDGQLKVADKNQFNLWSHMTVLENVMEAPIQVLGLSKHDARYLAKVGIDERAQGK
1q3hA           GIIKHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDIT-----KFAEQD-NTVLGE
1sgwA           GEIIYNGVPITKVKGKIFFLPEEIIVPRKI----SVEDYLKAVASLYGVKVNKNEIMDALESVEVLDLKK
1l7vC           GSIQFAGQPLEAWSATKLALHRAYLSQQQTPPFATPVWHYLTLHQHDKTRTELLNDVAGALALD-DKLGR
1ji0A           GKIIFNGQDITNKPAHVINRXGIALVPEGRRIELTVYENLXXGAYNRKDKEGIKRDLEWIFSLFPRLLKQ
1ex6A           GFSVSSTTRTPRAGEVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYSTVASVKQVSKSGKTCILDID
1m3eA1          LTAVSNNAGVLLLQSKQIKRXISSYVGENAEFERQYLAGELEVELTPQGTLAERIRAFYTSTGYGTLVQE
1nijA1          IAVIENEFGEVSVDDQLIGDRATQIKTLTNGCICSRSNELEDALLDLLDNLDKGNIQFDRLVI-ECTGMA
1e69A           DMIFAGSENLPPAGSAYVELVFEENGEEITVARELKRTGENTYYLNGSPVRLKDEGRLEISIRKPGRRDQ
1t06A           K--IKLNQELAEELYATGNYDAMYFAGIIADPKAMSESDFDRWIDGA-YFYMLSDYVVAVTLSESNIAQD
1pf4A1          GSICLDGHDVRDYKLTNLRRHFALVSQNVHLFNDTIANNIAYAAEGEYTREQIEFIENMPQGL-DTVIGE
1jalA1          IEPNTGVVPMPDPRLDALAEIVKPERILPTTMEFVDIAGLVKGEGLGNKFLANIRETDAIGHVVRCFENI
2yyeA2          NEAIENMLNLMLSLDATACTDVTGFGLLGHAWNICKNSNIGARIFFEKVPYYQLENLVKKKIYPKNLNFV
1khbA1          ECVGDDIAWMKFDAQGHLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYPLASGV
1e9rA           DRMVIVDPNGDMLSKFGRDK--DIILNPDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYG
1jjvA           -DADVVAREVVAKD-SPLLSKIVEHFG---------AQILNRAALRERVFNHDEDKLWLNNLLHPAIRER
1pv4A3          PDCVLXVLLIDERPEEVTE---XQRLVKGEVVASTFDEPASRHVQVAEXVIEKAKRLVEHKKDVIILLD-
2iqhA1          SAVKGVGTMVMELI----RMIKRGINRRTRIAYERMCNILKGKFQTAAQRTMVDQVRESRNFEDLIFLAR
1mukA           SDPFLKMVSVGP-MLQSTRKYFAQTLFMAKTVSGNAIDSALLRLRTLGADKKALTAQLLMVGLQESEADA
1kgdA           AYPIPHTTRPPEENGKNYYFVSHDQMMQDISNNEYLEYGS----HEDAMYGTKLETIRKIHEQGLIAILD
1ffhA2          RRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARD-------------L
1ohcA1          DDVYLDITDRFAILYSRPKSASNVHYFSNELEYENFYADFGPLNLAMVYRYCC--KINKKLKSITMLRKK
2gx8A1          LEVRIETIIPASLQRKVIKAMVTAHPYEEVAYDVYLDNKGETLGLGKIGYLQEEMTLGQFAEHVKQSLDV
1n25A           LNVNLPLDRLNFELFEDVKGTGGESRDLPSGQGINNLDNLGSVKVNLEKKHLNKRTQIFPPGIVTMNEYS
1udwA           VILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELIL-----KTLKEITEGKTVQIPVYDFVSHSRKE
1bs2A1          -----------------------------------------------------------------PYLQY
1rkbA           KYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGFFPERWFHIVFVLRTDTNVLYERLETR
1poiA           GLGGAAGGDWDMLIGNGRVKAYINCYSGVTNVSRRFRKWFEAMEDYSQDVIYMMWHAAALGLPFLPVTLD
1qhlA           TLLLHGKLKAGVCYSMHQRVVVGVRLQQVAGRKVDIKPFAIQGLPMSVARVLPLNELKDKLEAMEGVQFK
1vplA           GIVTVFGKNVVEEPHEVRKLISYLPEEAGAYRNMQGIRFVAGFYASSSSEIEEMVERATEIAGLGEKIKD
2qgmA1          -----------------------------------------------------------VKSIQ-SQANP
1grqA           LAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFGAAAQE
1mm8A           --------------LHRAADWAKSVFSSAALGDRLVNVAAQLAKYSGKSITISSEGSKAAQEGAYRFIRN
1g6oA           RIISIEDTEEIVF--KHHKNYTQLFFGGNITSADCLKSCLRXRPDRILRSSEAYDFYNVLCSGHKGTLTT
1c4oA1          LVLAPNKILAAQLAAEFRELFPENAVEYFISYYDYYQPEAYVPGKDLYIE-----KDASINPEIERLRHS
2axpA1          IKGSSFELAKSGNEKLFEHFNKLADEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRADPSVIKKRLRVR
1urjA           LQLFMPDFSREPFNANHRSIGEKFTYPLPRLLFEAVVGPAA--VALRSRNVDAVARAAAHLAFLPADITF
2gk3A1          -------------------------FIGESWHIHIHSKGYDSFTSSKYEEGATWLECLRKGGVDHTVQIA
1bmfA3          DGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCGKHALIIYD
1mjgM           KIEVIGPDIDQIPEGSKLPLGILVDIYGRKMQADFEGVLERRIHDFINYGEGLWHTGQRNINWLRVSKDA
1bgxT2          RVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKS----LLKALKEDGDAVIVVFDAKAPSFRHEAY
1xbtA1          YKCLVIKYAKTRALPACLLRDVAQEALGVAVIGIDEGQFFPDIVEFCE-----AMANAGKTVIVAALDGT
2v3jA1          GLLKKXGRDISETHQCLLTLLDSPINKAGKLQVYIQTSRGILIEVNPTVRIPRTFKRFSGLXVQLLHKLS
1dnpA2          ----------------------------------RLHDNLALAAACR-------NSSARVLALY-IATPR
1qhdA1          GPVFPPGMNWTDLITN--YSPSREDNLQRVFTVASIRSML------------------------------
1d6jA           RVHAYRLDGDNIRFGLNKDL-----GFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQ
1dhyA1          ------------------------------------------------------FAVKDVPAWD-HFLTK
1f8xA           ---------------------------------------------------------------PKKTIYF
1f2t.1          --------------------------------------------------------------VVWEGKER
1tmkA           KLLKFPERSTRIGGLINEYLTDDSFQLSDQAIHLLFSANRWEIVDKIKKDLLEGKNIVMDRYVYSGVAYS
1jb1A           ADDRVDVYQQDEQTIVGAAPPILSHLLEIRGLGIIDVXNLFGAGAVREDTTISLIVHLENWTPDQLIFDV
1np6A           IRPGLIKHTHHELRKAGAAQTIVASQQRWALMTETPDEEELDLQFLASRMDTSKLD------------LI
1zp6A1          VHFHSDD---LWGYIKHGRIDPWLPQSHQQNRXIXQIAADVAGRYAKEGYFVILDGVVRPDWLPLHYIVL
1ckvA           VNPWIKANGKIEVDCDEISELLGRQFNVYDFLVDVSSTIGRAYTL--GNKFTITSELMGL-DRKLEDY--
1sbxA           ---------------------------------------------------------------------F
1esmA           EHRRVELITTDGFLHPNQVL----------------KERGLXKKKGFPESYDXHRLVKFVSDLKSGVPNV
1ak2A1          LATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDK
1e6cA           VDTDIFMQHTSGMTVADVVAAGFRRRESEALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPQ
1f46A           HGSELNGELLLN-----SIQQAGFIFGDMNIYHRLSPDGSGPALFSLANMVKPGTFDPEMKDFTIFMQVP
1lw7A2          AWEYGREFVFEKLGGDEQAMQYSDYPQXALGHQRYIDYAV----RHSHKIAFIDT---------DFITTQ
1cr0A           GK-KVGLAMLEESVEETAEDLIGLHNRRLRQSDSLKREIIENGKFD--------QWFDELFGNDTFHLYD
2vgmA3          ----------------------------------------------------------------LLHLNK
1l7lA           WGPQGDREHPD-QGLICHDAFCGALVMKIGN---SGTIPVNTGLFRWVAPNNVQGAITLIY----NDVPG
1em8A           ----------------------------------------------------------------------
1jbkA           VPEGLKGRRVLALDMGALVARGEFEERLKGVLNDLAKQEGNVILFIDELHTMVGAMDAGNMLKPALALHC
1i1qA           GSYG--------------GAVGYFTAHGDLDTCIVIRSALVENGIATVQAGAGIVLDSVPQSEADETRNK
1o7d.2          -----------------------------------------------------RKLNISICPLTQTAERF
1j1zA2          ------------------SMDANLLHISEGGVLEDPWAEPPK--GMFRMTQDPEEAPDAPEYVEVEFFEG
1t3wA           ATLVPPLENLDENKLPGLGLFRELVNTCLSQPGLTTGQLLEHYRGTNNAATLEKLSXWDDIADKNI----
1v47A1          ----------------------------------------------------------------------
2fggA1          ------------------------------------------------------CQIDVLIEEH-DERTR
3cddA1          ------------------------------------------------------DNVKAARGRF-SWRQR
2gtlM1          GYG-VICDFNLGDDDHADVPSSLFVCAH-FNAQ-------------------------------------
1g6hA           GRVYFENKDITNKEPAELYHYGIVRTFQTPQPLEICPGESPLNSLFYKKWIPKEEEMVEKALKLSHLYDR
2pa7A1          -------------------------------------------------------------------LEQ
1a4iA2          ----------------------------------------------------------------------
1s9hA           CVNWTNENFPFNDCVDKWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQIDPTPVIV------TSNT
1zs3A1          -------------------------KPTAGAMLGHVLSNLFIENRLTQAGIYAKEYLREIAQREVEYFFK
2f9hA1          -------------TVTEIGKHAIDDSEKXIILFGTATDTLKQHAVIQSFPEKDQVTLAEGDIGDTNYTIT
1l3aA           GYSIYKGKAALTVE-PRSPEFSPLDSGAFKLSRGMVMLQFAPAAGVRQYDWSRKQVFSSIISLGTKDSCE
1vhhA           -----------------------------------------------------PNVAEKTLGASG---RY
1es6A2          ----------------------------------SFHPKLRPILLPNKADLTSPEKIQAIMTSLQDFPID
1ni3A1          ANYPYATIDPEEAVPDERFDWLCEAYKPKSRVPAFLFDIAGLTKGASTGVGLGNAFLSHVRAV--DAIYQ
1tljA           VDAEMPWDRKNSTIIFKNHLRITEQDLEDVLSKNQVRRLWLIVQGPIIHIYAKNIETGWDILKIAREAGF
1viaA           LDSDFLIEQKFNQKVSEIFEQKRENFFXADFFSSCEKACIATGGGFVNVSNLEKAGFCIYLKADFEYLKR
1fl9A           NVKSPTYTLVEEYNIAGKMIYHFDLYRLADPEELEYFNTDSICLIEWSEKGQGILPEADILVNIDYYDDA
2je6I3          GRIWAFSEEILIEAIRKIEN--------------------------------------------------
1uouA3          ----------------------------------------------------------------------
2ancF1          TQEAIEQVLATGVDVFLDIDWQGAQQIRQLPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYLIVN
1ckeA           GAIHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLR
1mi8A           ANHRFLTIDGWKRLDELSLKEHIALPRKSDISWSIVSITETGVEEVF-----------------------
1w1wA           AYVKAFNKLVESYKIDGKTVSYKLVFQGSPVELSRMFTVSDHLDAIYRELTGNAS-LTKYHATPPLKRFK
1g8yA           -AAQIAGGPDLLEVGELPTGPVIYLPAEDPPTAIHHRLHALGAHLSAEERQAVADGLLIQPLIGSL-PNI
1ovmA2          PVLHIVGAPGTAAQQRG-ELLHHTLGDGEFRHFYHMSEPITVAQAVLT----------------------
1e3mA2          IGSYVPAQKVEIGPIDRIFTRVGFXVEXTETANILHNATEYSLVLXDEIGRGTSTYDGL------SLAWA
1afrA           PQDFLPDPASDGF---------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1ii8.1          RIKDIKKDEFTKVG------------------------------------------------------LS
1iqrA2          ------------------------------------------------------LEALARGPVV-GLVVL
1l1oA           KNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLY---NEAVKIIHDFPQFYP-
1yvuA2          ----------------------------------FVLLNVAE--QVLAKTGNIPYKLKEIEGKVDAFVGI
1d8jA           -------------------------------LSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTL-DEILD
1e2hA           EPMVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDSPPPALTLIFDRHPIAALLC
3cddA2          ----------------------------------------------------------------------
1gm5A1          -------------------------FTSSLFLWGEALPTLLEEFLNELKNQVNTRRIHQLLKELDDPLLE
1yr6A1          KVAYVNLDTGVKELPYEPSIDVREFVTVEEIMREGYGPNGAIVESYEKFNEYLNKILRLEKENDYVLIDT
1b77A2          GKIVINGYNVEDSGLTRPKYSLTLTDYDGSNNFVINMANMKIQPGNYK---VMLAAKFESSQVSYVIAME
1jqjA3          ---TYSGAEMEGFNVSYVLDVLNALKCENVRMMLTDSVSSVQ----------------------------
1tueA           AVISFVNSTSHFWLEPLTDTKVAMLDDATTTCWTYFDTYMRNA---------------------------
1odfA           G---------EKSIGYASIDDFYLTHEDQLKLNEQFKNNKLLQGRGLPGTHDLQEVLNTIFNQDTVVLPK
1g31A           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1g8fA3          -----GGRYYKIFEHNNKTELLSLIQDFIGSGSGLIIPDQWEDDKDSVVGKQNVYLLDTSSSAD--IQLE
1cd5A           AECRQYEEKIRSY---------------------------------------------------------
1q3tA           GAMAATYMALKNLGVEELDQHPISFGRSETGDQLVFVGDVDITHPIRENEVTNHVSAIAAIPEVREKLVS
1yj5A2          VNRDTLGSWQRCVSSCQAALRQGKRVVIDNTNPDVPSRARYIQCRCFNFCATIEQARHNNRFREXTDPSH
1atrA1          YVAFTDTERLIGDAAKN-----------------------------------------------------
2gujA1          GRVTLYDVNFDSAKIASLDE--------------------------------------------------
1zbsA1          --------------------------------------------------------------------GD
1pgsA2          HTIAINNANTFQ--HQLGALGCSANPINNQSPGNWTPDRAGWCPGMAVPTRIDVLNNSLTGST-------
1t9hA2          GGLVADTPGFSSLEFTDIEEEELGYTFPDIRESSCKFRGCLHLKEPKCA----VKQAVEDGELKQYR-YD
1bccF           ------------------WYYNAAGFNKYGLMDDTIYENDDVKEAIRRLPENLYDDRMFRIKRALDLNMR
1mkyA1          VEWYGKTFKLVDTCGVFDNSQKXKEVTLNXIREADLVLFVVDGKRGITKEDESLADFLRKSTVDT-ILVA
1iioA           ----------------------------------------------------------------------
1xl3C1          ---------------------------------EFMGDIVALVHLANAFSLPTPEIXVRFYQDLXRMFRL
1tf7A1          PGVFV----TFEETPQDIIKNARSF--------GWDLAKLVDEGKLFILDASDPEGQEVVGGFDLSALIE
1jqjA2          ----------------------------------------------------------------------
1v37A           --------------------------------------------------------------------YP
1j90A           KWRNVNGVNLLELMYKDPKKW-AMPFQS------------------------------------------
1xkpA1          -----------------------------------VNQYLSXVPELEQXQNVSEQLXAYLEGXSEEPSEQ
1e6vC           ----------------------------------------------------------------------
1p5zB           RWCNVQSTNGGNVLQMMYEKPERWSF--------------------------------------------
1bifA1          -----IGVPTREFNVGQYRRDMVKTYKSFEFFLPDNEEGLKIRKQCALAALNDVRKLSEEGGHVAVF---
1heiB1          KVLVLNPSVGSPITYSTYGKFLADGGCSG-----------------------------------------
1ye8A1          RAIGFWTEEVRRTGF-------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           SARDLSGGQRQRLSLARTLSNPSSILLLDEITSALDPVSALEIEELIKRQHQEKKWTVMWVTHNMEQAKR
1b0uA           YPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRI-MQQLAEEGKTMVVVTHEMGFARH
1q3hA           GGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKL--MANKTRILVTSKMEHLR
1sgwA           KLGELSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVIISSREELS----
1l7vC           STNQLSGGEWQRVRLAAVVANPAGLLLLDEPXNSLDVAQQSALDKILSALCQ-QGLAIVXSSHDLNHTLR
1ji0A           LGGTLSGGEQQXLAIGRALXSRPKLLXXDEPSLGLAPILVSEVFEVIQKINQEGT-TILLVEQNALGALK
1ex6A           MQGVKSVKAIPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQAEGAHDKVIVNDDLDKAYK
1m3eA1          GGSPIKYNKDGSIAIASKPREVREFNGQHFILEEAIRGDFALVKAWKA--DQAGNVTFRKSARNFNLPXC
1nijA1          DPGPIIQTFFSHEVLCQRYLLDGVIALVDAVHADEQM----NQFTIAQSQVGYADRILLTKTDVAGEAEK
1e69A           KLSLLSGGEKALVGLALLFAKPSPFYVLDEVDSPLDDYNAERFKRLLKENSKHT--QFIVITHNKIVM-E
1t06A           VADKWIASGDMSAGWSWLLGNRKDNAFSESKISDMLEMVKDTIHHSPERTKSAMNNFLNTVAPLHEKAVE
1pf4A1          NGTSLSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQ--KNKTVLVIAHRLS-TIE
1jalA1          DPLDDIDTINTELALADLDSCERAIQRLQKRAKGGDKEAKFELSVMEKILPVLENAGMIRSVGLDKEELQ
2yyeA2          KNYLKSNLDNWKLILLSDPVTSGGLLFTINKEKLEKIDETA-------KELEVNYWIIGETIAENV----
1khbA1          TITSWKNKEWSSEDGEPCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLVYEALS--
1e9rA           RRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVT
1jjvA           MKQKLAEQTAPYTLFVVPLLIENKLTALCDRILVVDVSPQTQLARSANFEQI---QRIMNSQVSQQERLK
1pv4A3          --SITRLARAYNTVVPAVLTGGVDANALHRPKRFFGAARNVE------EGGSLTIIATALIDTGSKXDEV
2iqhA1          SALILRGSVAHKSCLPACVYGSAVASGYDFEREGYSL-------VGIDPFRLLQNSQVYSLIRPNENPAH
1mukA           LAGKIMLQDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLLPKDGRH----------LNTDIPPRMGW
1kgdA           VEPQALKVLRTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDIL--QRTYAHYFDLTIINNEIDETIR
1ffhA2          ILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARG
1ohcA1          IVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRDSCNFYITLLDCFHAVKKAMQ
2gx8A1          KGARVVGKLDDKVRKVAVLGGDGNKYINQAKFKGADVYVTGDMYYHVAHDAMMLGLNIVDPGHNVEKKQG
1n25A           VPKTLQARFVKQIDFRPKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPVAEFAQSIQSRIVEWKER
1udwA           ETVTVYPADVVLFEGILAFYSQ-EVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVK
1bs2A1          AHSRLRSVERNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPD-VLRNAIKTHEPTTVVTYLFKL---
1rkbA           GYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWI--KDHN------
1poiA           EWGISKEVRKTLDKVPDDKFKYIDNPFKPGEKVVAVPVPQVDV-AIIHAQQSPDGTVRIWGGKFQVDIAE
1qhlA           QFNSITDYHSLMARRLRSASDRSKFYRLIEASGGISSAITRSLRDYLLPE--------------------
1vplA           RVSTYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNA-REVRKILKQASQEGLTILVSSHNMLEVEF
2qgmA1          LKTIEPSKPFEDLKPLKKXIGNAQYVGLGENTHGSSEIFTXKFRLV-KYLVTEXGFTNFAXEEDWGNGLK
1grqA           RWRSFVGDLDVLWVGVRC-----DGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKE-SIE
1mm8A           PNVSRKAGAMQTVKLAQEFP----ELLAIEDTTSLSYRH--QVAEELGKLGSIQDKSRGWWVHSVLLLEA
1g6oA           LHAGSSEEAFIRLSSNSAARNIKFESLIEGFKDLIDXIVHINHHKQC-----------------------
1c4oA1          TTRASVSAIYGLGDPREYRARNLVGFVLFPATHYLSPEG---LEEILKEIEKEERVRYFEERGEVLYAQR
2axpA1          GDEYIEGKDIDILELYREVXSNAGLHTYSWDTGQWSSEIAKDIIFLVE----------------------
1urjA           TAFAGGFEQRLASVMAGDASIVSMAVFDEPPTDISAQDTAAARANAVGAYLARAAGLVGAMVFSTN----
2gk3A1          FPESIDELNRYDVIVISDIGSNTFLLQNETFYQLKIKP---NALESIKEYVKNGGGLLXIGGYLSFXGIE
1bmfA3          DLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAY--
1mjgM           VAKGFRFKNYGEILVAKMKEEFPAIVDRVQVTIFTDEAKVKEYMEVAREKYKEDDRMRGLTDETVDTCQS
1bgxT2          GGYKAGRAPTPEDFPRQLALIKELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQL
1xbtA1          FQRKPFGAILNLVPLAESV---------------------------------------------------
2v3jA1          IRSEEKLLKVIKNPITDHLPTKCRKVTLSFDAPVIRVQDYIEK------LDDDESICVFVGAXARGKDNF
1dnpA2          QWATHNMSPRQAELINALNGLQIALAEKGIPLLFREVDDFVASVEIVKQVCAENSVTHLFYNYQYEVNER
1qhdA1          ----------------------------------------------------------------------
1d6jA           LHEVATPGEETGLPFVEVYVDVPVEAPYEAPANPNYELPVQDAVKQIIDYLDTK----------------
1dhyA1          SVGLMAAGSAGDAALYRADQRAWRIAVQPGELDDLAYAGEVDDAAALERMADKLRQAGVAFTRGDEAL--
1f8xA           GAGWFTDRQNKAYKEAMEALKENPTIDLENSYVPLDNQYKGIRVDEHPEYLHDKVWATATYNNDLNG-IK
1f2t.1          PLTFLSGGERFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIP-QVILVSHDEE-LKD
1tmkA           AAKGTNGMDLDWCLQPDVGLLKPDLTLFLSTQFGDERYETVKFQE---------KVKQTFMKLLDKEIRK
1jb1A           PVPKITVGRNLAIIIEVAAXNFRAKSXGYDATKTFEKNLNHLIE--------------------------
1np6A           LVEGFKHEEIAKIVLFRDGAGHRPEELVIDRHVIAVASDPLNLDVALLDINDVEGLADFVVEWMQKQ---
1zp6A1          RTTAAEAIERCLDRGGDSLSDPLVVADLHSQFADLGAFEHHVLPVSGKDTDQALQSAINAL---------
1ckvA           ----------------------------------------------------------------------
1sbxA           XPSDRSTERCETVTISCFVVGGEKRLCL---PQILNSVLRDFSLQQINAVCDELHIYCSRCTADQLEILK
1esmA           TAPVYSHLIYDVIPDGDKTVVQPDILILEGLNVLQSGXDYPHDPHHVFVSDF-VDFSIYVDAPEDLLQTW
1ak2A1          LDSVIEFSIPDSLLIRRITGRLIHSDDNKKALKIRLEAYHTQTTPLVEYYSKRGIHSAIDASQTPDVVFA
1e6cA           AHQRPTLTGRPIAEEMEAVLREREALYQDVAHYVVDA--TQPPAAIVCE---------------------
1f46A           SYGDELQLFKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKDA-----------------
1lw7A2          AFCIQYEGKAHPFLDSXIKEYPFDVTILLKNN--------------------------------------
1cr0A           SFAEAETDRLLAKLAYMRSGLGCDVIILDHIS-IRKMID--NLMTKLKGFAKSTGVVLVVICHDLRALRQ
2vgmA3          DDDKAWYGE-KEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGG-KALVLSTLHSLGEE
1l7lA           TYGNNSGSFSVNIGKDQ-----------------------------------------------------
1em8A           -----------------------TFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYR
1jbkA           VGATTLDEYRQYIEKDAALERRFQKVFVAEPSVEDTI---------------------------------
1i1qA           -----ARAVLRAIATAH-----------------------------------------------------
1o7d.2          QVIVYNPLGRKVDWMVRLPVSKHVYLVKDPGGKIVPSDVVTIPSSDSQELLF--SALVPAVGFSIYSVSQ
1j1zA2          DPVAVNGERLSPAALLQRLN----EIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHARRAVESLT
1t3wA           --AEQTFTDSLNHXFDSLLELRQEELIARERTHGLSNEERLELWTLNQE---------------------
1v47A1          ----------PALEIGEDELDL--ENLATGAFFPVKGFMTREEALSVAHEMRLPTGEVWTILLQFREKPG
2fggA1          AKARLSWAGRQXVGVGLAR-----LDPADEPVAQIGDELA------IARALSDLANQLFALTSSDIEAST
3cddA1          FSKFTIKAAKADVTDSEIGRYRPLIIVNEEVTAEGAAKRGQWERQRIGKSNXAEYTVTGWRIPQTGKLWN
2gtlM1          ----------------------------------------------------------------------
1g6hA           KAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNH-VLELKAKGITFLIIEHRLDIVLN
2pa7A1          VLVCLNGSCRVILDDGNI----IQEITLDSPAVGLYVGPAVWHE---MHDFSSDCVMMVLASDYYDETDY
1a4iA2          ------------------------EILNGK---EISAQIRARLKNQVTQLKEQVPGFTPRLAILQVGNRD
1s9hA           NMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGVTKQEVKDFFRWAKDH-----------------
1zs3A1          IS-DLLLDENEIVPSTTEEFLKYHKFITEDPKAKYWT-----DEDLLESFIVDFQAQNMFITRAIKLANK
2f9hA1          KVGSFANSNLQSIAHSTLIFADAPTDEDDVIRNG-------VYLTPHQLPKITIGTTIDYL---------
1l3aA           FFHDPNKGRSDEGRVRKVLKVE---PLPDGSGHFFNLSVQNKLINLDENIYIPVEFAVLVSAFN------
1vhhA           EGKITRNSERFKELTPNYNPD---IIFKDEENTGADRLMTQRCKDKLNAVMNQWPGVKLRVTEGWDED-G
1es6A2          PTKNIMGIEVPETLVLKLTGGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPAS-----------
1ni3A1          VVRAFDDAEIIHVEGDVDPIRD--LSIIVDELLIKDAEFVEKHLEGLRKITSRGANTLEXKAKKEEQA--
1tljA           KHSGILATNQKGVLVELRTGIRMVHLLRESNTERVDKDKIKTLVNVCNEVLARGKQKMN-LLKD------
1viaA           PLFYDEIKAKKLYNERLSKYEQKANFILNIENKNIDELLS-EIKKVIK----------------------
1fl9A           RNIELIAQTNLGKNIISAFS--------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1uouA3          ------------------------------------REQEELLAPADGTVELVRALPLALVLHELGALRL
2ancF1          DDFDTALTDLKTIIRAERLRMSRQKQRHDALISKLL----------------------------------
1ckeA           RQRAFRELPGLIAD---GRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQVKGFSVNFERLLAEIKLVP
1mi8A           ----------------------------------------------------------------------
1w1wA           DMEYLSGGEKTVAALALLFAQPSPFFVLDEVDAALDITNVQRIAAYI-RRHRNPDLQFIVISLKFEKSDA
1g8yA           MAPEWFDGLKRAAEGRRLMVLDTLRRFHIEEENASGPMAQVIGRMEAIAADTGCSIVFL--HHAVVDNIR
1ovmA2          ----------------------------------------------------------------------
1e3mA2          CAENLANKIKAL---TLFATHYFELTQLPEKXE---GVANVHLDALEHGDTIAFXHSVQDGAASKSYGLA
1afrA           ------------------------ARQAKEHGDIKLA-------QICGTIAADEKRHETAYTKIVEKLFE
2vnuD1          ----------------------------------------------------------------------
1ii8.1          GGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIM-ERYLKKIPQVILVSHDEELK-D
1iqrA2          DPNNLKTTPRRRAWFLENVRA------LREAYRARGGALWVLEGLPWEKVPEAARRKAVYALTSHTPYGR
1l1oA           ----------------------------------------------------------------------
1yvuA2          DISRITRDGKTVNAVAFTKIFNSKGELVRYYLTSYPA----FGEKLT----EKAIGDVF-SLLEK-LGFK
1d8jA           ETQHLDIGLKQKQWLMTEALNNPKIEVIDGKYAFKPKYN-------------------------------
1e2hA           YPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAIRRVYGL
3cddA2          ----------PHELLARLAKQRG-VLLTSDTFGNLVI---------------------------------
1gm5A1          -NKDLEEKLQAFLDYVKE------IPNLPEARKRYRIQKSLEMIEKLRS---------------------
1yr6A1          PGQMETFLFHEFGVRLMENLPYPLVVYISDPEILKKPNDYCFVRFFALLIDLRLGATTIPALNKVDLLSK
1b77A2          ADSTHD----------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1odfA           YDKSQFKGEGDRCPTGQKIKLPVDIFILEGWFLGFNP---------------------------------
1g31A           ---------------LPIRAVGEYVILVSEPAQAGDEEVTESGLIIGKRVQGEVPELCVVHSVGPDVPEG
1dwmA           -------------------------------------KSGNMAAATVERENRNVH-AIVLKEGSAMTKDF
1g8fA3          SADEPISHIVQK----------------------------------------------------------
1cd5A           -------CVNHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIK-----------------
1q3tA           LQQEI-AQQGGIVMDGRDIGT---VVLPQAELKIFLVAS---VDERAERRYKE------------NIAKG
1yj5A2          APVSDXVXFSYRKQFEPPTLAEGFLEILEIPFRLQEHLDP-ALQRLYRQFSE------------------
1atrA1          --------QRQATKDAGTIAGLNVLRIINEPTAAAIAYG-------------------------------
2gujA1          ----------------------------------------------------------------------
1zbsA1          EGSGAVLGRLFIGSLLKGQXP---EGLCEAFLQEYGLTSADIIESVYRKPFPN---RFLAGFSPFIAQHL
1pgsA2          ----------------------------------------------------------------------
1t9hA2          HYVEFMTEIKDR----------------------------------------------------------
1bccF           QQILPKEQWTKYEEDVPYLEPYLKEVI-------------------------------------------
1mkyA1          NKAENLREFEREVKPELYSLGFGEPIP----VSAEHNINLDTIIKKLEEKGLDLE---------------
1iioA           ----LKASDAGQVLTADDFKSA-EEVADTIVNKA------------------------------------
1xl3C1          FPLGVFSDEEQRQNLLQMCQNAIDMAIESE----------------------------------------
1tf7A1          RINY----AIQKYRARRVSIDSVTSVFQQYDASSVVRRELFR----LVARLKQIGATTVMTTERIEEYGP
1jqjA2          ----TVATDGHRLAVCSMPIGQS----LPSHSVIVPRKGVIELMRMLDGGDNP---LRVQIGSNNIRA-H
1v37A           ELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGV-VRA
1j90A           ----------------------------------------------------------------------
1xkpA1          FXMLCGLRDALXGR-------PELAHLSHLVEQAL------------VSMAEEQGETIVLGARITPEAYR
1e6vC           -NRRKYMNPNYELKKLREIPDEDIVRLMGHREPGEEYPSVHPLEEMEEPECPIRE------LVEPTEGAK
1p5zB           ----------------------------------------------------------------------
1bifA1          ---DATNTTRERRAMIFNFQNGYKTFFVE--SICVDPEVIAANIVQVKLGSPDYV---------------
1heiB1          ----------------------------------------------------------------------
1ye8A1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IADTIWFMADGRLLEIAETDTFFSAPQHEAAKEFLKGGTR
1b0uA           VSSHVIFLHQGKIEEEGDPEQVFGNPQSPRLQQFLKG---
1q3hA           KADKILILHQGSSYFYGTFSELQ-SLRPDFSSKLMG----
1sgwA           YCDVNENLHKY-----------------------------
1l7vC           HAHRAWLLKGGKXLASGRREEVLTPPNLAQA---------
1ji0A           VAHYGYVLETGQIVLEGKASELLDNE--------------
1ex6A           ELKDFIFA--------------------------------
1m3eA1          KAAETTVVEVEEIVDIGSFAPEDIHIPKIYVHRLVKGE--
1nijA1          LHERLARINARAPVYTVTHGLLFNTNGFMLEENVV-----
1e69A           AADLLHGMVNG-----------------------------
1t06A           IAKEVGIVEVKR---DNKKSSLLNASES------------
1pf4A1          QADEILVVDEGEIIE-------------------------
1jalA1          AIKSYNFLTLANVNEDGFENNPYLDRVREIAAKEG-----
2yyeA2          ----------------------------------------
1khbA1          -WQHGVFVGAAMRSEAKIIMHDPFAMRP------------
1e9rA           MPDGDFSIRSWLEDPNGGNLFITWREDM------------
1jjvA           WADDVINNDAELAQNLPHLQQKVLELHQFYLQQAEN----
1pv4A3          IYEEFKGTGNXELHLSRK----------------------
2iqhA1          KSQLVWMACHSAAFEDLRVSSFIRGTKVVPRGKLS-----
1mukA           LRAILRFLGAGMVMTAT-------GVAVDIYLEDIHGGGR
1kgdA           HLEEA-----------------------------------
1ffhA2          AALSARHVTGKPIYFA------------------------
1ohcA1          ----------------------------------------
2gx8A1          VQKQLQEKVDAKKLNVHIASQLHTDPFI------------
1n25A           LDKEFSLSVYQKMKF-------------------------
1udwA           PAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQ----
1bs2A1          THQVSSCYDVLWVAGQTEELATARLALYGAARQVLY----
1rkbA           ----------------------------------------
1poiA           AAKYTIVTCE------------------------------
1qhlA           ----------------------------------------
1vplA           LCDRIALIHNGTIVETGTVEELKERYKAQNIEEVF-----
2qgmA1          LNEYIQTGKGN-----------------------------
1grqA           CAWAI-----------------------------------
1mm8A           TTFRTVGLLHQEWWMRPDDPADADEKESGKWLAA------
1g6oA           ----------------------------------------
1c4oA1          LKERTLYD--------------------------------
2axpA1          ----------------------------------------
1urjA           ----------------------------------------
2gk3A1          AKANYKNTVLAEVLPVIXLDGDDRVEKPEGICAE------
1bmfA3          IPTNVISITDGQIFLETELFYKGIRPAINVGLSV------
1mjgM           FANHVCIVTPERVGLCGAVSWLDAKASYEINHAGP-----
1bgxT2          LSDRIHVLHPEGYLI-------------------------
1xbtA1          ----------------------------------------
2v3jA1          AVDEKVGLSNYPL---------------------------
1dnpA2          ARDVEVERALRNVVCEGFDDSVILPPGAVMTGNH------
1qhdA1          ----------------------------------------
1d6jA           ----------------------------------------
1dhyA1          MQQRKVMGLLCLQDPFGLPLEIYYGPAEIFHEPFLPS---
1f8xA           TNDIMLGVYIPDEEDVGLGMELGYALSQG-----------
1f2t.1          AADHVIRIS-------------------------------
1tmkA           GDESITIVDVTNKGIQEVEALIWQIVEPVLSTH-------
1jb1A           ----------------------------------------
1np6A           ----------------------------------------
1zp6A1          ----------------------------------------
1ckvA           ----------------------------------------
1sbxA           VXGILPFAPSCGLITKTDAERLCNALLY------------
1esmA           YINRFLKFREGAFTDPDSYFHNYAKLTKEEAIKTA-----
1ak2A1          SILAA-----------------------------------
1e6cA           ----------------------------------------
1f46A           ----------------------------------------
1lw7A2          ----------------------------------------
1cr0A           LSDTIIALERNQLVLVRILKCRFTGDTGIA----------
2vgmA3          LDQLTGIACILK----------------------------
1l7lA           ----------------------------------------
1em8A           LDEALWARPAESFV--------------------------
1jbkA           ----------------------------------------
1i1qA           ----------------------------------------
1o7d.2          -MPRDLVIQNEYL---------------------------
1j1zA2          LDREVLHQRDMLSPKYAELVYFWYAPEREALQAY------
1t3wA           ----------------------------------------
1v47A1          PGNTVALLHGGERVALARAVFGTDSETHPGVARLYGKG--
2fggA1          ----------------------------------------
3cddA1          INTLVPVIDEI---XGLDEEXLIASILFSEDD--------
2gtlM1          ----------------------------------------
1g6hA           YIDHLYVMFNGQIIAEGRGEEEIKNVLSD-----------
2pa7A1          IRQYDNFKKYIAKI--------------------------
1a4iA2          DSNLYINVKLKAAEEIGIKATHIKLPRTTTESEVM-----
1s9hA           ----------------------------------------
1zs3A1          EEK-------------------------------------
2f9hA1          ----------------------------------------
1l3aA           ----------------------------------------
1vhhA           HHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVE-----
1es6A2          ----------------------------------------
1ni3A1          ----------------------------------------
1tljA           ----------------------------------------
1viaA           ----------------------------------------
1fl9A           ----------------------------------------
2je6I3          ----------------------------------------
1uouA3          GVGAELLVDVGQRLRRGTPWHRDGPALSGPQSRAL-----
2ancF1          ----------------------------------------
1ckeA           AADALVLDSTTLSIE-------------------------
1mi8A           ----------------------------------------
1w1wA           L---------------------------------------
1g8yA           WQSYLSSMTSAEAEEWGVDDDQRRFFVRFGVSKA------
1ovmA2          ----------------------------------------
1e3mA2          VAA-------------------------------------
1afrA           IDPDGTVLAFADMMRKKISMPAH-----------------
2vnuD1          ----------------------------------------
1ii8.1          AADHVIRISLENGSSKVE----------------------
1iqrA2          YRDGRVREA-------------------------------
1l1oA           ----------------------------------------
1yvuA2          KGSKIVVHRDGRLYR-------------------------
1d8jA           ----------------------------------------
1e2hA           LANTVRYLQCGGSWREDWGQLSGPRPHIGDT---------
3cddA2          ----------------------------------------
1gm5A1          ----------------------------------------
1yr6A1          ERHRKYFEDIDYLTARLKLDPSMQGLMAYKMCSMM-----
1b77A2          ----------------------------------------
1jqjA3          ----------------------------------------
1tueA           ----------------------------------------
1odfA           ----------------------------------------
1g31A           FCE----VGDLTSLPVGQ---IRNVPHPFV----------
1dwmA           RCDRVWVIVNDHGVVT------------------------
1g8fA3          ----------------------------------------
1cd5A           ----------------------------------------
1q3tA           IETDL----ETLKKEIAARD--------------------
1yj5A2          ----------------------------------------
1atrA1          ----------------------------------------
2gujA1          ----------------------------------------
1zbsA1          DIPAVYSLVQN-----------------------------
1pgsA2          ----------------------------------------
1t9hA2          ----------------------------------------
1bccF           ----------------------------------------
1mkyA1          ----------------------------------------
1iioA           ----------------------------------------
1xl3C1          ----------------------------------------
1tf7A1          IARYGVFVSDNVV---------------------------
1jqjA2          VGDFIFTS---KLVD-------------------------
1v37A           VLRALGEDGLVPPGSA------------------------
1j90A           ----------------------------------------
1xkpA1          ESQSGVNPLQPLRDTYRDAVMGY-----------------
1e6vC           AGDRIRYIQFTDSVYFAPIHPYI-----------------
1p5zB           ----------------------------------------
1bifA1          ----------------------------------------
1heiB1          ----------------------------------------
1ye8A1          ----------------------------------------