[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for bsub0:CAB13391.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1e8cA3.bssp"
#ERROR : Can't open dsspfile "1e0dA3.bssp"
#ERROR : Can't open dsspfile "1gg4A4.bssp"
#ERROR : Can't open dsspfile "1e8cA2.bssp"
#ERROR : Can't open dsspfile "1fgsA2.bssp"
#ERROR : Can't open dsspfile "1gqqA3.bssp"
#ERROR : Can't open dsspfile "1j6uA2.bssp"
#ERROR : Can't open dsspfile "1j6uA3.bssp"
#ERROR : Can't open dsspfile "1o5zA2.bssp"
#ERROR : Can't open dsspfile "1gqqA2.bssp"
#ERROR : Can't open dsspfile "1gg4A3.bssp"
#ERROR : Can't open dsspfile "1e8cA1.bssp"
#ERROR : Can't open dsspfile "1gg4A1.bssp"
#ERROR : Can't open dsspfile "1o5zA1.bssp"
#ERROR : Can't open dsspfile "1u1iA1.bssp"
#ERROR : Can't open dsspfile "1j3lA.bssp"
#ERROR : Can't open dsspfile "1fgsA1.bssp"
#ERROR : Can't open dsspfile "2g0tA1.bssp"
#ERROR : Can't open dsspfile "1bfdA2.bssp"
#ERROR : Can't open dsspfile "1ozfA2.bssp"

## Summary of PDB Search
:494
    4e-56  31%  1e8cA3 [c.72.2.1] UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMATE--2,6-
    2e-36  26%  1e0dA3 [c.72.2.1] UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
    7e-34  22%  1gg4A4 [c.72.2.1] UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMYL-2,6- A:99
    6e-33  46%  1e8cA2 [c.59.1.1] UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMATE--2,6-
    6e-33  21%  1fgsA2 [c.72.2.2] FOLYLPOLYGLUTAMATE SYNTHETASE A:1 -- 296
    1e-31  20%  1gqqA3 [c.72.2.1] UDP-N-ACETYLMURAMATE-L-ALANINE LIGASE A:107 --
    2e-28  28%  1j6uA2 [c.59.1.1] UDP-N-ACETYLMURAMATE-ALANINE LIGASE MURC A:296 --
    4e-27  23%  1j6uA3 [c.72.2.1] UDP-N-ACETYLMURAMATE-ALANINE LIGASE MURC A:89 --
    4e-27  23%  1o5zA2 [c.72.2.2] FOLYLPOLYGLUTAMATE SYNTHASE/DIHYDROFOLATE A:-2 --
    1e-25  15%  1gqqA2 [c.59.1.1] UDP-N-ACETYLMURAMATE-L-ALANINE LIGASE A:322 --
    6e-25  34%  1gg4A3 [c.98.1.1] UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMYL-2,6- A:1
    1e-21  33%  1e8cA1 [c.98.1.1] UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMATE--2,6- A:3
    7e-21  14%  1gg4A1 [c.59.1.1] UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMYL-2,6- A:313
    7e-20  19%  1o5zA1 [c.59.1.2] FOLYLPOLYGLUTAMATE SYNTHASE/DIHYDROFOLATE A:294
    2e-12  10%  1u1iA1 [c.2.1.3] MYO-INOSITOL-1-PHOSPHATE SYNTHASE A:1 -- 227 A:333
    6e-12  17%  1j3lA  [c.8.7.1] DEMETHYLMENAQUINONE METHYLTRANSFERASE
    8e-09  15%  1fgsA1 [c.59.1.2] FOLYLPOLYGLUTAMATE SYNTHETASE A:297 -- 425
    5e-05  32%  2g0tA1 [c.37.1.10] CONSERVED HYPOTHETICAL PROTEIN A:1 -- 338
    6e-04  16%  1bfdA2 [c.36.1.5] BENZOYLFORMATE DECARBOXYLASE A:2 -- 181
    8e-04  17%  1ozfA2 [c.36.1.5] ACETOLACTATE SYNTHASE, CATABOLIC A:7 -- 187
:494

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxPSVNDSQDPEITSIEMDSREVKKGSLFVCVKGYTVDGHDFAQKAVENGAAAIVAERE
1e8cA3          ----------------------------------------------------------------------
1e0dA3          ----------------------------------------------------------------------
1gg4A4          ----------------------------------------------------------------------
1e8cA2          ----------------------------------------------------------------------
1fgsA2          ----------------------------------------------------------------------
1gqqA3          ----------------------------------------------------------------------
1j6uA2          ----------------------------------------------------------------------
1j6uA3          ----------------------------------------------------------------------
1o5zA2          ----------------------------------------------------------------------
1gqqA2          ----------------------------------------------------------------------
1gg4A3          --------------------DITLDAVTTDTRKLTPGCLFVALKGERFDAHDFADQAKAGGAGALLVSRP
1e8cA1          -------------PWVPDAPSRALREXTLDSRVAAAGDLFVAVVGHQADGRRYIPQAIEAKDEATDGEIR
1gg4A1          ----------------------------------------------------------------------
1o5zA1          ----------------------------------------------------------------------
1u1iA1          ----------------------------------------------------------------------
1j3lA           ----------------------------------------------------------------------
1fgsA1          ----------------------------------------------------------------------
2g0tA1          ---------------------------------------------------EFLKIAHENG---------
1bfdA2          ----------------------------------------------------------------------
1ozfA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VDVNVPVIIVRQSLRALSVLSDAFYGQPTKKLQLIGITGTNGKTSTTHMVDEILKKAGKRTGLIGTMYMK
1e8cA3          ---------------------------PSDNLRLVGVTGTNGKTTTTQLLAQWSQLLGEISAVXGTVGNG
1e0dA3          -------------------------FCREAQAPIVAITGSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLP
1gg4A4          ---------------------------------VVALTGSSGKTSVKEXTAAILSQCGNTLYTAGNLNND
1e8cA2          ----------------------------------------------------------------------
1fgsA2          --------------RILTLL--HALGNPQQQGRYIHVTGTNGKGSAANAIAHVLEASGLTVGLYTSPFIM
1gqqA3          ----------------------QMLAEIMRFRHGIAVAGTHGKTTTTAMISMIYTQAKLDPTFVS-----
1j6uA2          ----------------------------------------------------------------------
1j6uA3          -----------------------------EKKEEFAVTGTDGKTTTTAXVAHVLKHLRKSPTFLGGIXDS
1o5zA2          ----------------------SKLGNPHLEYKTIHIGGTNGKGSVANMVSNILVSQGYRVGSYYSPHLY
1gqqA2          ----------------------------------------------------------------------
1gg4A3          LDIDLPQLIVKDTRLAFGELAAWVRQQ-------------------------------------------
1e8cA1          EXHGVPVIYLSQLNERLSALAGRFYHE-------------------------------------------
1gg4A1          ----------------------------------------------------------------------
1o5zA1          ----------------------------------------------------------------------
1u1iA1          ------------------------------KVWLVGAYGIVSTTAMVGARAIERGIAPKI----GLVSEL
1j3lA           ----------------------------------------------------------------------
1fgsA1          ----------------------------------------------------------------------
2g0tA1          ----TRIIDIRIPPLELDVLRGGIYRKKIKV---VGVFGTDGKRTTAVQLWERALEKGIKAGFLAT----
1bfdA2          ----------------------------------------------------------------------
1ozfA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IGDETLPVKNTTPESVTLQKTFKKMNDKHVDTAIMEVSSHALSLGRVHGCDYDIAVFTNLTQDHLDYHKT
1e8cA3          LLGKVIPTENTTGSAVDVQHELAGLVDQGATFCAXEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGD
1e0dA3          ALM---------------------LLDDECELYVLELSSFQL--ETTSSLQAVAATILNVTEDF-----G
1gg4A4          IGV--------------PXTLLRLTPEYDYAVIELGANHQGEIA--------WTVSLTRPEAALVNNLAS
1e8cA2          ----------------------------------------------------------------------
1fgsA2          IDHEPIPDFNVTEFEFITALAYWYFRQRQVDVAVIEVGDS------TNVITPVVSVLTEVALDTI-----
1gqqA3          -------------------------------------RYLIAEADEFLHLQPMVSVVTNMEFEKMKATYV
1j6uA2          ----------------------------------------------------------------------
1j6uA3          LEHG--------------------NYEKGNGPVVYELDESEEFFSEFSP---NYLIITNARGDHLEYGNS
1o5zA2          ISEEDVPILNELDKEEIFSPSFLYFAEKNVDIAVLEVGLGGR-LDATNVVFPLCSTIVTVD------RYT
1gqqA2          ----------------------------------------------------------------------
1gg4A3          ----------------------------------------------------------------------
1e8cA1          ----------------------------------------------------------------------
1gg4A1          ----------------------------------------------------------------------
1o5zA1          ----------------------------------------------------------------------
1u1iA1          PHFEGIEKYAP----------------FSFEFGGHEIRLLSNAYEAAKEHWELNRHFDREILEAVKSDLE
1j3lA           ----------------------------------------------------------------------
1fgsA1          ----------------------------------------------------------------------
2g0tA1          ----------------------------------------------------------------------
1bfdA2          ----------------------------------------------------------------------
1ozfA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           MDEYRHAKSLLFSQLGGAFNHEHPKRAVLNADDEASAYFEKVTAAHISTYGIKNDADVMAKNISITAQGT
1e8cA3          XEHYEAAXWLLYSEHHC-------GQAIINADDEVGRRWLAKLPDAVAVSXEDHGRWLKATEVNYHDSGA
1e0dA3          LQQYRAAKLRIYENAK---------VCVVNADDA---LTMPIADERCVSFGVNMGDYHLNHQQ----GET
1gg4A4          LAGVAKAKGEIFSGL------PENGIAIXNADNDWLNWQSVIGSRKVWRFSPAANSDFTATNIHVTSHGT
1e8cA2          ----------------------------------------------------------------------
1fgsA2          -TAIAKHKAGII---------KRGIPVVTGNLVPDAAAVVAAKVATTGSQWLRFDRDFSVPKAKLHGWGQ
1gqqA3          KFLHNLPFY---------------GLAVMCADDPVLMELVPKVGRQVITYGFSEQADYRIEDYEQTGFQG
1j6uA2          ----------------------------------------------------------------------
1j6uA3          LTRYRSAFEKISRNTD---------LVVTFAEDELTSHLDVTFGVKKGTYTLEXRSAS--------RAEQ
1o5zA2          IEQIAWEK-------SGIIKERVPL--VTGERKREALKVMEDVARKKSSRMYVIDKDFSVKVKSLKLHEN
1gqqA2          ----------------------------------------------------------------------
1gg4A3          ----------------------------------------------------------------------
1e8cA1          ----------------------------------------------------------------------
1gg4A1          ----------------------------------------------------------------------
1o5zA1          ----------------------------------------------------------------------
1u1iA1          GIVARKGTALNCGSGIKELGDIKTLEGEGLSLAEMVSRIEEDIKSFADDETVVINVASTEPLP-------
1j3lA           ----------------------------------------------------------------------
1fgsA1          ----------------------------------------------------------------------
2g0tA1          ----------------------------------------------------------------------
1bfdA2          ----------------------------------------------------------------------
1ozfA2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SFDLVTNKGTKHITMSLVGQFNVYNVLAAVATCIAAGIPFEIITEAVEELHGVRGRFELVNQQQEFPVIV
1e8cA3          TIRFSSSWGDGEIESHLXGAFNVSNLLLALATLLALGYPLADLLKTAARL--------------------
1e0dA3          WLRVKGEKVLNVKEMKLSGQHNYTNALAALALADAAGLPRASSLKALTT---------------------
1gg4A4          EFTLQTPTGSVDVLLPLPGRHNIANALAAAALSXSVGATLDAIKAGLANLKA------------------
1e8cA2          ----------------------------------------------------VCGRXEVFTAPGKPTVVV
1fgsA2          RFTYEDQDGRSDLEVPLVGDYQQRNMAIAIQTAKVYALTPQNIRQGLAASH-------------------
1gqqA3          HYTVICPNNRINVLLNVPGKHNALNATAALAVAKEEGIANEAILEALADFQ-------------------
1j6uA2          ---------------------------------------------------GVHRRFSIADPETNIYVID
1j6uA3          KAXVENGKRYLELKLKVPGFHNVLNALAVIALFDSLGYDLAPVLEALEEF--------------------
1o5zA2          RFDYCGENTFEDLVLTMNGPHQIENAGVALKTLEATGLPLKAIREGLKN---------------------
1gqqA2          ---------------------------------------------------GAGRRFDQLGENGKVRLVD
1gg4A3          ----------------------------------------------------------------------
1e8cA1          ----------------------------------------------------------------------
1gg4A1          ----------------------------------------------------VPGRLFPIQLAENQLLLD
1o5zA1          ------------------------------------------------------GRFEILEKNGKM-YIL
1u1iA1          ----------------------------------------------------------------------
1j3lA           -------------------------------------------------------------------RTL
1fgsA1          ------------------------------------------------------ARLEKISDTPL--IVI
2g0tA1          ----------------------------------------------------------------------
1bfdA2          ------------------------NAMGALSNAWNSHSPLIVTAGQQTAMIGVEALLTNVDAANLPRPLV
1ozfA2          ---------------------GCSNLITGMATANSEGDPVVALGGAVKRADKAKQVHQSMDTVAMFSPVT


                         .         .         .         .         *         .         .:420
query           DYAHTPDSLENVLETCRDMTEGKLFVVVGCGGDRDKTKRPKMAKIAVELADEPIFTSDNPRSEDPRAILR
1e8cA3          ----------------------------------------------------------------------
1e0dA3          ----------------------------------------------------------------------
1gg4A4          ----------------------------------------------------------------------
1e8cA2          DYAHTPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLXGAIAEEFADVAVVTDDNPRTEEPRAIIN
1fgsA2          ----------------------------------------------------------------------
1gqqA3          ----------------------------------------------------------------------
1j6uA2          DYAHTPDEIRNLLQTAKEVFENEKIVVIFQ------PHRGNFAK-ALQLADEVVVTEVYDSGKXIWDSLK
1j6uA3          ----------------------------------------------------------------------
1o5zA2          ----------------------------------------------------------------------
1gqqA2          DYGHHPTEVGVTIKAAREGGDKRIVMIFQPHRYSRTRDLFDDFVQVLSQVDALIMLDVYAAGEAPIVGSK
1gg4A3          ----------------------------------------------------------------------
1e8cA1          ----------------------------------------------------------------------
1gg4A1          DYNANVGSXTAAVQVLAEXPGYRVLVVGDLGAESEACHVQVGEAAKAAGIDRVLSVGKQSH---------
1o5zA1          DGAHNPHGAESLVRSLKLYFGEPLSLVIGILDDKNR--EDILRKYTGIFERVIVTRVPSPRMKDMNSLVD
1u1iA1          ----------------------------------------------------------------------
1j3lA           RVFEDNALVRKVLEEEG---AGQVLFVDGGGSLRTALLGGNLARRAWEKGWAGVVVHGAVRDTEE---LR
1fgsA1          DGAHNPDGINGLITALKQLFSQPITVIAGYAAMADRLTAAFS-------TVYLVPVPGTPRGRLKDSWQE
2g0tA1          ----------------------------------------------------------------------
1bfdA2          KWSYEPASAAEVPHAMS-----------------------------------------------------
1ozfA2          KYAIEVTAPDALAEV-------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           DMEAGVENAYYHSIANREQAIFFAIANAKKGDVVLIAGKGHETYQQIGNETFDFDDAEVAARAIVELNKx
1e8cA3          ----------------------------------------------------------------------
1e0dA3          ----------------------------------------------------------------------
1gg4A4          ----------------------------------------------------------------------
1e8cA2          DILAGLDAGHAKVXEGRAEAVTCAVXQAKENDVVLVAGKGHEDYQIVGNQRLDYSDRVTVARLLGVIAR-
1fgsA2          ----------------------------------------------------------------------
1gqqA3          ----------------------------------------------------------------------
1j6uA2          SLGKEAY--FVEKLPELEKVISVSFLFVGAGDIIYSSRRFVERYQSS-----------------------
1j6uA3          ----------------------------------------------------------------------
1o5zA2          ----------------------------------------------------------------------
1gqqA2          SLCRSIRNLGPILVSDTSQLGDVLDQIIQDGDLILAQGAG------------------------------
1gg4A3          ----------------------------------------------------------------------
1e8cA1          ----------------------------------------------------------------------
1gg4A1          AISTASGVGEH--FADKTALITRLKLLIAEQQVITILVKG------------------------------
1o5zA1          NVEVIEDPLEAIESTERATVVTGSLFLVGYVREFLTTGKINEEWK-------------------------
1u1iA1          ----------------------------------------------------------------------
1j3lA           EVPIGLLALAATPKKSAKEGKGEVDVPLKVLGVEVLPG--------------------------------
1fgsA1          ALAASL--------------------NDVPDQPIVITGSLYLASAVRQTL--------------------
2g0tA1          ----------------------------------------------------------------------
1bfdA2          ----------------------------------------------------------------------
1ozfA2          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxx
1e8cA3          ----
1e0dA3          ----
1gg4A4          ----
1e8cA2          ----
1fgsA2          ----
1gqqA3          ----
1j6uA2          ----
1j6uA3          ----
1o5zA2          ----
1gqqA2          ----
1gg4A3          ----
1e8cA1          ----
1gg4A1          ----
1o5zA1          ----
1u1iA1          ----
1j3lA           ----
1fgsA1          ----
2g0tA1          ----
1bfdA2          ----
1ozfA2          ----