[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for bsub0:CAB13612.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2onfA1.bssp"
#ERROR : Can't open dsspfile "1nyeA.bssp"
#ERROR : Can't open dsspfile "1lqlA.bssp"
#ERROR : Can't open dsspfile "1n2fA.bssp"
#ERROR : Can't open dsspfile "1ml8A.bssp"
#ERROR : Can't open dsspfile "2oplA1.bssp"
#ERROR : Can't open dsspfile "2d7vA1.bssp"

## Summary of PDB Search
:150
    5e-29  23%  2onfA1 [d.227.1.1] HYPOTHETICAL PROTEIN TA0195 A:1 -- 139
    2e-24  21%  1nyeA  [d.227.1.1] OSMOTICALLY INDUCIBLE PROTEIN C
    9e-21  20%  1lqlA  [d.227.1.1] OSMOTICAL INDUCIBLE PROTEIN C LIKE FAMILY
    9e-20  24%  1n2fA  [d.227.1.1] ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN
    1e-19  20%  1ml8A  [d.227.1.2] HYPOTHETICAL PROTEIN (CRP REGION)
    5e-19  19%  2oplA1 [d.227.1.1] HYPOTHETICAL PROTEIN A:4 -- 185
    1e-11  16%  2d7vA1 [d.227.1.1] HYPOTHETICAL PROTEIN VCA0330 A:7 -- 161
:150

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MADHHFYLKANWPGNRNDVGTIESGNLITSISIPKEMDGPGEGTNPDEMLLGAAATCYIITLAAMMERSG
2onfA1          ---HVYESDVSWIDDRR--TEVSVGDHRIEVDSPPEFGGPEGQLYPETLFPSVLASCLLTTFLEFKDRXG
1nyeA           --TIHKKGQAHWEGDIKGTVSTESGVLNQQPYGFNTRFEGEKGTNPEELIGAAHAACFSMALSLMLGEAG
1lqlA           --------TAVLNEDSS--MTAISDQF--QITLDARPKHTAKGFGPLAALLSGLAACELATANLMAPAKM
1n2fA           --KALYTATATATGGRDGRAVSSDGVLDVKLSTPREMGGQGGATNPEQLFAAGYSACFIGAMKFVAGQRK
1ml8A           --------RVKWVEGLTFLGESASGHQI-----LMDGNSGDKAPSPMEMVLMAAGGCSAIDVVSILQKGR
2oplA1          IAQFKFRATNQWXGGTHNQATIKRKPXVFDLDEPPVLLGENRGANPVEYLLVALSGCLTTSLVAHAAARG
2d7vA1          -SXSEHSAIVTWKRKRAHTWEFDGGSKILASASPHVVLSVEANVDPEEAFVAALSSCHXLVFLSIAAKQR


                         .         .         *         .         .         .         .:140
query           LEKEDLQMESEGIVNVTKGVFTYKKIIHRPSVVLKHDASQDDVALAHKLCKKAESSCMISRAIQGNVELQ
2onfA1          INLKSWNSHVTAELGPSEKGFK----FHRIKIHVKIGVNDEDKEKIPRAXQLAEKYCFISRAIRNNVEE-
1nyeA           FTPTSIDTTADVSLDKVDAGFAITKIALKSEVAVP-GIDAST---FDGIIQKAKAGCPVSQVLKAEITLD
1lqlA           ITINKLLMNVTGSRSTTDGYFGLREI--NLHWEIHSPNSETE---IKEFIDFVSKRCPAHNTLQGVSQLK
1n2fA           QTPADASITGKVGIGQIPGGFGLE-------VELHINLPGMEREAAEALVAAAHQVCPYSNATRGNIDVR
1ml8A           QDVVDCEVK----LTSERRERLFTHINLHFIVTGR-DLKDAAVARA--VDLSAEKYCSVALMLEKAVNIT
2oplA1          IALRGVKSRYEGDIDLRGGLSEEVPVGYREIRVFFSIDADLTDGQKEELIRXAQKYSPVYNTVAKPVPVA
2d7vA1          YLVESYTDNAVGILGKNSKGTSVTKVVLRPQVVFSGTSKPTLQQLEKXH-HLAHENCFIANSVETEVVTE


                         +         .         .         .         .         *         .:210
query           LEASVKLGxx
2onfA1          ----------
1nyeA           YQ--------
1lqlA           INVNVTLV--
1n2fA           LNVSV-----
1ml8A           HSYEV-----
2oplA1          VLL-------
2d7vA1          I---------