[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for bsub0:CAB13622.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1pemA2.bssp"
#ERROR : Can't open dsspfile "1r1rA2.bssp"
#ERROR : Can't open dsspfile "1l1lA.bssp"
#ERROR : Can't open dsspfile "1pemA1.bssp"
#ERROR : Can't open dsspfile "1r1rA1.bssp"
#ERROR : Can't open dsspfile "1auvA1.bssp"
#ERROR : Can't open dsspfile "2b3wA1.bssp"
#ERROR : Can't open dsspfile "1h7zA.bssp"

## Summary of PDB Search
:700
    e-133  47%  1pemA2 [c.7.1.2] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 2 ALPHA A:175
    e-127  23%  1r1rA2 [c.7.1.2] RIBONUCLEOTIDE REDUCTASE R1 PROTEIN A:222 -- 737
    e-103  12%  1l1lA  [c.7.1.4] RIBONUCLEOSIDE TRIPHOSPHATE REDUCTASE
    3e-39  35%  1pemA1 [a.98.1.1] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 2 ALPHA A:13
    7e-20  14%  1r1rA1 [a.98.1.1] RIBONUCLEOTIDE REDUCTASE R1 PROTEIN A:4 -- 221
    2e-15  15%  1auvA1 [c.30.1.5] SYNAPSIN IA A:112 -- 213
    3e-15  15%  2b3wA1 [d.336.1.1] HYPOTHETICAL PROTEIN YBIA A:1 -- 160
    1e-05  13%  1h7zA  [b.21.1.1] ADENOVIRUS FIBRE PROTEIN
:700

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxPKWIQLNNEIMIXXXXXXXXXXXXEAVHSYFVDYINQNTVFFHNLKEKLDYLVENQYYEEEFLS
1pemA2          ----------------------------------------------------------------------
1r1rA2          ----------------------------------------------------------------------
1l1lA           -----------------------------------------------LTEEAERLYKLIYGLGATPSGR-
1pemA1          ------MDYHALNAMLNLYDKAGHIQFDKDQAIDAFFATHVRPHSVTFASQHERLGTLVREGYYDDAVLA
1r1rA1          -------------------------------RLAIFHLRKKAYGQFEPPALYDHVVKMVEMGKYDNHLLE
1auvA1          ----------------------------------------------------------------------
2b3wA1          ----------------------------------------------------------------------
1h7zA           ----------------------------------RGFMPSTTAYPFVLPNATHNENYIFGQCYYKASDGA


                         .         .         *         .         .         .         .:140
query           LYSFEDIKEVFKTAYAKKFRFPSFMSAFKFYNDYALKTNDKKKILERYEDRISIVALFFANGDTEKAKEY
1pemA2          ----------------------------------------------------------------------
1r1rA2          ----------------------------------------------------------------------
1l1lA           NLWISGTDYQRRTGDSLNNCWFVAIRPQKYGDSKIVPSYLGKQEKAVSMPFSFLFDELMKGGGVGFDFAI
1pemA1          RYDRAFVLRLFEHAHASGFRFQTFLGAWKFYTSYTLKTFDGKRYLEHFEDRVTMVALTLAQGDETLATQL
1r1rA1          DYTEEEFKQMDTFIDHDRDMTFSYAAVKQLEGKYLVQNRVTGEIYESAQFLYILVAACLFETRLQYVKRF
1auvA1          ----------------------------------------------------------------------
2b3wA1          ----------------------------------------------------------------------
1h7zA           TVMLNKRLPDSRTSYVMTFLWSLNAGLAPETTQATLITS-------------------------------


                         +         .         .         .         .         *         .:210
query           VNLMINQEYQPSTPTFLNAGRKRRGELVSCFLLEVNDSLNDISRAIDISMQLSKLGGGVSLNLSKLRAKG
1pemA2          --------------------------LVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAG
1r1rA2          --------------------------FSSCVLIECGDSLDSINATSSAIVKYVSQRAGIGINAGRIRALG
1l1lA           DLQLVVDETSESYDASVKVGAVGKNEQDADSIYRLPDTREGWVLANALLIDLPDRKQKLILDLSDIRPYG
1pemA1          TDEMLSGRFQPATPTFLNCGKQQRGE--------------------------------------------
1r1rA1          YDAVSTFKISLPTPIMSGVRTPTR----------------------------------------------
1auvA1          ----------------------------------------------------------------------
2b3wA1          ----------------------------------------------------------------------
1h7zA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EAIKDVENATKGVVGVMKLLDNAFRYADQMGQRQGSGAAYLNIFHRDINDFLDTKKISADEDVRVKTLSI
1pemA2          APIKRIENQSSGVIPVMKMLEDAFSYA-----NQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSL
1r1rA2          SPIRGGEAFHTGCIPFYKHFQTAVKSCSQGGVRGGAATLFYPMWHLEVESLLVLKNNRGVEGNRVRHMDY
1l1lA           AEIHGFGGTASGPMPLISMLLDVNEVLNNKAGGR-----LTAVDAADICNLIGKAVVAGNAELAL-----
1pemA1          ----------------------------------------------------------------------
1r1rA1          ----------------------------------------------------------------------
1auvA1          ----------------------------------------------------------------------
2b3wA1          ----------------------------------------------------------------------
1h7zA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GVVIPDKFVELAREDKAAYVFYPHTIYKEYGQHMDEMDMNEMYDKFVDNPRVKKEKINPRKLLEKLAMLR
1pemA2          GVVIPDITFRLAKENAQMALFSPYDIQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQ
1r1rA2          GVQINKLMYTRLLKGEDITLFSPSDVPGLYDAFFDQEEFERLYTKYEKDDSIRKQRVKAVELFSLMMQER
1l1lA           GSNDDQDF-------------------------ISMKQDQEKLMHHRWASNNSVAVDSAFSGYQPIAAGI
1pemA1          ----------------------------------------------------------------------
1r1rA1          ----------------------------------------------------------------------
1auvA1          ----------------------------------------------------------------------
2b3wA1          ----------------------------------------------------------------------
1h7zA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SESGYPYIMFQDNVNKVHANNHISKVKFSNLCSEVLQASQVSSYTDYDEEDEIGLDISCNLGSLNILNVM
1pemA2          FESGYPYIMFEDTVNR--ANPIAGRINMSNLCSEILQVNSASRYDDNLDYTHIGHDISCNLGSLNIAHVM
1r1rA2          ASTGRIYIQNVDHCNTHSPDPAIAPVRQSNLCLEIALP----TKPLNDVNDENGEIALCTLSAFNLGAIN
1l1lA           RENGEPGIVNLDLSKNGYQAGIDGDVEGTNPCGEISLAN----------------GEPCNLFEVFPLIAE
1pemA1          ----------------------------------------------------------------------
1r1rA1          ----------------------------------------------------------------------
1auvA1          ---AARVLLVIDEPHTDWAK----YFKGKKIHGE------------IDIKVE-----QAEFSDLNLVAHA
2b3wA1          ----------------------------------------------------------------------
1h7zA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           EHKSIEKTVKLATDSLTHVSETTDIRNAPAVRRANKAMKSIGLGAMNLHGYLAQNGIAYESPEARDFANT
1pemA2          DSPDIGRTVETAIRGLTAVSDMSHIRSVPSIAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNL
1r1rA2          NLDELEELAILAVRALDALLDYQDY-PIPAAKRGAMGRRTLGIGVINFAYYLAKHGKRYSDGSANNLTHK
1l1lA           EGWDLQEVFALAARYAKRVTFSPY--DWEISREIIQKNRRIGISMSGIQDWL-----------LTRLGNR
1pemA1          ----------------------------------------------------------------------
1r1rA1          ----------------------------------------------------------------------
1auvA1          NGGVLRNGVKVVRSLKPDFVLIRQH-AFSXARNGDYRSLVIGLQYAGIP---------------------
2b3wA1          ------------------------------------------------------------------TSDD
1h7zA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           FFMMVNFYSIQRSAEIAKEKGETFDQYEGSTYATGEYFDKYVSTDFSPKYEKIANLFEGMHIPTTEDWKK
1pemA2          YFYTITWHAVHTSMRLARERGKTFAGFAQSRYASGDYFTQYLQDDWQPKTAKVRALFAGITLPTREMWLK
1r1rA2          TFEAIQYYLLKASNELAKE-QGACPWFNETTYAKGILPID--------TYKKDL--DTIANEPLHYDWEA
1l1lA           VVTGFKDDFDPETHEAIKVPV--YDKRAIKMVDQL----------------------------YKAVVKA
1pemA1          ----------------------------------------------------------------------
1r1rA1          ----------------------------------------------------------------------
1auvA1          ----------------------------------------------------------------------
2b3wA1          YGDFSNFA--AWPIKVDGKTWPTSEHYFQAQKFLDEKYREEIRRVSSPM--VAARMGRDRSKPLRKNWES
1h7zA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           LKAFVAEHGMYHSYRLCIAPTGSISYVQSSTASVMPIMERIEERTYGNSKTYYPMPGLASNNWFFYKEAY
1pemA2          LRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKIEIRKEGKTRVYYPAPFMTNENLDMYQDAY
1r1rA2          LRESIKTHGLRNSTLSALMPSETSSQISNATNGIEPPRGYVSIKASKDGILRQVVPDYEHLHDAYELLWE
1l1lA           DQDYSKTLGCNEIKHTTVKPSGTVAKLAGASEGMHFHYGAYADIYTENTTCVEFPIKAVGADNPNFASAG
1pemA1          ----------------------------------------------------------------------
1r1rA1          ----------------------------------------------------------------------
1auvA1          ----------------------------------------------------------------------
2b3wA1          VKEQVMRKALRAKFELRLLATAPAKLVEHTE---------------------------------------
1h7zA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           DMDMFKVVDMIATIQQHIDQGISFTLFLKDTMTTRDLNRIDLYAHHRGIKTIYYARTKDTGQDSCLSCVx
1pemA2          DIGPEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKSLYYIRLRQ-----------
1r1rA2          MPGNDGYLQLVGIMQKFIDQSISANTNYSGKVPMQQLLKDLLTAYKFGVKTLFYQNTRD-----------
1l1lA           TVSIAEQFATQAFLQTWSDNAVSCTITFQDSEGDQVESLLRQYRFITKSTLPYFGGSLQPIDKETYEKR-
1pemA1          ----------------------------------------------------------------------
1r1rA1          ----------------------------------------------------------------------
1auvA1          ----------------------------------------------------------------------
2b3wA1          ----------------------------------------------------------------------
1h7zA           ----------------------------------------------------------------------