[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for bsub0:CAB14191.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2gh1A1.bssp"
#ERROR : Can't open dsspfile "1aqiA1.bssp"
#ERROR : Can't open dsspfile "1yzhA1.bssp"
#ERROR : Can't open dsspfile "2ooxA1.bssp"
#ERROR : Can't open dsspfile "1wxwA2.bssp"
#ERROR : Can't open dsspfile "1xxlA.bssp"
#ERROR : Can't open dsspfile "1o9gA.bssp"
#ERROR : Can't open dsspfile "2avnA1.bssp"
#ERROR : Can't open dsspfile "1p91A.bssp"
#ERROR : Can't open dsspfile "1uirA.bssp"
#ERROR : Can't open dsspfile "1vbfA.bssp"
#ERROR : Can't open dsspfile "2dulA1.bssp"
#ERROR : Can't open dsspfile "1bhjA.bssp"
#ERROR : Can't open dsspfile "1zq9A1.bssp"
#ERROR : Can't open dsspfile "2ckdA1.bssp"
#ERROR : Can't open dsspfile "1qzzA2.bssp"
#ERROR : Can't open dsspfile "1f38A.bssp"
#ERROR : Can't open dsspfile "2bzgA1.bssp"
#ERROR : Can't open dsspfile "1xdzA.bssp"
#ERROR : Can't open dsspfile "1i1nA.bssp"
#ERROR : Can't open dsspfile "1pjzA.bssp"
#ERROR : Can't open dsspfile "1vlmA.bssp"
#ERROR : Can't open dsspfile "2ex4A1.bssp"
#ERROR : Can't open dsspfile "1im8A.bssp"
#ERROR : Can't open dsspfile "2fpoA1.bssp"
#ERROR : Can't open dsspfile "1sqfA2.bssp"
#ERROR : Can't open dsspfile "1y8cA.bssp"
#ERROR : Can't open dsspfile "2avdA1.bssp"
#ERROR : Can't open dsspfile "1dl5A1.bssp"
#ERROR : Can't open dsspfile "2b25A1.bssp"
#ERROR : Can't open dsspfile "1m6yA2.bssp"
#ERROR : Can't open dsspfile "1nkvA.bssp"
#ERROR : Can't open dsspfile "1uwvA2.bssp"
#ERROR : Can't open dsspfile "1yb2A1.bssp"
#ERROR : Can't open dsspfile "2h00A1.bssp"
#ERROR : Can't open dsspfile "1wznA1.bssp"
#ERROR : Can't open dsspfile "2o57A1.bssp"
#ERROR : Can't open dsspfile "2ar0A1.bssp"
#ERROR : Can't open dsspfile "1i4wA.bssp"
#ERROR : Can't open dsspfile "1dusA.bssp"
#ERROR : Can't open dsspfile "1suiA1.bssp"
#ERROR : Can't open dsspfile "1vl5A.bssp"
#ERROR : Can't open dsspfile "1ve3A1.bssp"
#ERROR : Can't open dsspfile "2f8lA1.bssp"
#ERROR : Can't open dsspfile "1ufkA.bssp"
#ERROR : Can't open dsspfile "2frnA1.bssp"
#ERROR : Can't open dsspfile "2i6gA1.bssp"
#ERROR : Can't open dsspfile "1pqwA.bssp"
#ERROR : Can't open dsspfile "2b78A2.bssp"
#ERROR : Can't open dsspfile "1kp9A.bssp"
#ERROR : Can't open dsspfile "1ws6A1.bssp"
#ERROR : Can't open dsspfile "1fp2A2.bssp"
#ERROR : Can't open dsspfile "1h2tC2.bssp"
#ERROR : Can't open dsspfile "1o54A.bssp"
#ERROR : Can't open dsspfile "1e50A.bssp"
#ERROR : Can't open dsspfile "2p7hA1.bssp"
#ERROR : Can't open dsspfile "1g99A1.bssp"
#ERROR : Can't open dsspfile "1xtpA.bssp"
#ERROR : Can't open dsspfile "1h1dA.bssp"
#ERROR : Can't open dsspfile "1dctA.bssp"
#ERROR : Can't open dsspfile "1qamA.bssp"
#ERROR : Can't open dsspfile "1pgjA2.bssp"
#ERROR : Can't open dsspfile "1ixkA.bssp"
#ERROR : Can't open dsspfile "1i9gA.bssp"
#ERROR : Can't open dsspfile "1f3lA.bssp"
#ERROR : Can't open dsspfile "1nv8A.bssp"
#ERROR : Can't open dsspfile "1qyrA.bssp"
#ERROR : Can't open dsspfile "1jsxA.bssp"
#ERROR : Can't open dsspfile "2esrA1.bssp"
#ERROR : Can't open dsspfile "1t43A.bssp"
#ERROR : Can't open dsspfile "1euqA1.bssp"
#ERROR : Can't open dsspfile "1fp1D2.bssp"
#ERROR : Can't open dsspfile "1wy7A1.bssp"
#ERROR : Can't open dsspfile "2b9eA1.bssp"
#ERROR : Can't open dsspfile "1eizA.bssp"
#ERROR : Can't open dsspfile "1ne2A.bssp"
#ERROR : Can't open dsspfile "1a71A2.bssp"
#ERROR : Can't open dsspfile "1cf3A1.bssp"
#ERROR : Can't open dsspfile "1yb5A2.bssp"
#ERROR : Can't open dsspfile "1ri1A.bssp"

## Summary of PDB Search
:233
    2e-28  17%  2gh1A1 [c.66.1.49] METHYLTRANSFERASE A:13 -- 293
    3e-26  14%  1aqiA1 [c.66.1.27] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI A:21 --
    6e-25  19%  1yzhA1 [c.66.1.53] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE A:8 --
    1e-24  13%  2ooxA1 [d.129.6.2] SNF1-LIKE PROTEIN KINASE SSP2 A:449 -- 576
    2e-24  13%  1wxwA2 [c.66.1.51] HYPOTHETICAL PROTEIN TTHA1280 A:65 -- 382
    4e-24  19%  1xxlA  [c.66.1.41] YCGJ PROTEIN
    1e-22   9%  1o9gA  [c.66.1.29] RRNA METHYLTRANSFERASE
    8e-22  22%  2avnA1 [c.66.1.41] UBIQUINONE/MENAQUINONE BIOSYNTHESIS A:1 -- 246
    8e-22  23%  1p91A  [c.66.1.33] RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE A
    1e-21  11%  1uirA  [c.66.1.17] POLYAMINE AMINOPROPYLTRANSFERASE
    4e-21  13%  1vbfA  [c.66.1.7] 231AA LONG HYPOTHETICAL PROTEIN-L-ISOASPARTATE O-
    4e-21  13%  2dulA1 [c.66.1.58] N(2),N(2)-DIMETHYLGUANOSINE TRNA A:3 -- 377
    5e-21  14%  1bhjA  [c.66.1.5] GLYCINE N-METHYLTRANSFERASE
    1e-20  12%  1zq9A1 [c.66.1.24] PROBABLE DIMETHYLADENOSINE TRANSFERASE A:36 --
    1e-20   9%  2ckdA1 [c.66.1.57] PUTATIVE METHYLTRANSFERASE A:8 -- 310
    4e-20  13%  1qzzA2 [c.66.1.12] ACLACINOMYCIN-10-HYDROXYLASE A:102 -- 357
    1e-19  25%  1f38A  [c.66.1.22] PRECORRIN-8W DECARBOXYLASE
    2e-19  11%  2bzgA1 [c.66.1.36] THIOPURINE S-METHYLTRANSFERASE A:17 -- 245
    1e-18  13%  1xdzA  [c.66.1.20] METHYLTRANSFERASE GIDB
    1e-18  26%  1i1nA  [c.66.1.7] PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE
    2e-18  11%  1pjzA  [c.66.1.36] THIOPURINE S-METHYLTRANSFERASE
    2e-18  18%  1vlmA  [c.66.1.41] SAM-DEPENDENT METHYLTRANSFERASE
    2e-18  13%  2ex4A1 [c.66.1.42] ADRENAL GLAND PROTEIN AD-003 A:2 -- 224
    3e-18  18%  1im8A  [c.66.1.14] YECO
    4e-18   7%  2fpoA1 [c.66.1.46] METHYLASE YHHF A:10 -- 192
    8e-18  13%  1sqfA2 [c.66.1.38] SUN PROTEIN A:145 -- 429
    1e-17  14%  1y8cA  [c.66.1.43] S-ADENOSYLMETHIONINE-DEPENDENT METHYLTRANSFERASE
    2e-17  14%  2avdA1 [c.66.1.1] CATECHOL-O-METHYLTRANSFERASE A:44 -- 262
    2e-17  16%  1dl5A1 [c.66.1.7] PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE A:1 --
    5e-17  14%  2b25A1 [c.66.1.13] HYPOTHETICAL PROTEIN A:6 -- 329
    8e-17  15%  1m6yA2 [c.66.1.23] S-ADENOSYL-METHYLTRANSFERASE MRAW A:2 -- 114
    8e-17  15%  1nkvA  [c.66.1.21] HYPOTHETICAL PROTEIN YJHP
    1e-16  14%  1uwvA2 [c.66.1.40] 23S RRNA (URACIL-5-)-METHYLTRANSFERASE RUMA A:75
    1e-16  16%  1yb2A1 [c.66.1.13] HYPOTHETICAL PROTEIN TA0852 A:6 -- 255
    2e-16   7%  2h00A1 [c.66.1.54] METHYLTRANSFERASE 10 DOMAIN CONTAINING PROTEIN
    3e-16  16%  1wznA1 [c.66.1.43] SAM-DEPENDENT METHYLTRANSFERASE A:1 -- 251
    4e-16  21%  2o57A1 [c.66.1.18] PUTATIVE SARCOSINE DIMETHYLGLYCINE A:16 -- 297
    5e-16  10%  2ar0A1 [c.66.1.45] TYPE I RESTRICTION ENZYME ECOKI M PROTEIN A:6 --
    7e-16   9%  1i4wA  [c.66.1.24] MITOCHONDRIAL REPLICATION PROTEIN MTF1
    1e-15  13%  1dusA  [c.66.1.4] MJ0882
    2e-15  17%  1suiA1 [c.66.1.1] CAFFEOYL-COA O-METHYLTRANSFERASE A:21 -- 247
    2e-15  27%  1vl5A  [c.66.1.41] UNKNOWN CONSERVED PROTEIN BH2331
    3e-15  18%  1ve3A1 [c.66.1.43] HYPOTHETICAL PROTEIN PH0226 A:2 -- 227
    6e-15  13%  2f8lA1 [c.66.1.45] HYPOTHETICAL PROTEIN LMO1582 A:2 -- 329
    1e-14  19%  1ufkA  [c.66.1.39] TT0836 PROTEIN
    5e-14  12%  2frnA1 [c.66.1.47] HYPOTHETICAL PROTEIN PH0793 A:19 -- 278
    5e-14  18%  2i6gA1 [c.66.1.44] PUTATIVE METHYLTRANSFERASE A:1 -- 198
    9e-13  12%  1pqwA  [c.2.1.1] POLYKETIDE SYNTHASE
    2e-12  18%  2b78A2 [c.66.1.51] HYPOTHETICAL PROTEIN SMU.776 A:69 -- 385
    2e-12  18%  1kp9A  [c.66.1.18] CYCLOPROPANE-FATTY-ACYL-PHOSPHOLIPID SYNTHASE 1
    2e-12  15%  1ws6A1 [c.66.1.46] METHYLTRANSFERASE A:15 -- 185
    3e-12  17%  1fp2A2 [c.66.1.12] ISOFLAVONE O-METHYTRANSFERASE A:109 -- 352
    5e-12   9%  1h2tC2 [a.118.1.14] 80 KDA NUCLEAR CAP BINDING PROTEIN C:291 -- 480
    5e-12  20%  1o54A  [c.66.1.13] SAM-DEPENDENT O-METHYLTRANSFERASE
    7e-12   9%  1e50A  [b.2.5.6] CORE-BINDING FACTOR ALPHA SUBUNIT
    4e-11  20%  2p7hA1 [c.66.1.41] HYPOTHETICAL PROTEIN A:21 -- 249
    2e-10  16%  1g99A1 [c.55.1.2] ACETATE KINASE A:1 -- 197
    3e-10  15%  1xtpA  [c.66.1.42] LMAJ004091AAA
    3e-10  21%  1h1dA  [c.66.1.1] CATECHOL-O-METHYLTRANSFERASE
    4e-10   6%  1dctA  [c.66.1.26] PROTEIN (MODIFICATION METHYLASE HAEIII)
    5e-10  17%  1qamA  [c.66.1.24] ERMC' METHYLTRANSFERASE
    2e-09   9%  1pgjA2 [c.2.1.6] 6-PHOSPHOGLUCONATE DEHYDROGENASE A:1 -- 178
    5e-09  25%  1ixkA  [c.66.1.38] METHYLTRANSFERASE
    1e-08  17%  1i9gA  [c.66.1.13] HYPOTHETICAL PROTEIN RV2118C
    7e-08  25%  1f3lA  [c.66.1.6] PROTEIN ARGININE METHYLTRANSFERASE PRMT3
    2e-07  15%  1nv8A  [c.66.1.30] HEMK PROTEIN
    2e-07  12%  1qyrA  [c.66.1.24] HIGH LEVEL KASUGAMYCIN RESISTANCE PROTEIN
    5e-07  20%  1jsxA  [c.66.1.20] GLUCOSE-INHIBITED DIVISION PROTEIN B
    1e-06  16%  2esrA1 [c.66.1.46] METHYLTRANSFERASE A:28 -- 179
    4e-06  22%  1t43A  [c.66.1.30] PROTEIN METHYLTRANSFERASE HEMK
    4e-05  13%  1euqA1 [b.53.1.2] GLUTAMINYL-TRNA SYNTHETASE A:339 -- 547
    6e-05  21%  1fp1D2 [c.66.1.12] ISOLIQUIRITIGENIN 2'-O-METHYLTRANSFERASE D:129
    7e-05  21%  1wy7A1 [c.66.1.32] HYPOTHETICAL PROTEIN PH1948 A:4 -- 204
    1e-04  18%  2b9eA1 [c.66.1.38] NOL1/NOP2/SUN DOMAIN FAMILY, MEMBER 5 ISOFORM 2
    1e-04  23%  1eizA  [c.66.1.2] FTSJ
    1e-04  13%  1ne2A  [c.66.1.32] HYPOTHETICAL PROTEIN TA1320
    4e-04  12%  1a71A2 [c.2.1.1] LIVER ALCOHOL DEHYDROGENASE A:164 -- 339
    4e-04  20%  1cf3A1 [c.3.1.2] PROTEIN (GLUCOSE OXIDASE) A:3 -- 324 A:521 -- 583
    5e-04  15%  1yb5A2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:121 -- 294
    7e-04  18%  1ri1A  [c.66.1.34] MRNA CAPPING ENZYME
:233

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQDSKEQRVHGVFEKIYKNYDQMNSVISFQQHKKWRDKTMRIMNVKEGAKALDVCCGTADWTIALAKAAG
2gh1A1          ------------YLKNTRDLYYNDDYVSFLVN--------TVWKITKPVHIVDYGCGYGYLGLVLXPLLP
1aqiA1          -------------------------------PPEVVDFMVSLAEAPRGGRVLEPACAHGPFLRAFREAHG
1yzhA1          -----------------TELLEANPQYVVLNPLEAKAK-WRDLFGNDNPIHVEVGSGKGAFVSGXAKQNP
2ooxA1          ----------------------------------------------------------------------
1wxwA2          -PLYVRPLLGEVPERVQVQEGRVRYLVDLRAAYLDQRENRLYXERFRGERALDVFSYAGGFALHLALGFR
1xxlA           -------------------------------HHHSLGLXIKTAECRAEHRVLDIGAGAGHTALAFSPYVQ
1o9gA           -------------------------AFPVRLATEIFQRALARLPGDGPVTLWDPCCGSGYLLTVLGLLHR
2avnA1          -----------FYDRIARAYDSXYETPKWKLYHRLIGSFLEEY-LKNPCRVLDLGGGTGKWSLFLQE---
1p91A           -------------------YQPLRDAIVAQLRERLDDKATAVL---------DIGCGEGYYTHAFADALP
1uirA           ---------SKGFGKVLILDKDVQSTERDEYIYHETLVHPAMLTHPEPKRVLIVGGGEGATLREVLK-HP
1vbfA           ----RSLFLPENLKDYAYAHTHEALPILPGINTTALIFXLDELDLHKGQKVLEIGTGIGYYTALIAEIV-
2dulA1          -------------------KILIPPVFYNPRMALNRDIVVVLLNILNPKIVLDALSATGIRGIRFALETP
1bhjA           LGVAAEGIPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEG-
1zq9A1          ----------------------------ILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAK
2ckdA1          ----------------------------QAVRTNFFDTYFNNAVIDGIRQFVILASGLDSRAYRLDWPTG
1qzzA2          ------RPFWEDLSADVALADSFDALMSCDEDLAYE-APADAYDWSAVRHVLDVGGGNGGMLAAIALRAP
1f38A           ---------------------------------------------GKNDVAVDVGCGTGGVTLELAGRVR
2bzgA1          -------------------VNGKTAFHQEQGHQLLKKHLDTFLKGKSGLRVFFPLCGKAVEXKWFAD---
1xdzA           --PRQLEQFELYYDMLVEWNEKINLTSITEKKEVYSITAAFYVDFNQVNTICDVGAGAGFPSLPIKIC-F
1i1nA           --------------------------------------------LHEGAKALDVGSGSGILTACFARMVG
1pjzA           -----------------------------SEVNKDLQQYWSSLNVVPGARVLVPLCGKSQDMSWLSG---
1vlmA           ---------WHIFERFVNEYERWFLVHRFAYLSELQA----VKCLLPEGRGVEIGVGTGRFAVPLKIKI-
2ex4A1          -EKQFYSKAKTYWKQIPPTVDGMLGGYGHISSNSSRKFLQRFLRKTGTSCALDCGAGIGRITKRLLLPLF
1im8A           --------------------------------------------VTADSNVYDLGCSRGAATLSARRNIN
2fpoA1          -------------------------------DRVRETLFNWLAPVIVDAQCLDCFAGSGALGLEALSRYA
1sqfA2          ----------------------------VTVQDASAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEV-A
1y8cA           -----------CYNKFAHIYDKLIRADVD--YKKWSDFIIEKCNNLVFDDYLDLACGTGNLTENLCP-KF
2avdA1          -PPEDSRLWQYLLSRSMREHPALRSLRLLTLEQPQGDSMMTLARLIQAKKALDLGTFTGYSALALALALP
1dl5A1          -------------------YDDGEEYSTSSQPSLMA-LFMEWVGLDKGMRVLEIGGGTGYNAAVMSRVVG
2b25A1          ------------------------------------------MDINPGDTVLEAGSGSGGMSLFLSKAVG
1m6yA2          ---------------------------SQRHIPVXVREVIEFLKPEDEKIILDCTVGEGGHSRAILEHCP
1nkvA           ------------IFTISESEHRIHNPFT----EEKYATLGRVLRXKPGTRILDLGSGSGEXLCTWARDHG
1uwvA2          -------------------------------NQKXVARALEWLDVQPEDRVLDLFCGXGNFTLPLATQAA
1yb2A1          -----------------------------------------ICGLRPGXDILEVGVGSGNXSSYILYALN
2h00A1          -----REDFGLSIDIPLERLIPTVPLRLNYIHWVEDLIGHQDSDKSTLRRGIDIGTGASCIYPLLGATLN
1wznA1          --------MYELYTLLAEYYDTIRRIERVKAEIDFVEEIFKEDAKREVRRVLDLACGTGIPTLELAERGY
2o57A1          ---------------------------------------------QRQAKGLDLGAGYGGAARFLVRKFG
2ar0A1          ----------------------------YFTPRPLIKTIIHLLKPQPREVVQDPAAGTAGFLIEADRYVK
1i4wA           ----GIKDISKLKFFYGFKYLWNPTVYN---KIFDKLDLTKTYKHPEELKVLDLYPGVGIQSAIFYNK-Y
1dusA           ----DVKIVEDILRGKKLKFKTDSGVFSYGKVDKGTKILVENVVVDKDDDILDLGCGYGVIGIALAD---
1suiA1          ----------------------------------------MLLKLINAKNTMEIGVYTGYSLLATALAIP
1vl5A           ----------------------------------DLAKLXQIAALKGNEEVLDVATGGGHVANAFAP---
1ve3A1          -----------EYYRVFPTYTDINSQEYRSRIETLEP--LLXKYXKKRGKVLDLACGVGGFSFLLEDYGF
2f8lA1          -------------------------------GFIVAYLLEKVIQKKKNVSILDPACGTANLLTTVINQLE
1ufkA           -----------------WEGAEIPLVIEPGHHETTRLALKALAHLRPGDKVLDLGTGSGVLAIAAEKLGG
2frnA1          -----------HVENGIKYKLDVAKIXFSPANVKERVRXAKV--AKPDELVVDXFAGIGHLSLPIAVYGK
2i6gA1          -----------------------------------------------PGRTLDLGCGNGRNSLYLAA---
1pqwA           ---------------------------------------CEVGRLSPGERVLIHSATGGVGMAAVSIAKM
2b78A2          ------ILENGISYNVFLNDGLM--TGIFLDQRQVRN--ELINGSAAGKTVLNLFSYTAAFSV--AAAMG
1kp9A           ------------------------------------DLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYD
1ws6A1          ------------------------------------------LRYPRRGRFLDPFAGSGAVGLEAASEG-
1fp2A2          ------GVTLGSWDFLDKNPEYNTSFNDASDSKLINLALRDCDFVFDGLEIVDVGGGTGTTAKIICETF-
1h2tC2          -----EENLHCIIKSHWKEKTCAAQLVSYP-----GKNKIPLNYHIVEVAPPHIDVMYTTLLIELCKL-Q
1o54A           -------------------------------YPKDSSFIAMMLDVKEGDRIIDTGVGSGAMCAVLARAVG
1e50A           ----------------------------------------------------------------------
2p7hA1          -----------------------------------------FTPFFRPGNLLELGSFKGDFTSRLQEHFN
1g99A1          -------------------------------------------------KVLVINAGSSSLKYQLIDMTN
1xtpA           --------------------------------IEGSRNFIASLPGHGTSRALDCGAGIGRITKNLLTKLY
1h1dA           --DTKEQRIQSVLEAITQKEWAMN--VGDAK-GQIMDAVIREYSPS---LVLELGAYCGYSAVRMARLLQ
1dctA           -------------------------------------------------NLISLFSGAGGLDLGFQKAGF
1qamA           ----------------------------FITSKHNIDKIMTNIRLNEHDNIFEIGSGKGHFTLELVQRCN
1pgjA2          ----------------------------------------------------------ANLALNIAEK--
1ixkA           ------------------------------------------LDPKPGEIVADXAAAPGGKTSYLAQLXR
1i9gA           ------------------------------------------GDIFPGARVLEAGAGSGALTLSLLRAVG
1f3lA           ----------------------------------------------KDKVVLDVGCGTGILSMFAAKAGA
1nv8A           ---------------------------------------LELIRKYGIKTVADIGTGSGAIGVSVAKFSD
1qyrA           ----------------------------FLNDQFVIDSIVSAINPQKGQAMVEIGPGLAALTEPVGERLD
1jsxA           --------------------------------HKWNEMLVRVAPYLQGERFIDVGTGPGLPGIPLSIVRP
2esrA1          -----------------------------------------IGPYFNGGRVLDLFAGSG--GLAIEAVSR
1t43A           ---------------------------------------------EQPCRILDLGTGTGAIALALASERP
1euqA1          -------------------------------------------------------------IKAERVEKD
1fp1D2          ------------------------------------KRMLEIYTGFEGISTLDVGGGSGRNLELIIS---
1wy7A1          ----------------------------------------------EGKVVADLGAGTGVLSYGALLLGA
2b9eA1          ------------------------------------------LDPPPGSHVIDACAAPGNKTSHLAALLK
1eizA           ---------------------------------------------KPGMTVVDLGAAPGGWSQYVVTQIG
1ne2A           ----------------------------------------------GGRSVIDAGTGNGILACGSYLLGA
1a71A2          ----------------------------------------KVAKVTQGSTCAVFGLGGAGLSVIMGCKAA
1cf3A1          ----------------------------------------------------------------------
1yb5A2          ----------------------------------------HSACVKAGESVLVHGASGGVGLAACQIARA
1ri1A           ---------------------------------------------KRGDSVLDLGCGKGGDLLKYERAGI


                         .         .         *         .         .         .         .:140
query           KSGEIKGLDFSENMLSVGEQKVKDGGFSQIELLHGNAMELPFDDDTFDYVTIGFGLRNVPDYLTVLKEMR
2gh1A1          EGSKYTGIDSGETLLAEARELFRLLPY-DSEFLEGDATEIELND-KYDIAICHAFLLHXTTPETXLQKXI
1aqiA1          TGYRFVGVEIDPKALDLPPWAEGILA-DFLLWEPGEAFDLILGNPPYGIVKAVKDLYKKAFYGAFLEKAV
1yzhA1          D-INYIGIDIQKSVLSYALDKVLEVGVPNIKLLWVSDLTDYFEDGEIDRLYLNFSDPWPKTYKTFLDTFK
2ooxA1          -------------------------------------------------NKWHFGVRCRGDAPEILLAVY
1wxwA2          ---EVVAVDSSAEALRRAEENARAFDLLRRLEKEGERFDLVVLDPPAFAKGKKDVERAYRAYKEVNLRAI
1xxlA           ---ECIGVDATKEXVEVASSFAQEKGVENVRFQQGTAESLPFPDDSFDIITCRYAAHHFSDVRKAVREVA
1o9gA           RSLRQVASDVDPAPLELAAKNLALLSPAGLTARELERREERFGKPSYGALPCAIRTADVFDPRALSAVLA
2avnA1          RGFEVVLVDPSKEXLEVAREKGVKNVV------EAKAEDLPFPSGAFEAVALGDVLSYVENKDKAFSEIR
1p91A           E-ITTFGLDVSKVAI-----KAAAKRYPQVTFCVASSHRLPFSDTSXDAIIRIYAPCKA-------EELA
1uirA           TVEKAVMVDIDGELVEVAKRHMPEWHQGAFDDPRDARAYLERTEERYDVVIIDLTDPVGEDTVEFYRLVK
1vbfA           --DKVVSVEINEKXYNYASKLLSYYNN--IKLILGDGTLGYEEEKPYDRVV------VWATAPTLLCKPY
2dulA1          -AEEVWLNDISEDAYELMKRNVMLNFDGELRESKGRAILKGEKTIVINHDDANRLMAERHSPMEFLDTAL
1bhjA           --FSVTSVDASDKMLKYALKERWNKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPEHRLALKNIA
1zq9A1          K---VVACELDPRLVAELHKRVQGTPV-ASKLQVLVGDVLKTDLPFFDTCVANLPYQISSPFVFKLLLHR
2ckdA1          T--TVYEIDQPKVLAYKSTTLAEHGVTPTADDWPPALRSAGFDPSARTAWLAEGLLMYLPAQDGLFTEIG
1qzzA2          HL-RGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCV
1f38A           R---VYAIDRNPEAISTTEXNLQRHGLGNVTLXEGDAPEALCKIPDIDIAVVGGSGGELQE---ILRIIK
2bzgA1          RGHSVVGVEISELGIQEFFTEQNLSYSEEPITEIPGTKVFKSSSGNISLYCCSLVAINPGDRKCYADTXF
1xdzA           PHLHVTIVDSLNKRITFLEKLSEALQLENTTFCHDRAETRKDVRESYDIVT----ARAVARLSVLSELCL
1i1nA           CTGKVIGIDHIKELVDDSVNNVRLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVP------QALI
1pjzA           QGYHVVGAELSEAAVERYFTERGEQPHITSQGDFKVYALTARDIGHCAAFYDRAAMIALPMRERYVQHLE
1vlmA           -------------GVEPSERXAEIARKRGVFVLKGTAENLPLKDESFDFALXVTTICFVDDPERALKEAY
2ex4A1          --REVDMVDITEDFLVQAKTYLGEEGKRVRFCCGLQDFTPEPDSYDVIWIQWVIGHLTDQHLAEFLRRCK
1im8A           QPNKIIGIDNSQPXVERCRQHIAAYHSIPVEILCNDIRHVEIKN--ASXVILNFTLQFLPDRIALLTKIY
2fpoA1          A--GATLIEXDRAVSQQLIKNLATLKAGARVVNSNAXSFLAQKGTPHNIVFVDPPFRRGLLETINLLEDN
1sqfA2          PEAQVVAVDIDEQRLSRVYDNLKRLGMKTVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKW
1y8cA           KNTWAVDLSQEXLSEAENKFRSQGLKPRLACQDISNLNINRKFDLITCCLDSTNYIIDSDDLKKYFKAVS
2avdA1          ADGRVVTCEVDAQPPELGRPLWRQAEAEHKIDLRLDELLAAGEAGTFDVAVVDADKENCSAYY---ERCL
1dl5A1          EKGLVVSVEYSRKICEIAKRNVERLGIENVIFVCGDGYYGVPEFSPYDVIFVTVGVDEVPE------TWF
2b25A1          SQGRVISFEVRKDHHDLAKKNYKHWRDSKLSHVEEWPDNVDFIHKDISGATFDAVALDMLNPHVTLPVFY
1m6yA2          G-CRIIGIDVDSEVLRIAEEKLKEFSDRKVSYREADFLLKTLGIEKVDGILXDLGVSTYQLLKEFLKKAE
1nkvA           I--TGTGIDXSSLFTAQAKRRAEELGVSERVHFIHNDAAGYVANEKCDVAACVGATWIAGGFAGAEELLA
1uwvA2          S---VVGVEGVPALVEKGQQNARLNGLQNVTFYHENLEEDVTKQPWAKNGFDKVLLDPARAGAAGVXQQI
1yb2A1          GKGTLTVVERDEDNLKKAXDNLSEYDIGNVRTSRSDIADF-ISDQXYDAV-----IADIPDPWNHVQKIA
2h00A1          GWYFL-ATEVDDMCFNYAKKNVEQNNLSLIKVVKVPQALKEESEIIYDFCMCNPPFFGITEVKRIIHDSL
1wznA1          E--VVGLDLHEEMLRVARRKAKERNLKIEFLQGDVLEIAFKNEFDAVTMFFSTIMYFDEEDLRKLFSKVA
2o57A1          --VSIDCLNIAPVQNKRNEEYNNQAGLANITVKYGSFLEIPCEDNSYDFIWSQDAFLHSPDKLKVFQECA
2ar0A1          SHRAFIGLELVPGTRRLALXNCLLHDIENLDHGGAIRLGNTLGSDGENLPKAHIVATNPPFGSAAGTNIT
1i4wA           CPRQYSLLEKRSSLYKFLNAKFEGSPLQIL---KRDPYDWSTYSNLIDEERIFVPEVQSSDNDKFLTVAN
1dusA           EVKSTTXADINRRAIKLAKENIKLNNLDYDIRVVHSDLYENVKDRKYNKIITNPPIRAGKEVLRIIEEGK
1suiA1          EDGKILAMDINKENYELGLPVIKKAGDHKIDFREGPMIKDEKNHGSYDFIFVDADKDNYLNY---HKRLI
1vl5A           FVKKVVAFDLTEDILKVARAFIEGNGHQQVEYVQGDAEQXPFTDERFHIVTCRIAAHHFPNPASFVSEAY
1ve3A1          EVVGV---DISEDXIRKAREYAKSRESNVEFIVGDARKL-SFEDKTFDYVIFIDSIVHFEPLNQVFKEVR
2f8lA1          LKGDVDGVDVDDLLISLALVGADLQRQKXTLLHQDGL--ANLLVDPVDVVISDLPVGYYPDDENAKTFEL
1ufkA           K---ALGVDIDPMVLPQAEANAKRNGVRPRFLEGSLEA--ALPFGPFDLLVANLYAELHAALA---PRYR
2frnA1          --AKVIAIEKDPYTFKFLVENIHLNKVEDRXSAYNXDNRDFPGENIADRILXGY----VVRTHEFIPKAL
2i6gA1          NGYDVTAWDXNPASXANLERIXAAEGLDNLQTDLVDLNTLTF-DGEYDFITVVXXFLEAQTIPGLIANXQ
1pqwA           IGARIYTTAGSDAKREMLSRLGVEYVGDSRSVDFADEILELTDGYGVDVVLNSLAGE-------AIQRGV
2b78A2          GAMATTSVDLAKRSRALSLAHFEANHMANHQLVVMDVFDYRRHHLTYDIIIIDPPSFEVKDYHKLIRQGL
1kp9A           V--NVVGLTLSKNQANHVQQLVANENLRSKRVLLAGWEQF---DEPVDRIVIGFGHERYDAF---FSLAH
1ws6A1          --WEAVLVEKDPEAVRLLKENVRRTGLGRVVALPVEVFEAKAQGERFTVAFXAPPYAXDLAALFGELLAS
1fp2A2          PKLKCIVFDRPQVVENLSGSN-------NLTYVGGDMFT-SIPNADAVLLKYILHNWTDKDCLRILKKCK
1h2tC2          PGSLPQVLAQATEMLYMRLDTMNTTCVDRFINWFSHHLS------NFQFRWSWEDWSDCLSQD---PESP
1o54A           SSGKVFAYEKREEFAKLAESNLTKWGLIERVTIKVRDISEGFDEKDVDAL-----FLDVPDPWNYIDKCW
1e50A           -----------------------------------------VRTDSPNFLCSVLPTHWRKTLPIAFKVVA
2p7hA1          ---DITCVEASEEAISHAQGRLKDG----ITYIHSRFEDAQLPRR-YDNIVLTHVLEHIDDPVALLKRIN
1g99A1          ESALAVGLC---------ERIGIDNSIITQKK--FDGKKLEKLTDLPTHKLTDDEFGVIKDMGEINAVGH
1xtpA           ATTDL--LEPVKHXLEEAKREL--AGXPVGKFILASXETATLPPNTYDLIVIQWTAIYLTDFVKFFKHCQ
1h1dA           PGARLLTMEMNPDYAAITQQMLNFAGLQKVTILNGASQDLKYDVDTLDMVFLDHWKDRLPDTL--LLEKC
1dctA           R--IICANEYDKSIWKTYESNHSAKLIKGDISKISSDEFPKCDQSWSEGGSLRGIDDPRGKLFYEYIRIL
1qamA           F---VTAIEIDHKLCKTTENKLVD--HDNFQVLNKDILQFKFPKNQSYKI-----FGNIPYNIST-DIIR
1pgjA2          --GKVAVFNRTYSKSEEFMKANASAPFAGNLKAFETM--EAFAASLKKPRKALILVQAGAATDSTIEQLK
1ixkA           NDGVIYAFDVDENRLRETRLNLSRLGVLNVILFHSSSLHIGELNVEFDKILLGSGIHRTXDDIKLLEKGL
1i9gA           PAGQVISYEQRADHAEHARRNVSGCYPDNWRLVVSDLADSELPDGSVDRAVL-----DMLAPWEVLDAVS
1f3lA           K--KVIAVDQSEILYQAMDIIRLNKLEDTIVLIKGKIEEVSLPVEKVDVIWMGYFLLFESMLDSVLYAKS
1nv8A           A--IVFATDVSSKAVEIARKNAERHGVSRFFVRKGEFLE-PFKEKSIEMI--------------------
1qyrA           Q---LTVIELDRDL--AARLQTHPFLGPKLTIYQQDAMTFNFGELAEKMGQPLRVFGNLP-YNISTPLMF
1jsxA           EA-HFTLLDSLGKRVRFLRQVQHELKLENIEPVQSRVEEFP-SEPPFDGVIS----RAFASLNDMVSWCH
2esrA1          GXSAAVLVEKNRKAQAIIQDNIIXTKAERFTLLKXEAERIDCLTGRFDLVFLDYAKETIVATIEALAA-K
1t43A           DC-EIIAVDRMPDAVSLAQRNAQHLAIKNIHILQSDWFS-ALAGQQFAMILQQGDVRFEPDIVHIIEQSR
1euqA1          AEGNITTIFCTYDADTLGVIHWVSAAHAPVEIRLYDRLFSPGAADDFLSVINPESLVIKQGF---AEPSL
1fp1D2          KYPLIKGINFD--LPQVIENAPPLSG---IEHVGGDMFA---SVPQGDAMILKAVCHNWSDCIEFLSNCH
1wy7A1          K--EVICVEVDKEAVDVLIENLGEFK-GKFKVFIGDVSEF---NSRVDIVNPPFGQRKHADRPFLLKAFE
2b9eA1          NQGKIFAFDLDAKRLASMATLLARAGVSCCELAEEDFLAVSPSDHEVHYILLGVRLHALAGFQRALCHAL
1eizA           GKGRIIACDLLPMDPIVGVDFLQ-GDFRDELVM--KALLERVGDSKVQVVMSGTPAVDIPRAMYLLEMCR
1ne2A           ES--VTAFDIDPDAIETAKRNCGG-----VNFXVADVSEISGKYDT------------------------
1a71A2          GAARIIGVDINKDKF----AKAKEVGATECVNPQDYKKPIQEVLTEMSNGGVDFSFEVIGRLDTMVTALS
1cf3A1          ----------------------------------------DVSGRTVDYIIAGGGLTG------LTTAAR
1yb5A2          YGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDL-------
1ri1A           --GEYYGVDIAEVSINDARVRARNMKRRKVFFRAQDSYGRHMDLGKFDVISSQFSFSTSESLDIAQRNIA


                         +         .         .         .         .         *         .:210
query           RVVKPGGQVVCLETSQPEMFGFRQAYFMYFKYIMPFFGKLFAKSYKEYSWLQESARDFPGMKELAGLFEE
2gh1A1          HSVKKGGKIICFEPHWISNXASYLLDGEKQSEFIQ-----LGVLQKLFESDTQRGKDGNIGXKIPIYLSE
1aqiA1          RLLKPGGVLVPATWLVLEDFALLREFLAREGKTSVYYLGEVFPQKKVSAVVIRFQKSGKGLSLWDTQESE
1yzhA1          RILPENGEIHFKTDNRG-----------LFEYSLVSFSQYGXKLNGVWLDLHASDFEGNVXTEYEQKFSN
2ooxA1          RALQRAG----AQFTVPKPVNGKYRSDMYTIKSRWEIPHCKREGKNTYAYIELQLYEVMP-GCFMLDVKS
1wxwA2          KLLKEGGILATASCSHHTEPLFYAXVAEAAQDAHRLLRVV-------EKRGQPFDHPVLLNHPETHYLKF
1xxlA           RVLKQDGRFLLVDHYAPEDPVLDE----FVNHLNRLRDPSHVRESSLSEW--------------------
1o9gA           GSAPDVVLTDLPYGERTHWEGQV--PGQPVAGLLRSLASALPAHAVIAVTDRSRKIPVAPVKALERLKIG
2avnA1          RVLVPDGLLI-ATVDNFYTFLQQXIEKDAWDQITRFL---------------------------------
1p91A           RVVKPGGWVITATPGPRHLXELKGLIYNEVHLHAP-----HAEQLEGFTLQQSAELCYPXRDEAVALLQX
1uirA           AHLNPGGVMGMQTMILLRVHPVVHRTVREAFRYVRSYKNHIPGFFLNFGFLLASDAFDPAAFSEGVIEAR
1vbfA           EQLKEGGIXILPIRVQKLYKVIKKGNSPSLENLGEXFGRILYGFYDDYD--DIEFRVNKLERQIKSI---
2dulA1          RSAKRRGILGVTATDGAPLCGAHPRACLRK--------------YLAVPLRGELCHEVGTRILVGVIARY
1bhjA           SMVRPGGLLVIDHRN----------YDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYT
1zq9A1          PFFRCAILMFQREVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNPPPPINF
2ckdA1          GLSAVGSRIAVETSPLHGDEWREQMQLRFRRVSDALGFEQ-------AVDVQELIYHDENRAVVADWLNR
1qzzA2          RALEPGGRLLVLDRADRFFSTLLDLRMLTF----------------------------------------
1f38A           DKLKPGGRIILLETKFEAXECLRDLGF-------------------------------------------
2bzgA1          SLLGKKFQYLLCVLSYDPTKHPGPPFYVPHAEIERLFGKIC------------NIRCLEKVDAFEERHKS
1xdzA           PLVKKNGLFVALKAAAEE----------------------------------------------------
1i1nA           DQLKPGGRLILPVGPA----GGNQMLEQYDKLMKPLMGVIYVPTDKEKQW--------------------
1pjzA           ALMPQACSGLLITLEYDQALLEGPPFSVPQTWLHRVMSG---------NWEVTKVGGQDTLHSSAR-GLK
1vlmA           RILKKGGYLIVGIVDRESFLGREYEKN--------------------KEKVFYKNARFFSTEELXDLXRK
2ex4A1          GSLRPNGIIVIKDNMAQEGVILDDVDSSV----------------------------CRDLDVVRRIICS
1im8A           EGLNPNGVLVLSEKFRFEDTKINHLLILHHQF----------KRANGYSELEVSQKXRTDIETHKVRLKN
2fpoA1          GWLADEALIYVESEVENGLPTVPANWSLHREKVAG-----------------------------------
1sqfA2          LRRDRDIPELAQLQSEILDAIWPHGTLVYATCSVLPEENSFLQRTADAELCETGTPEQPGKQNLPGAEEG
1y8cA           NHLKEGGVFIFDINSYYKLSQVLGNNDFFEDDLVSXYISFFVRDGEFYKRFDEEHEERAKEEDIEKYLKH
2avdA1          QLLRPGGILAVLRVLWRGKVLQPPKGDVAAECVRNLNERIRRDVRVYISLL-------------------
1dl5A1          TQLKEGGRVINLKLSRRQPAFLFKKKDPYLVGNYKLETR-FITAGGNL----------------------
2b25A1          PHLKHGGVCAVYVVNITQVIELLDGI--------------------------------------------
1m6yA2          DLLNPGGRIVVISFHSLEDRIVKETFRNSKKLRILTEKPVRP----SEEEIRENPRARSGRLRAA-----
1nkvA           QSLKPGGIXLIGEPYWRQLPATEEIA---------------------QACGVSSTSDFLTLPGLVGAFDD
1uwvA2          IKLEPIRIVYVSCNPATLARDSEALLKAGYTIARLAXLDXFPHTGH------------------------
1yb2A1          SXXKPGSVATF-----------------------------------------------------------
2h00A1          QLKKRLRWYSCMKCSLAPLKEELRIQGVPKVTYTEFCQGRTMRWALAWSFY-------------------
1wznA1          EALKPGGVFICGPVVWNEQKGEEKLVIMDWREVEPAVQKLRFKRLVQILRPNGEVKAFLVDDELVRLLAE
2o57A1          RVLKPRGVXAITDPXKEDGIDKSSIQPILDRIKLH---------------------DXGSLGLYRSLAKE
2ar0A1          RTFVHPTSNKQLCFXQHIIETLHPGGRAAVVVPDNVL-FEGGKGTDIRRDLXDKCHLHTILRLPTGIFYA
1i4wA           VTGEGSEGLIMQWLSCIGNKNWLYRFGKVLLWMPSTTARKLLARPGMHSRSKCSVVREA-----------
1dusA           ELLKDNGEIWVVIQTKQGAKSLAKYXKDVFGNVETVT---------------------------------
1suiA1          DLVKVGGVIGNGSVVAPPDAPLRKYVRYYRDFVLELNKALAV----------------------------
1vl5A           RVLKKGGQLLLVDNSAPENDAFDVFYNYVEKERDYSHHRAWKKS--------------------------
1ve3A1          RVLKPSGKFIXYFTDLRELLPRLKEISKVIPDQEERTV-----------------VIEFSFRVRFNVWGK
2f8lA1          CREEGHSFAHFIEQGXRYTKPGGYLFFLVPDAXFGTSDFAKVDKFIKKNGHIEGIIKLP-----------
1ufkA           EALVPGGRALLTGILKDRAPLVREAMAGAGFRPLEEAAE-------------------------------
2frnA1          SIAKDGAIIHYHNTVPEKLFETFKRITKEYGYDVEKLNELKIKRYAPGVW--------------------
2i6gA1          RCTXPGGYNL------------------------------------------------------------
1pqwA           QILAPGGRFIEL----------------------------------------------------------
2b78A2          EILSENGLIIASTNAA----------NMTVSQFKKQIEKGFGKQKHTYLDLQQLPSDFA-----------
1kp9A           RLLPADGVMLITGLHPKEIHERGLPMSFTFARFLKFIVTIFPGGR------------LPSIPMVQECASA
1ws6A1          GLVEAGGLYVLQHPKDLYLLGERRVY--------------------------------------------
1fp2A2          EAVTNDGKVTIIDMKKKDENQVTQIKLLMDVNMACLNGK-------ERNE-----------EEWKKLFIE
1h2tC2          KPKFVREVLE------------------------------------------------------------
1o54A           EALKGGGRFATVCPTTNQV---------------------------------------------------
1e50A           LGDVPDGTLVTVMAGNDENYSAELRNA--------------------TAAMKNQVARFNDLRFVGRSGRG
2p7hA1          DWLAEGGRLF------------------------------------------------------------
1g99A1          RVVHGGEKFTTSALYDEGVE--------------------------------------------------
1xtpA           QALTPNGYIFFKE---------------------------------------------------------
1h1dA           GLLRKGTVLL------------------------------------------------------------
1dctA           KQKKPIFFLAENVKGMMAQRHNKAVQEFIQEFDNAGY---------------------------------
1qamA           KIVFD-----------------------------------------------------------------
1pgjA2          KVFEKGDILVDTGNAHFKDQGRRAQQLEAAGLRFLGMGISGGEEGARKGPAFFPGGTLSVWEEIRPIVEA
1ixkA           EVLKPGGILV------------------------------------------------------------
1i9gA           RLLVAGGVLMV-----------------------------------------------------------
1f3lA           KYLAKGGSVY------------------------------------------------------------
1nv8A           ----------------------------------------------------------------------
1qyrA           HLFSYTDAIADM----------------------------------------------------------
1jsxA           HLPGEQGRFYALKGQMPE----------------------------------------------------
2esrA1          NLLSEQVXVVC-ETDKTVLL--------------------------------------------------
1t43A           NALVSGG-FLLLEH------GWQQG---------------------------------------------
1euqA1          KDAVAGKAFQ------------------------------------------------------------
1fp1D2          KALSPNGKVIIVEFEEPNTSEESKLVSTLDNLMFITVGG------RERT-----------EKQYEKLSKL
1wy7A1          ----ISDVVYSIHLAKPE----------------------------------------------------
2b9eA1          TFPSLQRLVYSTCSLCQE----------------------------------------------------
1eizA           DVLAPGGSFVV-----------------------------------------------------------
1ne2A           ----------------------------------------------------------------------
1a71A2          CCQEAYGVSVIVGVPPDSQNLS-------------MNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMA
1cf3A1          LTENPNISVLVIES------GSYESDRGPIIEDLNAYGDIFGSSVDHAYETVELATNNQTA---------
1yb5A2          SLLSHGGRVIVVGSRGTIEINPRDTMAKESSIIGVTLF--------------------------------
1ri1A           RHLRPGGYIMTVPSRDVILERYKQGRMSNDFYKIELMEDVPMESVREYRFTLLDSVNFVDFTRMVDGFKR


                         .         .         .         +         .         .         .:280
query           AGLKNVKYHSFTGGVAATHIGWK
2gh1A1          LGVKNIECRVSD-----------
1aqiA1          SGFTPILWAEYPHWEGEI-----
1yzhA1          KGQVIYRVE--------------
2ooxA1          NGYKDIYSHPERTADHGMDDLKS
1wxwA2          AVF--------------------
1xxlA           -----------------------
1o9gA           TRS---AVXVRAADVLE------
2avnA1          -----------------------
1p91A           TPF--------------------
1uirA           IRERNLALRHLT---APYLEAM-
1vbfA           -----------------------
2dulA1          AAKYDLGIDVYKDHYFRAFVKLK
1bhjA           VQVPGAGRDGA------------
1zq9A1          QEWDGLVRITFVRKNKTLSAAFK
2ckdA1          HGWRATAQSAPD-----------
1qzzA2          -----------------------
1f38A           -----------------------
2bzgA1          WGIDCLFEKLYL-----------
1xdzA           -----------------------
1i1nA           -----------------------
1pjzA           AGLERMDEHVY------------
1vlmA           AGFEEFKVVQTLFKHPSELSEIE
2ex4A1          AGLSLLAEERQENLPDEIYHVY-
1im8A           VGFSQVQCFNFGSXIA-------
2fpoA1          -----------------------
1sqfA2          DGFFYAKL---------------
1y8cA           GQLNILDKVDCYS----------
2avdA1          -----------------------
1dl5A1          -----------------------
2b25A1          -----------------------
1m6yA2          -----------------------
1nkvA           LGYDVVEXVLADQEGWDRYEAAK
1uwvA2          -----------------------
1yb2A1          -----------------------
2h00A1          -----------------------
1wznA1          KYFEKVKI---------------
2o57A1          CGLVTLRTFSRPDSLVHHYSKVK
2ar0A1          QGVKTNVLFFTK-GTVANPNQD-
1i4wA           -----------------------
1dusA           -----------------------
1suiA1          -----------------------
1vl5A           -----------------------
1ve3A1          TGVELLAKLYFTKEAEEKVGNY-
2f8lA1          -----------------------
1ufkA           -----------------------
2frnA1          -----------------------
2i6gA1          -----------------------
1pqwA           -----------------------
2b78A2          -----------------------
1kp9A           NGFTVTRVQSLQPHYAKTLDLW-
1ws6A1          -----------------------
1fp2A2          AGFQHYKISPLTG----------
1h2tC2          -----------------------
1o54A           -----------------------
1e50A           KSFTLTITVFTNPPQVATYHRA-
2p7hA1          -----------------------
1g99A1          -----------------------
1xtpA           -----------------------
1h1dA           -----------------------
1dctA           -----------------------
1qamA           -----------------------
1pgjA2          AAAKADDGRPCVTMNGS------
1ixkA           -----------------------
1i9gA           -----------------------
1f3lA           -----------------------
1nv8A           -----------------------
1qyrA           -----------------------
1jsxA           -----------------------
2esrA1          -----------------------
1t43A           -----------------------
1euqA1          -----------------------
1fp1D2          SGFSKFQ----------------
1wy7A1          -----------------------
2b9eA1          -----------------------
1eizA           -----------------------
1ne2A           -----------------------
1a71A2          -----------------------
1cf3A1          -----------------------
1yb5A2          -----------------------
1ri1A           LGLSLVERKGFI-----------