[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for bsub0:CAB15681.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1a5kC2.bssp"
#ERROR : Can't open dsspfile "1a5kC1.bssp"
#ERROR : Can't open dsspfile "1k6wA2.bssp"
#ERROR : Can't open dsspfile "1un7A2.bssp"
#ERROR : Can't open dsspfile "1gkpA2.bssp"
#ERROR : Can't open dsspfile "2p9bA2.bssp"
#ERROR : Can't open dsspfile "2a3lA1.bssp"
#ERROR : Can't open dsspfile "2ftyA1.bssp"
#ERROR : Can't open dsspfile "1xwyA1.bssp"
#ERROR : Can't open dsspfile "1yixA1.bssp"
#ERROR : Can't open dsspfile "2bb0A1.bssp"
#ERROR : Can't open dsspfile "2oodA2.bssp"
#ERROR : Can't open dsspfile "2oodA1.bssp"
#ERROR : Can't open dsspfile "1j6pA1.bssp"
#ERROR : Can't open dsspfile "1gkpA1.bssp"
#ERROR : Can't open dsspfile "2i9uA1.bssp"
#ERROR : Can't open dsspfile "1zzmA1.bssp"
#ERROR : Can't open dsspfile "1onwA1.bssp"
#ERROR : Can't open dsspfile "2gokA1.bssp"
#ERROR : Can't open dsspfile "2qs8A1.bssp"
#ERROR : Can't open dsspfile "1k6wA1.bssp"
#ERROR : Can't open dsspfile "3be7A1.bssp"
#ERROR : Can't open dsspfile "1xrfA1.bssp"
#ERROR : Can't open dsspfile "1ymyA1.bssp"
#ERROR : Can't open dsspfile "2oofA1.bssp"
#ERROR : Can't open dsspfile "1gkrA1.bssp"
#ERROR : Can't open dsspfile "2p9bA1.bssp"
#ERROR : Can't open dsspfile "2icsA1.bssp"
#ERROR : Can't open dsspfile "2r8cA1.bssp"
#ERROR : Can't open dsspfile "1m7jA1.bssp"
#ERROR : Can't open dsspfile "1un7A1.bssp"
#ERROR : Can't open dsspfile "1dpmA.bssp"
#ERROR : Can't open dsspfile "2f6kA1.bssp"
#ERROR : Can't open dsspfile "1bohA1.bssp"
#ERROR : Can't open dsspfile "1pxzA.bssp"
#ERROR : Can't open dsspfile "2qs8A1.bssp"

## Summary of PDB Search
:569
    e-110  59%  1a5kC2 [c.1.9.2] UREASE (ALPHA SUBUNIT) C:130 -- 422 C:476 -- 567
    7e-34  57%  1a5kC1 [b.92.1.1] UREASE (ALPHA SUBUNIT) C:2 -- 129 C:423 -- 475
    3e-31   8%  1k6wA2 [c.1.9.5] CYTOSINE DEAMINASE A:56 -- 375
    5e-27  12%  1un7A2 [c.1.9.10] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE A:58
    5e-26  12%  1gkpA2 [c.1.9.6] HYDANTOINASE A:55 -- 389
    8e-23  10%  2p9bA2 [c.1.9.17] POSSIBLE PROLIDASE A:71 -- 394
    8e-22  11%  2a3lA1 [c.1.9.1] AMP DEAMINASE A:212 -- 839
    2e-19  11%  2ftyA1 [b.92.1.3] DIHYDROPYRIMIDINASE A:2 -- 56 A:441 -- 541
    1e-18  11%  1xwyA1 [c.1.9.12] DEOXYRIBONUCLEASE TATD A:1 -- 260
    2e-18  14%  1yixA1 [c.1.9.12] DEOXYRIBONUCLEASE YCFH A:1 -- 265
    2e-17  21%  2bb0A1 [b.92.1.10] IMIDAZOLONEPROPIONASE A:3 -- 73 A:374 -- 415
    7e-17   7%  2oodA2 [c.1.9.9] BLR3880 PROTEIN A:73 -- 397
    4e-16  14%  2oodA1 [b.92.1.4] BLR3880 PROTEIN A:3 -- 72 A:398 -- 467
    1e-15  16%  1j6pA1 [b.92.1.4] METAL-DEPENDENT HYDROLASE OF A:-1 -- 49 A:331 --
    2e-14  17%  1gkpA1 [b.92.1.3] HYDANTOINASE A:2 -- 54 A:390 -- 459
    3e-14   9%  2i9uA1 [b.92.1.4] CYTOSINE/GUANINE DEAMINASE RELATED PROTEIN A:9 --
    1e-13  12%  1zzmA1 [c.1.9.12] PUTATIVE DEOXYRIBONUCLEASE YJJV A:1 -- 259
    1e-12  19%  1onwA1 [b.92.1.7] ISOASPARTYL DIPEPTIDASE A:1 -- 62 A:347 -- 389
    2e-12  17%  2gokA1 [b.92.1.10] IMIDAZOLONEPROPIONASE A:17 -- 79 A:381 -- 420
    3e-12  21%  2qs8A1 [b.92.1.9] XAA-PRO DIPEPTIDASE A:7 -- 63 A:374 -- 412
    4e-12  13%  1k6wA1 [b.92.1.2] CYTOSINE DEAMINASE A:4 -- 55 A:376 -- 426
    2e-11  30%  3be7A1 [b.92.1.9] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE A:3 -- 56
    2e-11  20%  1xrfA1 [b.92.1.3] DIHYDROOROTASE A:1 -- 55 A:366 -- 422
    9e-11  17%  1ymyA1 [b.92.1.5] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE A:1
    3e-10  12%  2oofA1 [b.92.1.10] 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE A:3 --
    3e-10  23%  1gkrA1 [b.92.1.3] NON-ATP DEPENDENT L-SELECTIVE HYDANTOINASE A:1 --
    8e-10  26%  2p9bA1 [b.92.1.10] POSSIBLE PROLIDASE A:9 -- 70 A:395 -- 450
    1e-09  20%  2icsA1 [b.92.1.8] ADENINE DEAMINASE A:4 -- 54 A:322 -- 371
    2e-09  22%  2r8cA1 [b.92.1.9] PUTATIVE AMIDOHYDROLASE A:2 -- 57 A:369 -- 414
    5e-09  29%  1m7jA1 [b.92.1.6] D-AMINOACYLASE A:7 -- 61
    8e-08  29%  1un7A1 [b.92.1.5] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE A:3
    9e-05   9%  1dpmA  [c.1.9.3] PHOSPHOTRIESTERASE
    5e-04  13%  2f6kA1 [c.1.9.15] METAL-DEPENDENT HYDROLASE A:2 -- 307
    7e-04  39%  1bohA1 [c.46.1.2] RHODANESE A:1 -- 149
    7e-04  24%  1pxzA  [b.80.1.1] MAJOR POLLEN ALLERGEN JUN A 1
    1e-04  11%  2qs8A1 [b.92.1.9] XAA-PRO DIPEPTIDASE A:7 -- 63 A:374 -- 412(query 68->124)
:569

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xKMSREEYAELFGPTTGDKIRLGDTDLWIEVEKDFTVYGEEMIFGGGKTIRDGMGQNGRITGKDGALDLV
1a5kC2          ----------------------------------------------------------------------
1a5kC1          -NISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQGQ--MLAADCVDLV
1k6wA2          ----------------------------------------------------------------------
1un7A2          ----------------------------------------------------------------------
1gkpA2          ----------------------------------------------------------------------
2p9bA2          ----------------------------------------------------------------------
2a3lA1          ----------------------------------------------------------------------
2ftyA1          -------------------------------------------------------------------DLI
1xwyA1          ----------------------------------------------------------------------
1yixA1          ----------------------------------------------------------------------
2bb0A1          ----------------------------------------------------------------------
2oodA2          ----------------------------------------------------------------------
2oodA1          ----------------------------------------------------------------------
1j6pA1          ----------------------------------------------------------------------
1gkpA1          --------------------------------------------------------------------LL
2i9uA1          ----------------------------------------------------------------------
1zzmA1          ----------------------------------------------------------------------
1onwA1          -----------------------------------------------------------MIDYTAAGFTL
2gokA1          -------------------------------------------------------------------TAL
2qs8A1          ----------------------------------------------------------------------
1k6wA1          --------------------------------------------------------------------QT
3be7A1          -----------------------------------------------------------------SEDFL
1xrfA1          -------------------------------------------------------------------KLI
1ymyA1          --------------------------------------------------------------------YA
2oofA1          ----------------------------------------------------------------------
1gkrA1          -------------------------------------------------------------------DVI
2p9bA1          ----------------------------------------------------------------------
2icsA1          ----------------------------------------------------------------------
2r8cA1          --------------------------------------------------------------------FL
1m7jA1          ------------------------------------------------------------------FDYI
1un7A1          ----------------------------------------------------------------------
1dpmA           ----------------------------------------------------------------------
2f6kA1          ----------------------------------------------------------------------
1bohA1          ----------------------------------------------------------------------
1pxzA           --------------------------LWIIFSQNMNIKKMPLYVAGHKTI-DGRGADVHLGNGGPCLFMR
2qs8A1          -------------------------------------------------------------------KTL


                         .         .         *         .         .         .         .:140
query           ITNVVLLDYTGIVKADVGVKDGRIVGVGKSGNPDIMDGVDPHMVIGAGTEVISGEGKILTAGGVDTHIHF
1a5kC2          --------------------------------------------------------------GIDTHIHW
1a5kC1          LTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVTIP--IGAATEVIAAEGKIVTAGSIEVGKLA
1k6wA2          -----------------------------------------HLDTTQTAGQPNWNQSGTLFEGIERWAER
1un7A2          -------------------------------------------------------------GMIDIHIHG
1gkpA2          ---------------------------------------------------------------IDPHVHI
2p9bA2          -------------------------------------------------------------GLINAHTHL
2a3lA1          ----------------------------------------------------------------------
2ftyA1          IKNGIICTASDIYAAEIAVNNGKVQLIAASIDPSLGS---------EVIDAEGAFITPILPGVSDADLVI
1xwyA1          ---------------------------------------------------------------FDIGVNL
1yixA1          ---------------------------------------------------------------VDSHCHL
2bb0A1          ----------------------------------------------------------------------
2oodA2          -------------------------------------------------------------GFIDGHIHL
2oodA1          ----------------------------------------------------------------------
1j6pA1          ----------------------------------------------------------------------
1gkpA1          IKNGEIITADSRYKADIYAEGETITRIG------------QNLEAPPGTEVIDATGKYVFPGADLVVYDP
2i9uA1          ----------------------------------------------------------------------
1zzmA1          -------------------------------------------------------------RFIDTHCHF
1onwA1          LQGAHLYAPEDRGICDVLVANGKIIAVASNIPSD----------IVPNCTVVDLSGQILCPEILPGNDAD
2gokA1          WRNAQLATIGAVENAVIAVRNGRIAFAGPESDLPDDLS--------TADETTDCGGRWITLEAGKSADFA
2qs8A1          ----------------------------------------------------------------------
1k6wA1          IINARLPGEEGLW--QIHLQDGKISAIDAQSGVMPIT-----------ENSLDAEQGLVIPLIILPAENG
3be7A1          IKSKGYLDTGEIIKADLLIRNGKIAEIGKINTKD--------------ATVISIPDLILIPQIKEGFDAD
1xrfA1          VKNGYVIDPSQEGEFDILVENGKIKKIDKNILVP-------------EAEIIDAKGLIVCPTLKLGSPAD
1ymyA1          LTQGRIFTGHEFLDHAVVIADGLIKSVCPVAEL------------PPEIEQRSLNGAILSPTLAAGKVAN
2oofA1          ----------------------------------------------------------------------
1gkrA1          VKNCRLVSSDGITEADILVKDGKVAAISADTSDVEA------------SRTIDAGGKFVMPTLQVGSDA-
2p9bA1          ----------------------------------------------------------------------
2icsA1          ----------------------------------------------------------------------
2r8cA1          FRNGALLDPDHLQGFEILIEDGFIREVSDKPIK------------SSNAHVIDVKGKTIMPRIVPAHADV
1m7jA1          LSGGTVIDGTNARLADVGVRGDRIAAVGDLSASS-------------ARRRIDVAGKVVS----------
1un7A1          ----------------------------------------------------------------------
1dpmA           ----------------------------------------------ARINTVRGPITISEAGFTLTHEHI
2f6kA1          ----------------------------------------------------------------------
1bohA1          ----------------------------------------------------------------------
1pxzA           VSHVILLHIHGCNTSVLG--DVLVSESIGVEPVHAQDG--------------------------------
2qs8A1          IHAGKLIDGKSQSRISIVIDGNIISDIK----KGFISSNDFEDYIDLRDHTVLP----------------


                         +         .         .         .         .         *         .:210
query           ICPQQMEVXXXXXXXXXXXXXXXXXXXXXXXXCTSGAWYMARMLEAAEEFPINVGFLGKGNASDKAPLIE
1a5kC2          ICPQQAEEALVSGVTTMVGGGTGPAAGTHATTCTPGPWYISRMLQAADSLPVNIGLLGKGNVSQPDALRE
1a5kC1          DLVVW-----------------------------------------------------------------
1k6wA2          KALLTHDKQRAWQTLKWQIANGIQHVRTHVDVSDATLTALKAMLEVKQEVAPWIDLQIVAFPQEGILSYP
1un7A2          GYGADMDASFSTLDIMSSRLPEEGTTSFLATTITQEHGNISQALVNAREWKAESSLLGAEGIHLEGPFVS
1gkpA2          YLPFMATFAKDTHETGSKAALMGGTTTYIEMCCPSRNDDALEGYQAEGNSYCDYTFHMKFDEKTEGQLRE
2p9bA2          FVKHNATTLLESGVTTIRTLGDVGYEVVTLRDQIDAGQILGPRILASGPLXAIPEGHGGTPEEARTAVAQ
2a3lA1          ----------------------------------------------------------------------
2ftyA1          WYPDDSKKEYNSKPKLITNKLMEHNCDYTPFEGIEIKNWPRYTIVKGKIVYKEGEILKENAD-GKYLKRG
1xwyA1          TSSDVVACAFDAGVNGLLITGTNLRESQQAQKLARQYSSCWSTAGVHPHDSSQWQAATEEAIIELAAQPE
1yixA1          DGLDYES---LHKDVDDVLAKAAARDVKFCLAVATTLPSYLHMRDLVGERDNVVHPLNQNDPYDVEDLRR
2bb0A1          ----------------------------------------------------------------------
2oodA2          PQTRVAYGEQLLPWLQKSIYPEEIKYKDRNYAREGVKRFLDALLAAGTTTCQAFTSSSPVATEELFEEAS
2oodA1          ----------------------------------------------------------------------
1j6pA1          ----------------------------------------------------------------------
1gkpA1          QYRGTISVKTQHVNNDYNGFEGFEIDGRPSVVTVRGKVAVRDGQFVGEKG--------------------
2i9uA1          ----------------------------------------------------------------------
1zzmA1          DFPPFSGDEEASLQRAAQAGVGKIIVPATEAENFARVLALAENGMLEKHSDVSLEQLQQALERRPAKVVA
1onwA1          LLV-------------------------------------------------------------------
2gokA1          IWDIE-----------------------------------------------------------------
2qs8A1          ----------------------------------------------------------------------
1k6wA1          FDA-------------------------------------------------------------------
3be7A1          IVG-------------------------------------------------------------------
1xrfA1          ITIFD-----------------------------------------------------------------
1ymyA1          LTA-------------------------------------------------------------------
2oofA1          ----------------------------------------------------------------------
1gkrA1          ----------------------------------------------------------------------
2p9bA1          ----------------------------------------------------------------------
2icsA1          ----------------------------------------------------------------------
2r8cA1          LVVDG-----------------------------------------------------------------
1m7jA1          ----------------------------------------------------------------------
1un7A1          ----------------------------------------------------------------------
1dpmA           CGSGSRKALAEKAVRGLRRARAAGVRTIVDVSTFDIGRDVSLLAEVSRAADVHTGLWFDPPLSMRLRSVE
2f6kA1          --------------------------------------ANDDGKSLAQQYPDQLGYLASLPIPYELDAVK
1bohA1          ----------------------------------------------------------------------
1pxzA           ----------------------------------------------------------------------
2qs8A1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           QVEAGAIGLKLHEDWGTTPSAIKTCMEVVDEADIQVAIHTDTINEAGFLENTLDAIGDRVIHTYHIEGAG
1a5kC2          QVAAGVIGLEIHEDWGATPAAIDCALTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAG
1a5kC1          ----------------------------------------------------------------------
1k6wA2          NADVVGAIPHFEFTREYGVESLHKTFALAQKYDRLIDVHCDEIDDEQSRFVETVAALAHHEGMGARVTAS
1un7A2          PKRAGAQPKEWIRPS--DVELFKKWQQEAGGLIKIVTLAPEEDQHFELIRHLKDEIIASMGHTDADSALL
1gkpA2          IVADGISSFXIFNFFGVDDGEMYQTLRLAKELGVIVTAHCE---NAELVGRLQQKLLSEGKTGPEWHEPS
2p9bA2          NLKAGVNAIKIAATGGVTDAQEIQICDEAHQYGVIVGAHAQSPE----------GVRRSLLAGVDTIEHG
2a3lA1          ------------------------LRESKGMTTITLRPHSGEAGDIDHLA-ATFLTCHSIAHGINL----
2ftyA1          KSFMCTPKNEWVTEWR------------------------------------------------------
1xwyA1          VVAIGECGLDFNRNFSTPEEQERAQLRIAADLNMPVFMHCRDAHEMTLLEPWLDKLPGAVLHCFTGTRE-
1yixA1          LAALGETGLDYYYTPETKVESFIHHIQIGRELNKPVIVHTRDARAD-TLAILREEKVTDCGGVLHCFTED
2bb0A1          ----------------------------------------------------------------------
2oodA2          RRNXRVIAGLTGIDRNAPAEFIDTPENFYRDSRLIAQYHDKGRNLYAITPRFAFGASPELLKACQRLKHE
2oodA1          ----------------------------------------------------------------------
1j6pA1          ----------------------------------------------------------------------
1gkpA1          ----------------------------------------------------------------------
2i9uA1          ----------------------------------------------------------------------
1zzmA1          VGEIGLDLFGDDPQFERQQWLLDEQLKLAKRYDLPVILH-----SRRTHDKLAMHLKRHDLPRTGVVHGF
1onwA1          ----------------------------------------------------------------------
2gokA1          ----------------------------------------------------------------------
2qs8A1          ----------------------------------------------------------------------
1k6wA1          ----------------------------------------------------------------------
3be7A1          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
1ymyA1          ----------------------------------------------------------------------
2oofA1          ----------------------------------------------------------------------
1gkrA1          ----------------------------------------------------------------------
2p9bA1          ----------------------------------------------------------------------
2icsA1          ----------------------------------------------------------------------
2r8cA1          ----------------------------------------------------------------------
1m7jA1          ----------------------------------------------------------------------
1un7A1          ----------------------------------------------------------------------
1dpmA           EYGIEDTGIRAGKATPFQELVLKAAARASLATGVPVTTHTAASQRDGEQQAAIFESEGLSPSRVCIGHSD
2f6kA1          TVQQGALGVTVPTNSRGLYPVLERVYQELDARQAIVALHP-----------------------------N
1bohA1          ----------------------------------------------------------------------
1pxzA           ----------------------------------------------------------------------
2qs8A1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GGHAPDIMKLASYANILPSSTTPTIPYTVNTMDEHLDMMMVCHHLDAKVPEDVAFSHSRIRAATIAAEDI
1a5kC2          GGHAPDIITACAHPNILPSSTNPTLPYTLNTIDEHLDMLMVCHHLDPDIAEDVAFAESRIRRETIAAEDV
1a5kC1          ----------------------------------------------------------------------
1k6wA2          HTT------------AMHSYNGAYTSRLFRLLKMSGINFVANPLVNIHLQGRFDT---YPKRRGITRVKE
1un7A2          SDAAKAGASHMTHLYNAMSPFHHREPGVIGTALAHDGFVLIADGIHSHPLAAKLAFLAKGSSKLILITDS
1gkpA2          RPEAVEAEGTARFATFLETTGATGYVVHLSCKPIYIESVIPHFLLDKTYAERGGVEAMKYIMSPPLRDKR
2p9bA2          SVLDDELIGXFRHNPNALRGY----SALIPTLSAGLPLTLLGQDV-TGITDIQLENSKNVVGGXVSGARQ
2a3lA1          -RKSPVLQYLYYLAQIGLAMSPLSNNSLFLDYHRNPFPVFFLRGLNVSLST-------------------
2ftyA1          ----------------------------------------------------------------------
1xwyA1          --EMQACVAHGIYIGITGWVCDERRGLELRELLIPAEKLLIETDAPYLLPRDLTPKPSSRRNEPAHLPHI
1yixA1          RETAGKLLDLGFYISFSGIVTFRNAEQLRDAARYPLDRLLVETDSPYLAPVPHRGKENQPAMVRDVAEYM
2bb0A1          ------------------------------------------------------------------IDTI
2oodA2          HPDCWVNTHISENPAEHPDCQDYLGVYEKFDLVGPKFSGGHGVYLSNNEFRRXSKKGAAVVFCPCSNRAT
2oodA1          ----------------------------------------------------------------------
1j6pA1          ----------------------------------------------------------------------
1gkpA1          ----------------------------------------------------------------------
2i9uA1          ----------------------------------------------------------------------
1zzmA1          SGSLQQAERFVQLGYKIGVGGTITYPRASKTRDDAPDMPLNGFQGQPNRPEQAARVFAVLCELRREPADE
1onwA1          ----------------------------------------------------------------------
2gokA1          ----------------------------------------------------------------------
2qs8A1          ----------------------------------------------------------------------
1k6wA1          ----------------------------------------------------------------------
3be7A1          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
1ymyA1          ----------------------------------------------------------------------
2oofA1          ----------------------------------------------------------------------
1gkrA1          ----------------------------------------------------------------------
2p9bA1          ----------------------------------------------------------------------
2icsA1          ----------------------------------------------------------------------
2r8cA1          ----------------------------------------------------------------------
1m7jA1          ----------------------------------------------------------------------
1un7A1          ----------------------------------------------------------------------
1dpmA           DTDDLSYLTALAARG-YLIGLDHIPHSAIGLEDNASASALLGIRSWQTRALLIKA---------------
2f6kA1          EPAILPKNVDIDLPVPLLGDTTXTFINXLHFFEKYPNIKVIIPHAGAFLGIDDRIAQYAQKVYQVDVYDV
1bohA1          ----------------------------------------------------------------------
1pxzA           ----------------------------------------------------------------------
2qs8A1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LHDIGAISMTSSDSQAMGRVGEVIIRTWQVADKMKKQRGALAGENGNDNVRAKRYIAKYTINPAITHGLS
1a5kC2          LHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQRGALAEETDNDNFRVKRYIAKYTINPALTHGIA
1a5kC1          ----------------------------------------------------------------------
1k6wA2          MLESGINVCFGHDDVFDPWYPLGTANMLQVLHMGLHVCQL------MGYGQINDGLNLITHHSARTLNLQ
1un7A2          MRAKGLKDGVYEFGGQSVTVRGRTALLSDGTLAGSILKMNEGARHMFTNCSWTDIANITSENAAKQLGIF
1gkpA2          NQKDTVGTDHCPFDTEQKLLGKEAFTAIPNGIPAIEDRVNLLYTYGRGRLDIHRFVDAASTKAAKLFGLF
2p9bA2          AHEAGLXIGVGTDTGXTF---VPQYATWRELELLVAYAG----------FSPAEALHAATAVNASILGVD
2a3lA1          -DDPLQIHLTKEPLVEEYSIAASVWKLSACDLCE------------------------IARNSVYQSGFS
2ftyA1          ----------------------------------------------------------------------
1xwyA1          LQRIAHWRGEDAA--------WLAATTDANVKTL------------------------------------
1yixA1          AVLKGLAQVTT-----------------------------------------------------------
2bb0A1          LINIGQLLTMESSGPRAGKSMQDLHVIEDAVVGIHEQK----------IVFAGQKGAEAGYEADEIIDCS
2oodA2          DPEHRVKXSFGTDVGGGNRFSXISVLDDAYKVGXCNNTLLDGSIDERNKLSPYRGFWSVTLGGAEGLYID
2oodA1          ----GTFFDFVDDPWKHIGNEQAAARFHQDGLXVTDGVIKAFGP---------YEKIAAAHPGVEITHIK
1j6pA1          ------------------------------NCLILKDFSSEPFWGAIENGTIKRVLQGEVKVDLDLSGK-
1gkpA1          ----------------------------------------------------------------------
2i9uA1          ------------------------LKIFKGNLIFTKTSDKFTIMKSYIVVIDVSSNLPDKYKGNPIIDFR
1zzmA1          IAQA------------------------------------------------------------------
1onwA1          ----------------------------------------------------------------------
2gokA1          ----------------------------------------------------------------------
2qs8A1          ---------------------KTLIHAGKLIDGKSDQRISIVIDGNIISDIKKGFISSNDFEDYIDLRDH
1k6wA1          ----------------------------------------------------------------------
3be7A1          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
1ymyA1          ----------------------------------------------------------------------
2oofA1          ----------NCERVWLNV-------TPATLRSDLADYGLEPHALGVHERIHALVPXQDLKYPAHWQDXK
1gkrA1          ----------------------------------------------------------------------
2p9bA1          -----------------------------------------------DGRIEQVAPSIETSIPAEYHYLD
2icsA1          --------------------------------------------------------ATISGSAKETIHLE
2r8cA1          ----------------------------------------------------------------------
1m7jA1          ----------------------------------------------------------------------
1un7A1          ---------------------------------------NDGKISTVSTERPKEPYSKEIQAPADSVLL-
1dpmA           ----------------------------------------------------------------------
2f6kA1          XHHVYFDVAGAVLPRQLPTLXSLA----------------------------------------------
1bohA1          ----------------------------------------------------------------------
1pxzA           ----------------------------------------------------------------------
2qs8A1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           HEVGSVEKGKLADLVLWDPVFFGVKPELVLKGGMIARAQMGDPNASIPTPEPVFMRQMYASYGKANRSTS
1a5kC2          HEV---------------GMF--------------------------------------GALGSARHHCR
1a5kC1          ----------------------------------------------------------------------
1k6wA2          D--YGIAAGNSAN---------------------------------------------------------
1un7A2          DRKG------------------------------------------------------------------
1gkpA2          PRKGTIAVGS------------------------------------------------------------
2p9bA2          AETGS-----------------------------------------------------------------
2a3lA1          HALKSHWIGKDYYKRGPDGNDIHKTNVPHIRVEFRDTIWKEEMQQVY-----------------------
2ftyA1          ----------------------------------------------------------------------
1xwyA1          ----------------------------------------------------------------------
1yixA1          ----------------------------------------------------------------------
2bb0A1          GRLVTLKAGRSADLVIWQAHYGVNHVHQVMKNGTI-----------------------------------
2oodA2          DKLGN-----------------------------------------------------------------
2oodA1          DRIIVFEPGKEADFVALDPNGG---QLAQPWHQSLIGAGPRTVD--------------------------
1j6pA1          LVXPKIEEGWNADLVVIDLDLPEXFPVQNIKNHLVHAF-SGEVFATXVAGKWIYFDGEYPTIDSE---EV
1gkpA1          ----------------------------------------------------------------------
2i9uA1          NNIIIFEEGYDFDALVINDSNLYPEDY-DLTERLERFIYLGDDR--------------------------
1zzmA1          ----------------------------------------------------------------------
1onwA1          ----------------------------------------------------------------------
2gokA1          ----------------------------------------------------------------------
2qs8A1          TVLPSIESGKLADLIAVKDISVLENVDVVIKDGLLYEG--------------------------------
1k6wA1          ----------------------------------------------------------------------
3be7A1          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
1ymyA1          ----------------------------------------------------------------------
2oofA1          GKLVTLRVGXLADFLVWNCGHPAEQLVSRVVNGEE-----------------------------------
1gkrA1          ----------------------------------------------------------------------
2p9bA1          GKIVXLEVGKSADLLVLNANPLLEHPALVIAAGHPGPKRFADIDA-------------------------
2icsA1          PGSATLEIGKDADLTIFTIQAEEKTLTDSNGLTRVAKE-QIRPIKTI-----------------------
2r8cA1          ----------------------------------------------------------------------
1m7jA1          ----------------------------------------------------------------------
1un7A1          ---PSVTVGKDADLVIVSSDC---EVILTICRGNI-----------------------------------
1dpmA           ----------------------------------------------------------------------
2f6kA1          ----------------------------------------------------------------------
1bohA1          -----------APRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPRPEP------------------
1pxzA           ----------------------------------------------------------------------
2qs8A1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           ITFMSQASIERGVAESLGLEKRISPVKNIRKLSKLDMKLNSALPKIEIDPKTYQVFADGEELSCQPVDYV
1a5kC2          LTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTYEVRVDGELITSEPADVL
1a5kC1          ----------------------------------------------------------------------
1k6wA2          ----------------------------------------------------------------------
1un7A2          ----------------------------------------------------------------------
1gkpA2          ----------------------------------------------------------------------
2p9bA2          ----------------------------------------------------------------------
2a3lA1          ----------------------------------------------------------------------
2ftyA1          ----------------------------------------------------------------------
1xwyA1          ----------------------------------------------------------------------
1yixA1          ----------------------------------------------------------------------
2bb0A1          ----------------------------------------------------------------------
2oodA2          ----------------------------------------------------------------------
2oodA1          ----------------------------------------------------------------------
1j6pA1          KRELARIEKE------------------------------------------------------------
1gkpA1          ----------------------------------------------------------------------
2i9uA1          ----------------------------------------------------------------------
1zzmA1          ----------------------------------------------------------------------
1onwA1          ----------------------------------------------------------------------
2gokA1          ----------------------------------------------------------------------
2qs8A1          ----------------------------------------------------------------------
1k6wA1          ----------------------------------------------------------------------
3be7A1          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
1ymyA1          ----------------------------------------------------------------------
2oofA1          ----------------------------------------------------------------------
1gkrA1          ----------------------------------------------------------------------
2p9bA1          ----------------------------------------------------------------------
2icsA1          ----------------------------------------------------------------------
2r8cA1          ----------------------------------------------------------------------
1m7jA1          ----------------------------------------------------------------------
1un7A1          ----------------------------------------------------------------------
1dpmA           ----------------------------------------------------------------------
2f6kA1          ----------------------------------------------------------------------
1bohA1          ----------------------------------------------------------------------
1pxzA           ----------------------------------------------------------------------
2qs8A1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           PLGQRYFLF
1a5kC2          PMAQRYFLF
1a5kC1          ---------
1k6wA2          ---------
1un7A2          ---------
1gkpA2          ---------
2p9bA2          ---------
2a3lA1          ---------
2ftyA1          ---------
1xwyA1          ---------
1yixA1          ---------
2bb0A1          ---------
2oodA2          ---------
2oodA1          ---------
1j6pA1          ---------
1gkpA1          ---------
2i9uA1          ---------
1zzmA1          ---------
1onwA1          ---------
2gokA1          ---------
2qs8A1          ---------
1k6wA1          ---------
3be7A1          ---------
1xrfA1          ---------
1ymyA1          ---------
2oofA1          ---------
1gkrA1          ---------
2p9bA1          ---------
2icsA1          ---------
2r8cA1          ---------
1m7jA1          ---------
1un7A1          ---------
1dpmA           ---------
2f6kA1          ---------
1bohA1          ---------
1pxzA           ---------
2qs8A1          ---------