[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cele0:F10G7.2

[Show Plain Result]

#ERROR : Can't open dsspfile "3bdlA.bssp"
#ERROR : Can't open dsspfile "2wacA.bssp"
#ERROR : Can't open dsspfile "2wacB.bssp"
#ERROR : Can't open dsspfile "2o4xA.bssp"
#ERROR : Can't open dsspfile "2hqeA.bssp"
#ERROR : Can't open dsspfile "2e6nA.bssp"
#ERROR : Can't open dsspfile "2hqxA.bssp"
#ERROR : Can't open dsspfile "2o4xB.bssp"
#ERROR : Can't open dsspfile "2hqeB.bssp"
#ERROR : Can't open dsspfile "2diqA.bssp"
#ERROR : Can't open dsspfile "3fdrA.bssp"
#ERROR : Can't open dsspfile "3bdlA.bssp"

## Summary of PDB Search
:914
    e-106  43%  3bdlA  [x.x.x] STAPHYLOCOCCAL NUCLEASE DOMAIN-CONTAINING
    4e-43  44%  2wacA  [x.x.x] CG7008-PA
    1e-41  44%  2wacB  [x.x.x] CG7008-PA
    1e-34  34%  2o4xA  [x.x.x] STAPHYLOCOCCAL NUCLEASE DOMAIN-CONTAINING
    3e-34  33%  2hqeA  [x.x.x] P100 CO-ACTIVATOR TUDOR DOMAIN
    6e-19  44%  2e6nA  [x.x.x] STAPHYLOCOCCAL NUCLEASE DOMAIN-CONTAINING
    9e-17  43%  2hqxA  [x.x.x] P100 CO-ACTIVATOR TUDOR DOMAIN
    3e-14  44%  2o4xB  [x.x.x] STAPHYLOCOCCAL NUCLEASE DOMAIN-CONTAINING
    7e-14  43%  2hqeB  [x.x.x] P100 CO-ACTIVATOR TUDOR DOMAIN
    8e-05  26%  2diqA  [x.x.x] TUDOR AND KH DOMAIN-CONTAINING PROTEIN
    3e-04  25%  3fdrA  [x.x.x] TUDOR AND KH DOMAIN-CONTAINING PROTEIN
    6e-10  30%  3bdlA  [x.x.x] STAPHYLOCOCCAL NUCLEASE DOMAIN-CONTAINING(query 28->229)
:914

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxVKSVLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDS
3bdlA           ----------------------------------------------------------------------
2wacA           ----------------------------------------------------------------------
2wacB           ----------------------------------------------------------------------
2o4xA           ----------------------------------------------------------------------
2hqeA           ----------------------------------------------------------------------
2e6nA           ----------------------------------------------------------------------
2hqxA           ----------------------------------------------------------------------
2o4xB           ----------------------------------------------------------------------
2hqeB           ----------------------------------------------------------------------
2diqA           ----------------------------------------------------------------------
3fdrA           ----------------------------------------------------------------------
3bdlA           ---------------------------VMQVLNADAIVVKLNSGDYK----TIHLSSIRPPRLEGENTQD


                         .         .         *         .         .         .         .:140
query           ASATPDEPYAWDSREYLRQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQ
3bdlA           ----------------------------------------------------------------------
2wacA           ----------------------------------------------------------------------
2wacB           ----------------------------------------------------------------------
2o4xA           ----------------------------------------------------------------------
2hqeA           ----------------------------------------------------------------------
2e6nA           ----------------------------------------------------------------------
2hqxA           ----------------------------------------------------------------------
2o4xB           ----------------------------------------------------------------------
2hqeB           ----------------------------------------------------------------------
2diqA           ----------------------------------------------------------------------
3fdrA           ----------------------------------------------------------------------
3bdlA           KNKKLDIPYMFEAREFLRKKLIGKKVNVTVDYPAFSERTCATVTIGGI------NIAEALVSKGLATVIR


                         +         .         .         .         .         *         .:210
query           GKVADEYSTKLLELQEQAKSAGRGKWNSNAGTIRDIRWVIDNPRELVDKYAQKPIDAVIEMVRDGSTVRA
3bdlA           ----------------------------------------------------------------------
2wacA           ----------------------------------------------------------------------
2wacB           ----------------------------------------------------------------------
2o4xA           ----------------------------------------------------------------------
2hqeA           ----------------------------------------------------------------------
2e6nA           ----------------------------------------------------------------------
2hqxA           ----------------------------------------------------------------------
2o4xB           ----------------------------------------------------------------------
2hqeB           ----------------------------------------------------------------------
2diqA           ----------------------------------------------------------------------
3fdrA           ----------------------------------------------------------------------
3bdlA           YRQDDDHYDELLAAEARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQPFLQRASEAVVEYVFSGSRLKL


                         .         .         .         +         .         .         .:280
query           FLLPNFEYITLQLSGVRAPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bdlA           ----------------------------------------------------------------------
2wacA           ----------------------------------------------------------------------
2wacB           ----------------------------------------------------------------------
2o4xA           ----------------------------------------------------------------------
2hqeA           ----------------------------------------------------------------------
2e6nA           ----------------------------------------------------------------------
2hqxA           ----------------------------------------------------------------------
2o4xB           ----------------------------------------------------------------------
2hqeB           ----------------------------------------------------------------------
2diqA           ----------------------------------------------------------------------
3fdrA           ----------------------------------------------------------------------
3bdlA           YLPKETCLITFLLAGIECP---------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKAFTGKVVEI
3bdlA           ------------------------------------------------------------KQFVAKVMQV
2wacA           ----------------------------------------------------------------------
2wacB           ----------------------------------------------------------------------
2o4xA           ----------------------------------------------------------------------
2hqeA           ----------------------------------------------------------------------
2e6nA           ----------------------------------------------------------------------
2hqxA           ----------------------------------------------------------------------
2o4xB           ----------------------------------------------------------------------
2hqeB           ----------------------------------------------------------------------
2diqA           ----------------------------------------------------------------------
3fdrA           ----------------------------------------------------------------------
3bdlA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VLSDAVVVQKDDGSEVKLHLSSIRLPRESGDDKATGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQ
3bdlA           LNADAIVVKLNSGDYKTIHLSSIRPPRLEGEN--TQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVT
2wacA           ----------------------------------------------------------------------
2wacB           ----------------------------------------------------------------------
2o4xA           ----------------------------------------------------------------------
2hqeA           ----------------------------------------------------------------------
2e6nA           ----------------------------------------------------------------------
2hqxA           ----------------------------------------------------------------------
2o4xB           ----------------------------------------------------------------------
2hqeB           ----------------------------------------------------------------------
2diqA           ----------------------------------------------------------------------
3fdrA           ----------------------------------------------------------------------
3bdlA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           IDYVQPKSENFPEKTCATIKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTXXXXXXXXXXXXXXXF
3bdlA           VDYIRPASPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLH
2wacA           ----------------------------------------------------------------------
2wacB           ----------------------------------------------------------------------
2o4xA           ----------------------------------------------------------------------
2hqeA           ----------------------------------------------------------------------
2e6nA           ----------------------------------------------------------------------
2hqxA           ----------------------------------------------------------------------
2o4xB           ----------------------------------------------------------------------
2hqeB           ----------------------------------------------------------------------
2diqA           ----------------------------------------------------------------------
3fdrA           ----------------------------------------------------------------------
3bdlA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           ADKTAEKKDTHRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETVLITFLLGGINCP
3bdlA           SKKEVP---IHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECP
2wacA           ----------------------------------------------------------------------
2wacB           ----------------------------------------------------------------------
2o4xA           ----------------------------------------------------------------------
2hqeA           ----------------------------------------------------------------------
2e6nA           ----------------------------------------------------------------------
2hqxA           ----------------------------------------------------------------------
2o4xB           ----------------------------------------------------------------------
2hqeB           ----------------------------------------------------------------------
2diqA           ----------------------------------------------------------------------
3fdrA           ----------------------------------------------------------------------
3bdlA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           KGARVGPGGVSTGXXXXXXXXXXXXTRKLVLQHEVQLEVESTDKNGNFVGYLYVSPDGNTSRAINLSEAL
3bdlA           RGARNLPGLVQEG--EPFSEEATLFTKELVLQRXXXXXXXSMDKAGNFIGWLHI--DG-----ANLSVLL
2wacA           ----------------------------------------------------------------------
2wacB           ----------------------------------------------------------------------
2o4xA           ----------------------------------------------------------------------
2hqeA           ----------------------------------------------------------------------
2e6nA           ----------------------------------------------------------------------
2hqxA           ----------------------------------------------------------------------
2o4xB           ----------------------------------------------------------------------
2hqeB           ----------------------------------------------------------------------
2diqA           ----------------------------------------------------------------------
3fdrA           ----------------------------------------------------------------------
3bdlA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           VENGLASLHFTAERSGHYXXXXXXXXXXXXXXXXXXXXFTXXXXXXXXXXXXADTSERKQNFRQVAVTDI
3bdlA           VEHALSKVHFTAERSSYY------------KSLLSXXXXXXXXXXXVWAMPVLEEKERSASYKPVFVTEI
2wacA           ------------------------------------------------------------NYENVIVTEI
2wacB           ------------------------------------------------------------NYENVIVTEI
2o4xA           ------------------------------------------------------------SYKPVFVTEI
2hqeA           ------------------------------------------------------------SYKPVFVTEI
2e6nA           ----------------------------------------------------------------------
2hqxA           ----------------------------------------------------------------------
2o4xB           ----------------------------------------------------------------------
2hqeB           ----------------------------------------------------------------------
2diqA           ----------------------------------------------------------------------
3fdrA           ----------------------------------------------------------------------
3bdlA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           APGALRFSAQNIEDGPKIEKMTTEMRQALAEHPPLAGSYTTKRGDLCVAKFSQDGQWYRCKVESVRAGQA
3bdlA           TDD-LHFYVQDVETGTQLEKLMENMRNDIASHPPVEGSYAPRRGEFCIAKF-VDGEWYRARVEKVESAKI
2wacA           TE-TLTFFAQSVESGSKLESLMSKLHADFQSNPPIAGSYTPKRGDLVAAQFTLDNQWYRAKVERVQGSNA
2wacB           TE-TLTFFAQSVESGSKLESLMSKLHADFQSNPPIAGSYTPKRGDLVAAQFTLDNQWYRAKVERVQGSNA
2o4xA           TDD-LHFYVQDVETGTQFEKLMENMRNDIASHPPVEGSYAPRRGEFCIAKF-VDGEWYRARVEKVESAKI
2hqeA           TDD-LHFYVQDVETGTQFQKLMENMRNDIASHPPVEGSYAPRRGEFCIAKF-VDGEWYRARVEKVESAKI
2e6nA           --------------GTQLEKLMENMRNDIASHPPVEGSYAPRRGEFCIAKF-VDGEWYRARVEKVESAKI
2hqxA           ----------------QFQKLMENMRNDIASHPPVEGSYAPRRGEFCIAKF-VDGEWYRARVEKVESAKI
2o4xB           ----------------QFEKLMENMRNDIASHPP----YAPRRGEFCIAKFV-DGEWYRARVEKVESAKI
2hqeB           ----------------QFQKLMENMRNDIASHPP----YAPRRGEFCIAKFV-DGEWYRARVEKVESAKI
2diqA           ----------------QLDKLVNEMTQHYENSVP--EDLTVHVGDIVAAPLPTNGSWYRARVGTLENGNL
3fdrA           ----------------QLDKLVNEMTQHYENSVP--EDLTVHVGDIVAAPLPTNGSWYRARVGTLENGNL
3bdlA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           EIVYIDYGNRETIEAVKLAQIPAGFANFPAGVREYNLALAKLPNEDYVQLTSDAFAQYLFGHSSVFINSE
3bdlA           HVFYIDYGNREVLPSTRLGTLSPAFSTLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVE
2wacA           TVLYIDYGNKETLPTNRLAALPPAFSSEKPYATEYALALVALPNEDKEEALR-AFSEDVLNH-KVQLNVE
2wacB           TVLYIDYGNKETLPTNRLAALPPAFSSEKPYATEYALALVALPNEDKEEALR-AFSEDVLNH-KVQLNVE
2o4xA           HVFYIDYGNREVLPSTRLGTLSPAFSTLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVE
2hqeA           HVFYIDYGNREVLPSTRLGTLSPAFSTLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVE
2e6nA           HVFYIDYGNREVLPSTRLGTLSPAFSTLPAQATEYAFA--------------------------------
2hqxA           HVFYIDYGNREVLPSTRLGTLSPAFS--------------------------------------------
2o4xB           HVFYIDYGNREVLPSTRLGTLSPAFS--------------------------------------------
2hqeB           HVFYIDYGNREVLPSTRLGTLSPAFS--------------------------------------------
2diqA           DLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECSLA--------------------------------
3fdrA           DLYFVDFGDNGDCPLKDLRALRSDFLSLP-----------------------------------------
3bdlA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           YKVGTSEYVTVYYDSGNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSRKNIWEYGxxx
3bdlA           HLSAGCPHVTLQF--ADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESA--------------
2wacA           LKVTGSPNLATLRDP-TTKVDFGKQLVAEGLVLAEQRGERKLKELVDQYKAAQEAARVAHLAIWKYG---
2wacB           LKVTGSPNLATLRDP-TTKVDFGKQLVAEGLVLAEQRGERKLKELVDQYKAAQEAARVAHLAIWK-----
2o4xA           HLSAGCPHVTLQF--ADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRY----
2hqeA           HLSAGCPHVTLQF--ADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRY----
2e6nA           ----------------------------------------------------------------------
2hqxA           ----------------------------------------------------------------------
2o4xB           ----------------------------------------------------------------------
2hqeB           ----------------------------------------------------------------------
2diqA           ----------------------------------------------------------------------
3fdrA           ----------------------------------------------------------------------
3bdlA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxx
3bdlA           ----
2wacA           ----
2wacB           ----
2o4xA           ----
2hqeA           ----
2e6nA           ----
2hqxA           ----
2o4xB           ----
2hqeB           ----
2diqA           ----
3fdrA           ----
3bdlA           ----