[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cele0:F09E5.2

[Show Plain Result]

#ERROR : Can't open dsspfile "2f9fA.bssp"
#ERROR : Can't open dsspfile "2jjmA.bssp"
#ERROR : Can't open dsspfile "2r60A.bssp"
#ERROR : Can't open dsspfile "3c48B.bssp"
#ERROR : Can't open dsspfile "3c48A.bssp"
#ERROR : Can't open dsspfile "3c4qB.bssp"
#ERROR : Can't open dsspfile "3c4qA.bssp"
#ERROR : Can't open dsspfile "2gejA.bssp"
#ERROR : Can't open dsspfile "2bisA.bssp"
#ERROR : Can't open dsspfile "2bfwA.bssp"
#ERROR : Can't open dsspfile "3b9tD.bssp"
#ERROR : Can't open dsspfile "3b9tB.bssp"
#ERROR : Can't open dsspfile "3b9tA.bssp"

## Summary of PDB Search
:400
    3e-14  39%  2f9fA  [x.x.x] FIRST MANNOSYL TRANSFERASE (WBAZ-1)
    9e-11  27%  2jjmA  [x.x.x] GLYCOSYL TRANSFERASE, GROUP 1 FAMILY PROTEIN
    1e-10  28%  2r60A  [x.x.x] GLYCOSYL TRANSFERASE, GROUP 1
    3e-07  29%  3c48B  [x.x.x] PREDICTED GLYCOSYLTRANSFERASES
    6e-07  27%  3c48A  [x.x.x] PREDICTED GLYCOSYLTRANSFERASES
    8e-07  40%  3c4qB  [x.x.x] PREDICTED GLYCOSYLTRANSFERASES
    8e-07  40%  3c4qA  [x.x.x] PREDICTED GLYCOSYLTRANSFERASES
    1e-04  35%  2gejA  [x.x.x] PHOSPHATIDYLINOSITOL MANNOSYLTRANSFERASE (PIMA)
    2e-04  34%  2bisA  [x.x.x] GLGA GLYCOGEN SYNTHASE
    2e-04  34%  2bfwA  [x.x.x] GLGA GLYCOGEN SYNTHASE
    6e-04  36%  3b9tD  [x.x.x] TWIN-ARGININE TRANSLOCATION PATHWAY SIGNAL
    6e-04  36%  3b9tB  [x.x.x] TWIN-ARGININE TRANSLOCATION PATHWAY SIGNAL
    6e-04  36%  3b9tA  [x.x.x] TWIN-ARGININE TRANSLOCATION PATHWAY SIGNAL
:400

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2f9fA           ----------------------------------------------------------------------
2jjmA           ----------------------------------------------------------------------
2r60A           ----------------------------------------------------------------------
3c48B           ----------------------------------------------------------------------
3c48A           ----------------------------------------------------------------------
3c4qB           ----------------------------------------------------------------------
3c4qA           ----------------------------------------------------------------------
2gejA           ----------------------------------------------------------------------
2bisA           ----------------------------------------------------------------------
2bfwA           ----------------------------------------------------------------------
3b9tD           ----------------------------------------------------------------------
3b9tB           ----------------------------------------------------------------------
3b9tA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFYRN
2f9fA           ----------------------------------------------------------------------
2jjmA           ----------------------------------------------------------------------
2r60A           ------------------------------------------------------------------FHRR
3c48B           ----------------------------------------------------------------------
3c48A           ----------------------------------------------------------------------
3c4qB           ----------------------------------------------------------------------
3c4qA           ----------------------------------------------------------------------
2gejA           ----------------------------------------------------------------------
2bisA           ----------------------------------------------------------------------
2bfwA           ----------------------------------------------------------------------
3b9tD           ----------------------------------------------------------------------
3b9tB           ----------------------------------------------------------------------
3b9tA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IIDWIEEYTTGLADVICVNSNFTKNVVRETFKSLASQELTVLYPSLNTEFFDSIEASDDFGEEIPRGTKY
2f9fA           ----------------------------------------------------------------------
2jjmA           ------------------------------------------------------------------GISK
2r60A           II--AERLTMSYADKIIVSTSYSHDLYRGAVNVEDDDKFSVIPPGVNTRVFDG-----EYGDKIKKITKY
3c48B           -----EQQLVDNADVLAVNTQEEMQDLMHHYDA-DPDRISVVSPGADVELYSNDRATERSRREIPLHTKV
3c48A           -----EQQLVDNADVLAVNTQEEMQDLMHHYDA-DPDRISVVSPGADVELYSPGTERSRRELGIPLHTKV
3c4qB           ----------------------------------------------------------------------
3c4qA           ----------------------------------------------------------------------
2gejA           ----------------------------------------------------------------------
2bisA           ----------------------------------------------------------------------
2bfwA           ----------------------------------------------------------------------
3b9tD           ----------------------------------------------------------------------
3b9tB           ----------------------------------------------------------------------
3b9tA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VFTSLNRFERKKNIVLALDAFEKLKSNLPADEFSQCHLVIAGGYDLKNPENIEHYDELVEHMKKLELPAD
2f9fA           ---SVNRIYPEKRIELQLEVFKKLQDE---------KLYIVGWFSKG--------DHAERYARKIKIAPD
2jjmA           ILIHISNFRKVKRVQDVVQAFAKIVTEVDAK------LLLVGD----GPE----FCTILQLVKNLHIE-D
2r60A           LERDLSRLDQKKNHYGLVEAYVQ---NKELQDKANLVLTLRG---IENP--FEDYSRAGQXXXXXXXXXX
3c48B           V-AFVGRLQPFKGPQVLIKAVAAL---FDRDPDRNLRVIICGG-----PSTYRHMAEELGVEKRIR----
3c48A           V-AFVGRLQPFKGPQVLIKAVAAL---FDRDPDRNLRVIICGGPS-----------DTYRHMAE-ELGVE
3c4qB           ----------------------------------------------------------------------
3c4qA           ----------------------------------------------------------------------
2gejA           -------------------------------------------------------DELREQAGDL---AG
2bisA           -FMFIGRFDRQKGVDVLLKAIEILSSK---KEFQEMRFIIIGKGD----------PELEGWARSLEEKHG
2bfwA           -FMFIGRFDRQKGVDVLLKAIEILSSK---KEFQEMRFIIIGKGD----------PELEGWARSLEEKHG
3b9tD           -----------------------------------------------------HYNELIEEPKKRE----
3b9tB           -----------------------------------------------------HYNELIEEPKKRE----
3b9tA           -----------------------------------------------------HYNELIEEPKKRE----


                         .         *         .         .         .         .         +:350
query           QIVFLHSPSDTQKVNLIRRSRAVLYTPDREHFGIVPVEAMYLGTPVIAVNTGGPCESVRNNETGFLVDQT
2f9fA           NVKFLGSVSEEELIDLYSRCKGLLCTAKDEDFGLTPIEAA-SGKPVIAVNEGGFKETVINEKTGYLVN--
2jjmA           RVLFLGKQDNVXXXXXXXXXXXXXXX--KESFGLVLLEAMACGVPCIGTRVGGIPEVIQHGDTGYLCEGD
2r60A           XXXDNNDPLNSQQAYLASKGSVFALTSFYEPFGLAPVEAMASGLPAVVTRNGGPAEILDGGKYGVLVDED
3c48B           ---FLDPRPPSELVAVYRAADIVAVPSFNESFGLVAMEAQASGTPVIAARVGGLPIAVAEGETGLLVD--
3c48A           KRIRFLDPRPPSELVAVYRAADIVAVPSNESFGLVAMEAQASGTPVIAARVGGLPIAVAEGETGLLVD--
3c4qB           RIRFLDPRPPSELVAVYRAADIVAVPSFNESFGLVAMEAQASGTPVIAARVGGLPIAVAEGETGLLVD--
3c4qA           RIRFLDPRPPSELVAVYRAADIVAVPSFNESFGLVAMEAQASGTPVIAARVGGLPIAVAEGETGLLVD--
2gejA           HLRFLGQVDDATKASAMR-SADVYCAPHLESFGIVLVEAMAAGTAVVASDLDAFRRVLADGDAGRLVPDD
2bisA           NVKVITEMLSREFVRELYGSVDFVIIPSYEPFGLVALEAMCLGAIPIASAVGG-LRDIITNETGILV---
2bfwA           NVKVITEMLSREFVRELYGSVDFVIIPSYEPFGLVALEAMCLGAIPIASAVGG-LRDIITNETGILV---
3b9tD           -VVTIYELDATGERNWARAFYNYRWTPQKDPFGVVHPIVDYPGVPV------------------------
3b9tB           -VVTIYELDATGERNWARAFYNYRWTPQKDPFGVVHPIVDYPGVPV------------------------
3b9tA           -VVTIYELDATGERNWARAFYNYRWTPQKDPFGVVHPIVDYPGVPV------------------------


                         .         .         .         .         *         .         .:420
query           AEAFAEKMIDLMKDEEMYRRMSEEGPKWVQKVFAFEAFARKLDEIIQSTL
2f9fA           --ADVNEIIDAKK-------------------------------------
2jjmA           TTGVADQAIQLLKDEELHRNMGERARESVYEQFRSEKIVSQYETIYYDVL
2r60A           PEDIARGLLKAFESEETWSAYQEKGKQRVEERYTWQETARGYLEVIQ---
3c48B           --------------------------------------------------
3c48A           --------------------------------------------------
3c4qB           --------------------------------------------------
3c4qA           --------------------------------------------------
2gejA           ADGMAAALIGILEDDQL---------------------------------
2bisA           --------------------------------------------------
2bfwA           --------------------------------------------------
3b9tD           --------------------------------------------------
3b9tB           --------------------------------------------------
3b9tA           --------------------------------------------------