[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cele0:C08B11.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2omzA.bssp"
#ERROR : Can't open dsspfile "1o6vA.bssp"
#ERROR : Can't open dsspfile "1o6tA.bssp"
#ERROR : Can't open dsspfile "1o6sA.bssp"
#ERROR : Can't open dsspfile "2omyA.bssp"
#ERROR : Can't open dsspfile "2omwA.bssp"
#ERROR : Can't open dsspfile "2omvA.bssp"
#ERROR : Can't open dsspfile "2omxA.bssp"
#ERROR : Can't open dsspfile "2omuA.bssp"
#ERROR : Can't open dsspfile "2omtA.bssp"
#ERROR : Can't open dsspfile "2z64A.bssp"
#ERROR : Can't open dsspfile "1h6uA.bssp"

## Summary of PDB Search
:799
    6e-06  37%  2omzA  [x.x.x] INTERNALIN-A
    6e-06  37%  1o6vA  [c.10.2 - b.1.18] INTERNALIN A
    6e-06  37%  1o6tA  [c.10.2 - b.1.18] INTERNALIN A
    6e-06  37%  1o6sA  [c.10.2 - b.1.18] INTERNALIN A
    1e-05  37%  2omyA  [x.x.x] INTERNALIN-A
    1e-05  37%  2omwA  [x.x.x] INTERNALIN-A
    1e-05  37%  2omvA  [x.x.x] INTERNALIN-A
    3e-05  36%  2omxA  [x.x.x] INTERNALIN-A
    1e-04  35%  2omuA  [x.x.x] INTERNALIN-A
    1e-04  35%  2omtA  [x.x.x] INTERNALIN-A
    3e-04  36%  2z64A  [x.x.x] TOLL-LIKE RECEPTOR 4
    8e-04  35%  1h6uA  [c.10.2 - b.1.18] INTERNALIN H
:799

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2omzA           ----------------------------------------------------------------------
1o6vA           ----------------------------------------------------------------------
1o6tA           ----------------------------------------------------------------------
1o6sA           ----------------------------------------------------------------------
2omyA           ----------------------------------------------------------------------
2omwA           ----------------------------------------------------------------------
2omvA           ----------------------------------------------------------------------
2omxA           ----------------------------------------------------------------------
2omuA           ----------------------------------------------------------------------
2omtA           ----------------------------------------------------------------------
2z64A           ----------------------------------------------------------------------
1h6uA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTSRQQLRHLDLS
2omzA           ----------------------------------------------------------TDIDPLKNLTNL
1o6vA           ----------------------------------------------------------TDIDPLKNLTNL
1o6tA           ----------------------------------------------------------TDIDPLKNLTNL
1o6sA           ----------------------------------------------------------TDIDPLKNLTNL
2omyA           ----------------------------------------------------------TDIDPLKNLTNL
2omwA           ----------------------------------------------------------TDIDPLKNLTNL
2omvA           ----------------------------------------------------------TDIDPLKNLTNL
2omxA           ----------------------------------------------------------TDIDPLKNLTNL
2omuA           ----------------------------------------------------------TDIDPLKNLTNL
2omtA           ----------------------------------------------------------TDIDPLKNLTNL
2z64A           ----------------------------------------------------------------------
1h6uA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GRHRITSNWPTYVARKLPRLESLAFANRSTANETLSQIGASLLNLRFLDISSTCVTDISCISSLRNLEVL
2omzA           NRLELSSNTISDISALLTSLQQLSFGNQVTDLKPL----ANLTTLERLDISSNKVSDISVLAKLTNLESL
1o6vA           NRLELSSNTISDISALLTSLQQLSFGNQVTDLKPL----ANLTTLERLDISSNKVSDISVLAKLTNLESL
1o6tA           NRLELSSNTISDISALLTSLQQLSFGNQVTDLKPL----ANLTTLERLDISSNKVSDISVLAKLTNLESL
1o6sA           NRLELSSNTISDISALLTSLQQLSFGNQVTDLKPL----ANLTTLERLDISSNKVSDISVLAKLTNLESL
2omyA           NRLELSSNTISDISALLTSLQQLNFGNQVTDLKPL----ANLTTLERLDISSNKVSDISVLAKLTNLESL
2omwA           NRLELSSNTISDISALLTSLQQLNFGNQVTDLKPL----ANLTTLERLDISSNKVSDISVLAKLTNLESL
2omvA           NRLELSSNTISDISALLTSLQQLNFGNQVTDLKPL----ANLTTLERLDISSNKVSDISVLAKLTNLESL
2omxA           NRLELSSNTISDISA-LSGLTSLQQLNFSSNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESL
2omuA           NRLELSSNTISDISALLTSLQQLSFSSNQVTD--LKPL-ANLTTLERLDISSNKVSDISVLAKLTNLESL
2omtA           NRLELSSNTISDISALLTSLQQLSFSSNQVTD--LKPL-ANLTTLERLDISSNKVSDISVLAKLTNLESL
2z64A           ----------------LTSLNTLKMAGNSFKDNTLSNVFANTTNLTFLDLSKCQLEQISVFDTLHRLQLL
1h6uA           ---------------------------------------AGLQSIKTLDLTSTQITDVTPLAGLSNLQVL


                         .         .         .         +         .         .         .:280
query           IMYNLNILKGDVTETLSNLTKLRVLDISRKVNTDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2omzA           IATNNQISDITPLGILTNLDEL------------------------------------------------
1o6vA           IATNNQISDITPLGILTNLDEL------------------------------------------------
1o6tA           IATNNQISDITPLGILTNLDEL------------------------------------------------
1o6sA           IATNNQISDITPLGILTNLDEL------------------------------------------------
2omyA           IATNNQISDITPLGILTNLDEL------------------------------------------------
2omwA           IATNNQISDITPLGILTNLDEL------------------------------------------------
2omvA           IATNNQISDITPLGILTNLDEL------------------------------------------------
2omxA           IATNNQISDITPLGILTNLDEL------------------------------------------------
2omuA           IATNNQISDITPLGILTNLDEL------------------------------------------------
2omtA           IATNNQISDITPLGILTNLDEL------------------------------------------------
2z64A           NMSHNNLLFLD-SSHYNQLYSLSTLDCS------------------------------------------
1h6uA           YL-DLNQITN--ISPLAGLTNLQYLSIGNAQVSD------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2omzA           ----------------------------------------------------------------------
1o6vA           ----------------------------------------------------------------------
1o6tA           ----------------------------------------------------------------------
1o6sA           ----------------------------------------------------------------------
2omyA           ----------------------------------------------------------------------
2omwA           ----------------------------------------------------------------------
2omvA           ----------------------------------------------------------------------
2omxA           ----------------------------------------------------------------------
2omuA           ----------------------------------------------------------------------
2omtA           ----------------------------------------------------------------------
2z64A           ----------------------------------------------------------------------
1h6uA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2omzA           ----------------------------------------------------------------------
1o6vA           ----------------------------------------------------------------------
1o6tA           ----------------------------------------------------------------------
1o6sA           ----------------------------------------------------------------------
2omyA           ----------------------------------------------------------------------
2omwA           ----------------------------------------------------------------------
2omvA           ----------------------------------------------------------------------
2omxA           ----------------------------------------------------------------------
2omuA           ----------------------------------------------------------------------
2omtA           ----------------------------------------------------------------------
2z64A           ----------------------------------------------------------------------
1h6uA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2omzA           ----------------------------------------------------------------------
1o6vA           ----------------------------------------------------------------------
1o6tA           ----------------------------------------------------------------------
1o6sA           ----------------------------------------------------------------------
2omyA           ----------------------------------------------------------------------
2omwA           ----------------------------------------------------------------------
2omvA           ----------------------------------------------------------------------
2omxA           ----------------------------------------------------------------------
2omuA           ----------------------------------------------------------------------
2omtA           ----------------------------------------------------------------------
2z64A           ----------------------------------------------------------------------
1h6uA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2omzA           ----------------------------------------------------------------------
1o6vA           ----------------------------------------------------------------------
1o6tA           ----------------------------------------------------------------------
1o6sA           ----------------------------------------------------------------------
2omyA           ----------------------------------------------------------------------
2omwA           ----------------------------------------------------------------------
2omvA           ----------------------------------------------------------------------
2omxA           ----------------------------------------------------------------------
2omuA           ----------------------------------------------------------------------
2omtA           ----------------------------------------------------------------------
2z64A           ----------------------------------------------------------------------
1h6uA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2omzA           ----------------------------------------------------------------------
1o6vA           ----------------------------------------------------------------------
1o6tA           ----------------------------------------------------------------------
1o6sA           ----------------------------------------------------------------------
2omyA           ----------------------------------------------------------------------
2omwA           ----------------------------------------------------------------------
2omvA           ----------------------------------------------------------------------
2omxA           ----------------------------------------------------------------------
2omuA           ----------------------------------------------------------------------
2omtA           ----------------------------------------------------------------------
2z64A           ----------------------------------------------------------------------
1h6uA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2omzA           ----------------------------------------------------------------------
1o6vA           ----------------------------------------------------------------------
1o6tA           ----------------------------------------------------------------------
1o6sA           ----------------------------------------------------------------------
2omyA           ----------------------------------------------------------------------
2omwA           ----------------------------------------------------------------------
2omvA           ----------------------------------------------------------------------
2omxA           ----------------------------------------------------------------------
2omuA           ----------------------------------------------------------------------
2omtA           ----------------------------------------------------------------------
2z64A           ----------------------------------------------------------------------
1h6uA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2omzA           ----------------------------------------------------------------------
1o6vA           ----------------------------------------------------------------------
1o6tA           ----------------------------------------------------------------------
1o6sA           ----------------------------------------------------------------------
2omyA           ----------------------------------------------------------------------
2omwA           ----------------------------------------------------------------------
2omvA           ----------------------------------------------------------------------
2omxA           ----------------------------------------------------------------------
2omuA           ----------------------------------------------------------------------
2omtA           ----------------------------------------------------------------------
2z64A           ----------------------------------------------------------------------
1h6uA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2omzA           -----------------------------
1o6vA           -----------------------------
1o6tA           -----------------------------
1o6sA           -----------------------------
2omyA           -----------------------------
2omwA           -----------------------------
2omvA           -----------------------------
2omxA           -----------------------------
2omuA           -----------------------------
2omtA           -----------------------------
2z64A           -----------------------------
1h6uA           -----------------------------