[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cele0:D2013.7

[Show Plain Result]

#ERROR : Can't open dsspfile "2o96A.bssp"
#ERROR : Can't open dsspfile "2o96B.bssp"
#ERROR : Can't open dsspfile "2o95B.bssp"
#ERROR : Can't open dsspfile "2o95A.bssp"

## Summary of PDB Search
:294
    1e-08  30%  2o96A  [x.x.x] 26S PROTEASOME NON-ATPASE REGULATORY SUBUNIT 7
    3e-08  35%  2o96B  [x.x.x] 26S PROTEASOME NON-ATPASE REGULATORY SUBUNIT 7
    3e-08  35%  2o95B  [x.x.x] 26S PROTEASOME NON-ATPASE REGULATORY SUBUNIT 7
    3e-08  35%  2o95A  [x.x.x] 26S PROTEASOME NON-ATPASE REGULATORY SUBUNIT 7
:294

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQEKCMGTLMGYYEKGSIQVTNCFAIPFNESNDDLEID
2o96A           ---------------------------------QKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVD
2o96B           ---------------------------------QKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVD
2o95B           ---------------------------------QKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVD
2o95A           ---------------------------------QKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVD


                         .         .         *         .         .         .         .:140
query           DQFNQQMISALKKTSPNEQPVGWFLTTSDITSSCLIYHDYYVRVITEASARRESPPIVVLTIDTTFSGDM
2o96A           HDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINEL---------MKRYCPNSVLVIIDV-----K
2o96B           HDYLENMYGMFKKVNARERIVGWYHT--------------------------------------------
2o95B           HDYLENMYGMFKKVNARERIVGWYHT--------------------------------------------
2o95A           HDYLENMYGMFKKVNARERIVGWYHT--------------------------------------------


                         +         .         .         .         .         *         .:210
query           SKRMPVRAYLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2o96A           PKDLPTEAYI------------------------------------------------------------
2o96B           ----------------------------------------------------------------------
2o95B           ----------------------------------------------------------------------
2o95A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2o96A           ----------------------------------------------------------------------
2o96B           ----------------------------------------------------------------------
2o95B           ----------------------------------------------------------------------
2o95A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxx
2o96A           --------------
2o96B           --------------
2o95B           --------------
2o95A           --------------