[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cele0:ZK596.2

[Show Plain Result]

#ERROR : Can't open dsspfile "1ckjB.bssp"
#ERROR : Can't open dsspfile "1ckjA.bssp"
#ERROR : Can't open dsspfile "1ckiB.bssp"
#ERROR : Can't open dsspfile "1ckiA.bssp"
#ERROR : Can't open dsspfile "2cmwA.bssp"
#ERROR : Can't open dsspfile "1csnA.bssp"
#ERROR : Can't open dsspfile "2c47B.bssp"
#ERROR : Can't open dsspfile "2c47A.bssp"
#ERROR : Can't open dsspfile "2c47C.bssp"
#ERROR : Can't open dsspfile "2c47D.bssp"
#ERROR : Can't open dsspfile "2chlA.bssp"
#ERROR : Can't open dsspfile "2izuA.bssp"
#ERROR : Can't open dsspfile "2iztA.bssp"
#ERROR : Can't open dsspfile "2izrA.bssp"
#ERROR : Can't open dsspfile "2v62B.bssp"
#ERROR : Can't open dsspfile "2v62A.bssp"
#ERROR : Can't open dsspfile "2jamB.bssp"
#ERROR : Can't open dsspfile "2jamA.bssp"
#ERROR : Can't open dsspfile "3hrfA.bssp"
#ERROR : Can't open dsspfile "3dbqA.bssp"
#ERROR : Can't open dsspfile "2zmcA.bssp"
#ERROR : Can't open dsspfile "2vd5B.bssp"
#ERROR : Can't open dsspfile "2vd5A.bssp"
#ERROR : Can't open dsspfile "1qcfA.bssp"
#ERROR : Can't open dsspfile "3h9fA.bssp"
#ERROR : Can't open dsspfile "3gfwA.bssp"
#ERROR : Can't open dsspfile "1kobA.bssp"
#ERROR : Can't open dsspfile "3cekA.bssp"
#ERROR : Can't open dsspfile "3blhA.bssp"
#ERROR : Can't open dsspfile "3hztA.bssp"
#ERROR : Can't open dsspfile "2zmdA.bssp"
#ERROR : Can't open dsspfile "1qpjA.bssp"
#ERROR : Can't open dsspfile "1qpcA.bssp"
#ERROR : Can't open dsspfile "2ofuA.bssp"
#ERROR : Can't open dsspfile "3hrcA.bssp"
#ERROR : Can't open dsspfile "1h1wA.bssp"
#ERROR : Can't open dsspfile "3bymA.bssp"
#ERROR : Can't open dsspfile "2biyA.bssp"
#ERROR : Can't open dsspfile "1zydA.bssp"
#ERROR : Can't open dsspfile "1zycC.bssp"
#ERROR : Can't open dsspfile "1zycB.bssp"
#ERROR : Can't open dsspfile "1u7eA.bssp"
#ERROR : Can't open dsspfile "3fhiA.bssp"
#ERROR : Can't open dsspfile "1zydB.bssp"
#ERROR : Can't open dsspfile "1zycA.bssp"
#ERROR : Can't open dsspfile "1yhwA.bssp"
#ERROR : Can't open dsspfile "1yhvA.bssp"
#ERROR : Can't open dsspfile "2pl0A.bssp"
#ERROR : Can't open dsspfile "2of2A.bssp"
#ERROR : Can't open dsspfile "1zy4A.bssp"
#ERROR : Can't open dsspfile "1rejA.bssp"
#ERROR : Can't open dsspfile "1rdqE.bssp"
#ERROR : Can't open dsspfile "2qvsE.bssp"
#ERROR : Can't open dsspfile "2qurA.bssp"
#ERROR : Can't open dsspfile "1jbpE.bssp"
#ERROR : Can't open dsspfile "3idbA.bssp"
#ERROR : Can't open dsspfile "2hk5A.bssp"
#ERROR : Can't open dsspfile "2gu8A.bssp"
#ERROR : Can't open dsspfile "3fxzA.bssp"
#ERROR : Can't open dsspfile "1fmoE.bssp"
#ERROR : Can't open dsspfile "3fjqE.bssp"
#ERROR : Can't open dsspfile "3e7eA.bssp"
#ERROR : Can't open dsspfile "1bkxA.bssp"
#ERROR : Can't open dsspfile "1uu7A.bssp"
#ERROR : Can't open dsspfile "2jiiB.bssp"
#ERROR : Can't open dsspfile "2jiiA.bssp"
#ERROR : Can't open dsspfile "3idpA.bssp"
#ERROR : Can't open dsspfile "2dq7X.bssp"
#ERROR : Can't open dsspfile "1zycD.bssp"
#ERROR : Can't open dsspfile "2z7qA.bssp"
#ERROR : Can't open dsspfile "1unlA.bssp"
#ERROR : Can't open dsspfile "1sykB.bssp"
#ERROR : Can't open dsspfile "1sykA.bssp"
#ERROR : Can't open dsspfile "1j3hB.bssp"
#ERROR : Can't open dsspfile "1j3hA.bssp"
#ERROR : Can't open dsspfile "2wmqA.bssp"
#ERROR : Can't open dsspfile "1wccA.bssp"
#ERROR : Can't open dsspfile "1hckA.bssp"
#ERROR : Can't open dsspfile "1apmE.bssp"
#ERROR : Can't open dsspfile "2jc6C.bssp"
#ERROR : Can't open dsspfile "2jc6A.bssp"
#ERROR : Can't open dsspfile "2iw9A.bssp"
#ERROR : Can't open dsspfile "3fz1A.bssp"
#ERROR : Can't open dsspfile "3eidC.bssp"
#ERROR : Can't open dsspfile "1ctpE.bssp"
#ERROR : Can't open dsspfile "1cmkE.bssp"
#ERROR : Can't open dsspfile "1cdkA.bssp"
#ERROR : Can't open dsspfile "3b2wA.bssp"
#ERROR : Can't open dsspfile "2qcsA.bssp"
#ERROR : Can't open dsspfile "1l3rE.bssp"
#ERROR : Can't open dsspfile "2cpkE.bssp"
#ERROR : Can't open dsspfile "2z7rA.bssp"
#ERROR : Can't open dsspfile "1ydrE.bssp"
#ERROR : Can't open dsspfile "1xh8A.bssp"
#ERROR : Can't open dsspfile "1xh6A.bssp"
#ERROR : Can't open dsspfile "2uztA.bssp"
#ERROR : Can't open dsspfile "1stcE.bssp"
#ERROR : Can't open dsspfile "1q8uA.bssp"
#ERROR : Can't open dsspfile "1q8tA.bssp"
#ERROR : Can't open dsspfile "1ia8A.bssp"
#ERROR : Can't open dsspfile "3hkoA.bssp"
#ERROR : Can't open dsspfile "3gc9B.bssp"
#ERROR : Can't open dsspfile "2f7xE.bssp"
#ERROR : Can't open dsspfile "1f3mC.bssp"
#ERROR : Can't open dsspfile "3e8eI.bssp"
#ERROR : Can't open dsspfile "3e8cE.bssp"
#ERROR : Can't open dsspfile "3e8cB.bssp"
#ERROR : Can't open dsspfile "3dneA.bssp"
#ERROR : Can't open dsspfile "3dndA.bssp"
#ERROR : Can't open dsspfile "2cgxA.bssp"
#ERROR : Can't open dsspfile "2cgvA.bssp"
#ERROR : Can't open dsspfile "2cguA.bssp"
#ERROR : Can't open dsspfile "2c3kA.bssp"
#ERROR : Can't open dsspfile "2c1aA.bssp"
#ERROR : Can't open dsspfile "2brnA.bssp"
#ERROR : Can't open dsspfile "2b9fA.bssp"
#ERROR : Can't open dsspfile "1zy5B.bssp"
#ERROR : Can't open dsspfile "1zy4B.bssp"
#ERROR : Can't open dsspfile "1uwjB.bssp"
#ERROR : Can't open dsspfile "1okyA.bssp"
#ERROR : Can't open dsspfile "3gc8B.bssp"
#ERROR : Can't open dsspfile "3gc8A.bssp"
#ERROR : Can't open dsspfile "2cgwA.bssp"
#ERROR : Can't open dsspfile "2z7sA.bssp"
#ERROR : Can't open dsspfile "1smhA.bssp"
#ERROR : Can't open dsspfile "2iw8C.bssp"
#ERROR : Can't open dsspfile "2iw8A.bssp"
#ERROR : Can't open dsspfile "2gdoA.bssp"
#ERROR : Can't open dsspfile "2fa2B.bssp"
#ERROR : Can't open dsspfile "2fa2A.bssp"
#ERROR : Can't open dsspfile "2f49A.bssp"
#ERROR : Can't open dsspfile "3blrA.bssp"
#ERROR : Can't open dsspfile "3blqA.bssp"
#ERROR : Can't open dsspfile "2b9hA.bssp"
#ERROR : Can't open dsspfile "1zysA.bssp"
#ERROR : Can't open dsspfile "1ykrA.bssp"
#ERROR : Can't open dsspfile "1xh9A.bssp"
#ERROR : Can't open dsspfile "1w98A.bssp"
#ERROR : Can't open dsspfile "2vz6B.bssp"
#ERROR : Can't open dsspfile "1vywC.bssp"
#ERROR : Can't open dsspfile "1vywA.bssp"
#ERROR : Can't open dsspfile "1v0bA.bssp"
#ERROR : Can't open dsspfile "1uwjA.bssp"
#ERROR : Can't open dsspfile "1okvC.bssp"
#ERROR : Can't open dsspfile "1okvA.bssp"
#ERROR : Can't open dsspfile "1oiuC.bssp"
#ERROR : Can't open dsspfile "1oguC.bssp"
#ERROR : Can't open dsspfile "1ob3A.bssp"
#ERROR : Can't open dsspfile "1nvrA.bssp"
#ERROR : Can't open dsspfile "1jstA.bssp"
#ERROR : Can't open dsspfile "2jgzA.bssp"
#ERROR : Can't open dsspfile "2iw9C.bssp"
#ERROR : Can't open dsspfile "2iw6C.bssp"
#ERROR : Can't open dsspfile "2hogA.bssp"
#ERROR : Can't open dsspfile "1h27C.bssp"
#ERROR : Can't open dsspfile "1h26C.bssp"
#ERROR : Can't open dsspfile "1h25C.bssp"
#ERROR : Can't open dsspfile "1h24A.bssp"
#ERROR : Can't open dsspfile "1h08A.bssp"
#ERROR : Can't open dsspfile "2gnlA.bssp"
#ERROR : Can't open dsspfile "2gnjA.bssp"
#ERROR : Can't open dsspfile "2g9xC.bssp"
#ERROR : Can't open dsspfile "2g9xA.bssp"
#ERROR : Can't open dsspfile "2f9gA.bssp"
#ERROR : Can't open dsspfile "3f5xA.bssp"
#ERROR : Can't open dsspfile "1e9hA.bssp"
#ERROR : Can't open dsspfile "3dqwD.bssp"
#ERROR : Can't open dsspfile "3dqwC.bssp"
#ERROR : Can't open dsspfile "3dqwA.bssp"
#ERROR : Can't open dsspfile "3dogC.bssp"
#ERROR : Can't open dsspfile "3ddqC.bssp"
#ERROR : Can't open dsspfile "2cchA.bssp"
#ERROR : Can't open dsspfile "2c4gC.bssp"
#ERROR : Can't open dsspfile "2c4gA.bssp"
#ERROR : Can't open dsspfile "2brmA.bssp"
#ERROR : Can't open dsspfile "2brhA.bssp"
#ERROR : Can't open dsspfile "2bkzC.bssp"
#ERROR : Can't open dsspfile "3bhuC.bssp"
#ERROR : Can't open dsspfile "3bhtC.bssp"
#ERROR : Can't open dsspfile "2b9iA.bssp"
#ERROR : Can't open dsspfile "2zvaA.bssp"
#ERROR : Can't open dsspfile "1uwhA.bssp"
#ERROR : Can't open dsspfile "1qpdA.bssp"
#ERROR : Can't open dsspfile "1q62A.bssp"
#ERROR : Can't open dsspfile "1q24A.bssp"
#ERROR : Can't open dsspfile "2e9nA.bssp"
#ERROR : Can't open dsspfile "3d4qA.bssp"
#ERROR : Can't open dsspfile "2c3lA.bssp"
#ERROR : Can't open dsspfile "2aypA.bssp"
#ERROR : Can't open dsspfile "1ad5A.bssp"
#ERROR : Can't open dsspfile "2w06A.bssp"
#ERROR : Can't open dsspfile "2vtoA.bssp"
#ERROR : Can't open dsspfile "2vo0A.bssp"
#ERROR : Can't open dsspfile "1v0oA.bssp"
#ERROR : Can't open dsspfile "2uvxA.bssp"
#ERROR : Can't open dsspfile "1uu8A.bssp"
#ERROR : Can't open dsspfile "2r5tA.bssp"
#ERROR : Can't open dsspfile "1q61A.bssp"
#ERROR : Can't open dsspfile "1oi9A.bssp"
#ERROR : Can't open dsspfile "1ke6A.bssp"
#ERROR : Can't open dsspfile "1jvpP.bssp"
#ERROR : Can't open dsspfile "2jdtA.bssp"
#ERROR : Can't open dsspfile "3hdnA.bssp"
#ERROR : Can't open dsspfile "3hdmA.bssp"
#ERROR : Can't open dsspfile "1h0wA.bssp"
#ERROR : Can't open dsspfile "1h0vA.bssp"
#ERROR : Can't open dsspfile "1h0uA.bssp"
#ERROR : Can't open dsspfile "1gz8A.bssp"
#ERROR : Can't open dsspfile "1fvtA.bssp"
#ERROR : Can't open dsspfile "3fbvI.bssp"
#ERROR : Can't open dsspfile "3fbvD.bssp"
#ERROR : Can't open dsspfile "3fbvA.bssp"
#ERROR : Can't open dsspfile "3dogA.bssp"
#ERROR : Can't open dsspfile "2b52A.bssp"
#ERROR : Can't open dsspfile "1y91A.bssp"
#ERROR : Can't open dsspfile "1y57A.bssp"
#ERROR : Can't open dsspfile "1xh7A.bssp"
#ERROR : Can't open dsspfile "2welA.bssp"
#ERROR : Can't open dsspfile "2vn9A.bssp"
#ERROR : Can't open dsspfile "2srcA.bssp"
#ERROR : Can't open dsspfile "1q8wA.bssp"
#ERROR : Can't open dsspfile "1oiyA.bssp"
#ERROR : Can't open dsspfile "1oguA.bssp"
#ERROR : Can't open dsspfile "2iw6A.bssp"
#ERROR : Can't open dsspfile "2i40A.bssp"
#ERROR : Can't open dsspfile "3h9oA.bssp"
#ERROR : Can't open dsspfile "2h8hA.bssp"
#ERROR : Can't open dsspfile "3gc9A.bssp"
#ERROR : Can't open dsspfile "2fb8A.bssp"
#ERROR : Can't open dsspfile "1f3mD.bssp"
#ERROR : Can't open dsspfile "3eocC.bssp"
#ERROR : Can't open dsspfile "3ej1C.bssp"
#ERROR : Can't open dsspfile "3ej1A.bssp"
#ERROR : Can't open dsspfile "3eidA.bssp"
#ERROR : Can't open dsspfile "3dxnA.bssp"
#ERROR : Can't open dsspfile "3ddqA.bssp"
#ERROR : Can't open dsspfile "3bwjA.bssp"
#ERROR : Can't open dsspfile "1buhA.bssp"
#ERROR : Can't open dsspfile "3bhtA.bssp"
#ERROR : Can't open dsspfile "1zxeC.bssp"
#ERROR : Can't open dsspfile "1uu9A.bssp"
#ERROR : Can't open dsspfile "1okzA.bssp"
#ERROR : Can't open dsspfile "3e5aA.bssp"
#ERROR : Can't open dsspfile "3dk6A.bssp"
#ERROR : Can't open dsspfile "2c5yA.bssp"
#ERROR : Can't open dsspfile "1z5mA.bssp"
#ERROR : Can't open dsspfile "1v0oB.bssp"
#ERROR : Can't open dsspfile "1v0bB.bssp"
#ERROR : Can't open dsspfile "1uu3A.bssp"
#ERROR : Can't open dsspfile "2r7bA.bssp"
#ERROR : Can't open dsspfile "1kswA.bssp"
#ERROR : Can't open dsspfile "2jfmA.bssp"
#ERROR : Can't open dsspfile "2jflA.bssp"
#ERROR : Can't open dsspfile "2j51A.bssp"
#ERROR : Can't open dsspfile "2gngA.bssp"
#ERROR : Can't open dsspfile "2gnfA.bssp"
#ERROR : Can't open dsspfile "3c4cB.bssp"
#ERROR : Can't open dsspfile "3c4cA.bssp"
#ERROR : Can't open dsspfile "2zv7A.bssp"
#ERROR : Can't open dsspfile "3idpB.bssp"
#ERROR : Can't open dsspfile "2c0tB.bssp"
#ERROR : Can't open dsspfile "2c0tA.bssp"
#ERROR : Can't open dsspfile "2c0iA.bssp"
#ERROR : Can't open dsspfile "1yxsA.bssp"
#ERROR : Can't open dsspfile "2w4oA.bssp"
#ERROR : Can't open dsspfile "1h07A.bssp"
#ERROR : Can't open dsspfile "1h01A.bssp"
#ERROR : Can't open dsspfile "1a06A.bssp"
#ERROR : Can't open dsspfile "2wmrA.bssp"
#ERROR : Can't open dsspfile "2vtpA.bssp"
#ERROR : Can't open dsspfile "2vtiA.bssp"
#ERROR : Can't open dsspfile "2vo6A.bssp"
#ERROR : Can't open dsspfile "2uvzA.bssp"
#ERROR : Can't open dsspfile "2uvyA.bssp"
#ERROR : Can't open dsspfile "1szmB.bssp"
#ERROR : Can't open dsspfile "1szmA.bssp"
#ERROR : Can't open dsspfile "2r3iA.bssp"
#ERROR : Can't open dsspfile "2okrD.bssp"
#ERROR : Can't open dsspfile "3ig7A.bssp"
#ERROR : Can't open dsspfile "1giiA.bssp"
#ERROR : Can't open dsspfile "1e1vA.bssp"
#ERROR : Can't open dsspfile "2ds1A.bssp"
#ERROR : Can't open dsspfile "3dakD.bssp"
#ERROR : Can't open dsspfile "3ctqA.bssp"
#ERROR : Can't open dsspfile "2clxA.bssp"
#ERROR : Can't open dsspfile "1ckpA.bssp"
#ERROR : Can't open dsspfile "1zxeA.bssp"
#ERROR : Can't open dsspfile "1vyzA.bssp"
#ERROR : Can't open dsspfile "2vtsA.bssp"
#ERROR : Can't open dsspfile "2vtrA.bssp"
#ERROR : Can't open dsspfile "2vthA.bssp"
#ERROR : Can't open dsspfile "2rioA.bssp"
#ERROR : Can't open dsspfile "2r3qA.bssp"
#ERROR : Can't open dsspfile "1oirA.bssp"
#ERROR : Can't open dsspfile "1jsvA.bssp"
#ERROR : Can't open dsspfile "2j2iB.bssp"
#ERROR : Can't open dsspfile "3h10B.bssp"
#ERROR : Can't open dsspfile "3h10A.bssp"
#ERROR : Can't open dsspfile "2c3iB.bssp"
#ERROR : Can't open dsspfile "2bzhB.bssp"
#ERROR : Can't open dsspfile "2bilB.bssp"
#ERROR : Can't open dsspfile "1ywvA.bssp"
#ERROR : Can't open dsspfile "1xwsA.bssp"
#ERROR : Can't open dsspfile "1xqzA.bssp"
#ERROR : Can't open dsspfile "2v7oA.bssp"
#ERROR : Can't open dsspfile "2v55C.bssp"
#ERROR : Can't open dsspfile "2v55A.bssp"
#ERROR : Can't open dsspfile "2uznA.bssp"
#ERROR : Can't open dsspfile "2r3hA.bssp"
#ERROR : Can't open dsspfile "1lezA.bssp"
#ERROR : Can't open dsspfile "2etkB.bssp"
#ERROR : Can't open dsspfile "2etkA.bssp"
#ERROR : Can't open dsspfile "1di8A.bssp"
#ERROR : Can't open dsspfile "3d83A.bssp"
#ERROR : Can't open dsspfile "1cm8A.bssp"
#ERROR : Can't open dsspfile "3c4eC.bssp"
#ERROR : Can't open dsspfile "3bhhD.bssp"
#ERROR : Can't open dsspfile "3bhhC.bssp"
#ERROR : Can't open dsspfile "3bhhB.bssp"
#ERROR : Can't open dsspfile "3bhhA.bssp"
#ERROR : Can't open dsspfile "2bfyB.bssp"
#ERROR : Can't open dsspfile "2bfyA.bssp"
#ERROR : Can't open dsspfile "1yi6A.bssp"
#ERROR : Can't open dsspfile "2rioB.bssp"
#ERROR : Can't open dsspfile "2r3lA.bssp"
#ERROR : Can't open dsspfile "1lewA.bssp"
#ERROR : Can't open dsspfile "2ivsA.bssp"
#ERROR : Can't open dsspfile "2c6iA.bssp"
#ERROR : Can't open dsspfile "2c68A.bssp"
#ERROR : Can't open dsspfile "2a4lA.bssp"
#ERROR : Can't open dsspfile "2zv9A.bssp"
#ERROR : Can't open dsspfile "2r3jA.bssp"
#ERROR : Can't open dsspfile "2objA.bssp"
#ERROR : Can't open dsspfile "1ob3B.bssp"
#ERROR : Can't open dsspfile "2ghlA.bssp"
#ERROR : Can't open dsspfile "2fh9A.bssp"
#ERROR : Can't open dsspfile "3f2aA.bssp"
#ERROR : Can't open dsspfile "3dcvA.bssp"
#ERROR : Can't open dsspfile "1bmkA.bssp"
#ERROR : Can't open dsspfile "2bikB.bssp"
#ERROR : Can't open dsspfile "2z60A.bssp"
#ERROR : Can't open dsspfile "1ywrA.bssp"
#ERROR : Can't open dsspfile "2weiA.bssp"
#ERROR : Can't open dsspfile "2r3kA.bssp"
#ERROR : Can't open dsspfile "1mq4A.bssp"
#ERROR : Can't open dsspfile "1h4lA.bssp"
#ERROR : Can't open dsspfile "3gc7A.bssp"
#ERROR : Can't open dsspfile "3dk6B.bssp"
#ERROR : Can't open dsspfile "3cy2A.bssp"
#ERROR : Can't open dsspfile "3cxwA.bssp"
#ERROR : Can't open dsspfile "3coiA.bssp"
#ERROR : Can't open dsspfile "2bzkB.bssp"
#ERROR : Can't open dsspfile "3bgzA.bssp"
#ERROR : Can't open dsspfile "2bdwB.bssp"
#ERROR : Can't open dsspfile "2bdwA.bssp"
#ERROR : Can't open dsspfile "2vtjA.bssp"
#ERROR : Can't open dsspfile "2qohB.bssp"
#ERROR : Can't open dsspfile "2puuA.bssp"
#ERROR : Can't open dsspfile "1ol7A.bssp"
#ERROR : Can't open dsspfile "1ol5A.bssp"
#ERROR : Can't open dsspfile "3ha6A.bssp"
#ERROR : Can't open dsspfile "3gcqA.bssp"
#ERROR : Can't open dsspfile "3gcpA.bssp"
#ERROR : Can't open dsspfile "3dk3B.bssp"
#ERROR : Can't open dsspfile "3dk3A.bssp"
#ERROR : Can't open dsspfile "3d5vA.bssp"
#ERROR : Can't open dsspfile "2brgA.bssp"
#ERROR : Can't open dsspfile "1zxeE.bssp"
#ERROR : Can't open dsspfile "1zxeB.bssp"
#ERROR : Can't open dsspfile "2zb0A.bssp"
#ERROR : Can't open dsspfile "1yqjA.bssp"
#ERROR : Can't open dsspfile "1wbsA.bssp"
#ERROR : Can't open dsspfile "2w5bA.bssp"
#ERROR : Can't open dsspfile "2w5aA.bssp"
#ERROR : Can't open dsspfile "2vz6A.bssp"
#ERROR : Can't open dsspfile "2vwiD.bssp"
#ERROR : Can't open dsspfile "2vgpB.bssp"
#ERROR : Can't open dsspfile "2vgoA.bssp"
#ERROR : Can't open dsspfile "1tkiA.bssp"
#ERROR : Can't open dsspfile "1oz1A.bssp"
#ERROR : Can't open dsspfile "1ouyA.bssp"
#ERROR : Can't open dsspfile "2onlA.bssp"
#ERROR : Can't open dsspfile "2okrA.bssp"
#ERROR : Can't open dsspfile "2og8A.bssp"
#ERROR : Can't open dsspfile "1koaA.bssp"
#ERROR : Can't open dsspfile "1k2pA.bssp"
#ERROR : Can't open dsspfile "2j4zB.bssp"
#ERROR : Can't open dsspfile "2j4zA.bssp"
#ERROR : Can't open dsspfile "2hyyD.bssp"
#ERROR : Can't open dsspfile "3gfeA.bssp"
#ERROR : Can't open dsspfile "1f5qA.bssp"
#ERROR : Can't open dsspfile "3e92A.bssp"
#ERROR : Can't open dsspfile "2dwbA.bssp"
#ERROR : Can't open dsspfile "3ds6A.bssp"
#ERROR : Can't open dsspfile "3dk7B.bssp"
#ERROR : Can't open dsspfile "3dk7A.bssp"
#ERROR : Can't open dsspfile "1di9A.bssp"
#ERROR : Can't open dsspfile "3dakC.bssp"
#ERROR : Can't open dsspfile "3d7zA.bssp"
#ERROR : Can't open dsspfile "3d5wA.bssp"
#ERROR : Can't open dsspfile "2cn5A.bssp"
#ERROR : Can't open dsspfile "3ckxA.bssp"
#ERROR : Can't open dsspfile "2cjmC.bssp"
#ERROR : Can't open dsspfile "2cjmA.bssp"
#ERROR : Can't open dsspfile "3bysA.bssp"
#ERROR : Can't open dsspfile "3bx5A.bssp"
#ERROR : Can't open dsspfile "3bv2A.bssp"
#ERROR : Can't open dsspfile "2bfxA.bssp"
#ERROR : Can't open dsspfile "2balA.bssp"
#ERROR : Can't open dsspfile "2vwiC.bssp"
#ERROR : Can't open dsspfile "2vgoB.bssp"
#ERROR : Can't open dsspfile "1v1kA.bssp"
#ERROR : Can't open dsspfile "2qohA.bssp"
#ERROR : Can't open dsspfile "1opjB.bssp"
#ERROR : Can't open dsspfile "1opjA.bssp"
#ERROR : Can't open dsspfile "1m52B.bssp"
#ERROR : Can't open dsspfile "1m52A.bssp"
#ERROR : Can't open dsspfile "1iepA.bssp"
#ERROR : Can't open dsspfile "2hznA.bssp"
#ERROR : Can't open dsspfile "2hyyB.bssp"
#ERROR : Can't open dsspfile "2h9vA.bssp"
#ERROR : Can't open dsspfile "1fpuA.bssp"
#ERROR : Can't open dsspfile "2f2uB.bssp"
#ERROR : Can't open dsspfile "2f2uA.bssp"
#ERROR : Can't open dsspfile "3ezvA.bssp"
#ERROR : Can't open dsspfile "3eb0A.bssp"
#ERROR : Can't open dsspfile "3dbeA.bssp"
#ERROR : Can't open dsspfile "3db8A.bssp"
#ERROR : Can't open dsspfile "3db6A.bssp"
#ERROR : Can't open dsspfile "3daeA.bssp"
#ERROR : Can't open dsspfile "3d5xA.bssp"
#ERROR : Can't open dsspfile "3d5uA.bssp"
#ERROR : Can't open dsspfile "3cy3A.bssp"
#ERROR : Can't open dsspfile "3cqwA.bssp"
#ERROR : Can't open dsspfile "3cquA.bssp"
#ERROR : Can't open dsspfile "2wqeA.bssp"
#ERROR : Can't open dsspfile "2ozaB.bssp"
#ERROR : Can't open dsspfile "1o6lA.bssp"
#ERROR : Can't open dsspfile "1o6kA.bssp"
#ERROR : Can't open dsspfile "2jdoA.bssp"
#ERROR : Can't open dsspfile "3igoA.bssp"
#ERROR : Can't open dsspfile "2hw7A.bssp"
#ERROR : Can't open dsspfile "2gtnA.bssp"
#ERROR : Can't open dsspfile "2gtmA.bssp"
#ERROR : Can't open dsspfile "3f69B.bssp"
#ERROR : Can't open dsspfile "3efwB.bssp"
#ERROR : Can't open dsspfile "3efwA.bssp"
#ERROR : Can't open dsspfile "3e8dB.bssp"
#ERROR : Can't open dsspfile "3e8dA.bssp"
#ERROR : Can't open dsspfile "3e88A.bssp"
#ERROR : Can't open dsspfile "3e87A.bssp"
#ERROR : Can't open dsspfile "3d0eA.bssp"
#ERROR : Can't open dsspfile "1zohA.bssp"
#ERROR : Can't open dsspfile "2zazA.bssp"
#ERROR : Can't open dsspfile "2wmxA.bssp"
#ERROR : Can't open dsspfile "2wmwA.bssp"
#ERROR : Can't open dsspfile "2wmvA.bssp"
#ERROR : Can't open dsspfile "2wmuA.bssp"
#ERROR : Can't open dsspfile "2wmtA.bssp"
#ERROR : Can't open dsspfile "2wmsA.bssp"
#ERROR : Can't open dsspfile "2rg6A.bssp"
#ERROR : Can't open dsspfile "2rg5A.bssp"
#ERROR : Can't open dsspfile "2r0uA.bssp"
#ERROR : Can't open dsspfile "2qhnA.bssp"
#ERROR : Can't open dsspfile "2qc6A.bssp"
#ERROR : Can't open dsspfile "2pvkA.bssp"
#ERROR : Can't open dsspfile "2pvjA.bssp"
#ERROR : Can't open dsspfile "1om1A.bssp"
#ERROR : Can't open dsspfile "1lp4A.bssp"
#ERROR : Can't open dsspfile "3jvsA.bssp"
#ERROR : Can't open dsspfile "3jvrA.bssp"
#ERROR : Can't open dsspfile "3i79A.bssp"
#ERROR : Can't open dsspfile "2hz4C.bssp"
#ERROR : Can't open dsspfile "2hz4B.bssp"
#ERROR : Can't open dsspfile "2hz4A.bssp"
#ERROR : Can't open dsspfile "3hx4A.bssp"
#ERROR : Can't open dsspfile "2hw6A.bssp"
#ERROR : Can't open dsspfile "3hrbA.bssp"
#ERROR : Can't open dsspfile "3hp5A.bssp"
#ERROR : Can't open dsspfile "3h0zC.bssp"
#ERROR : Can't open dsspfile "1gijA.bssp"
#ERROR : Can't open dsspfile "3g6hA.bssp"
#ERROR : Can't open dsspfile "2fumA.bssp"
#ERROR : Can't open dsspfile "1fpuB.bssp"
#ERROR : Can't open dsspfile "1fotA.bssp"
#ERROR : Can't open dsspfile "3fl5A.bssp"
#ERROR : Can't open dsspfile "3f9nA.bssp"
#ERROR : Can't open dsspfile "1f0qA.bssp"
#ERROR : Can't open dsspfile "2duvA.bssp"
#ERROR : Can't open dsspfile "1ds5A.bssp"
#ERROR : Can't open dsspfile "3clyA.bssp"
#ERROR : Can't open dsspfile "3cg2A.bssp"
#ERROR : Can't open dsspfile "2c3jA.bssp"
#ERROR : Can't open dsspfile "2b55A.bssp"
#ERROR : Can't open dsspfile "2ac5A.bssp"
#ERROR : Can't open dsspfile "2w1gA.bssp"
#ERROR : Can't open dsspfile "2w1fA.bssp"
#ERROR : Can't open dsspfile "2w1eA.bssp"
#ERROR : Can't open dsspfile "2w1dA.bssp"
#ERROR : Can't open dsspfile "2np8A.bssp"
#ERROR : Can't open dsspfile "1muoA.bssp"
#ERROR : Can't open dsspfile "2j50A.bssp"
#ERROR : Can't open dsspfile "2hziB.bssp"
#ERROR : Can't open dsspfile "2hziA.bssp"
#ERROR : Can't open dsspfile "2hz0A.bssp"
#ERROR : Can't open dsspfile "2hyyC.bssp"
#ERROR : Can't open dsspfile "2hyyA.bssp"
#ERROR : Can't open dsspfile "2hiwA.bssp"
#ERROR : Can't open dsspfile "3h10D.bssp"
#ERROR : Can't open dsspfile "3h0zA.bssp"
#ERROR : Can't open dsspfile "3h0yA.bssp"
#ERROR : Can't open dsspfile "1gihA.bssp"
#ERROR : Can't open dsspfile "2g1tD.bssp"
#ERROR : Can't open dsspfile "2g1tC.bssp"
#ERROR : Can't open dsspfile "2g1tB.bssp"
#ERROR : Can't open dsspfile "2g1tA.bssp"
#ERROR : Can't open dsspfile "3fdnA.bssp"
#ERROR : Can't open dsspfile "1f5qC.bssp"
#ERROR : Can't open dsspfile "3ezrA.bssp"
#ERROR : Can't open dsspfile "3e93A.bssp"
#ERROR : Can't open dsspfile "3cs9D.bssp"
#ERROR : Can't open dsspfile "3cs9A.bssp"
#ERROR : Can't open dsspfile "2clqA.bssp"
#ERROR : Can't open dsspfile "2c6eB.bssp"
#ERROR : Can't open dsspfile "2c6eA.bssp"
#ERROR : Can't open dsspfile "2c6dA.bssp"
#ERROR : Can't open dsspfile "2btrA.bssp"
#ERROR : Can't open dsspfile "2bmcF.bssp"
#ERROR : Can't open dsspfile "2bmcC.bssp"
#ERROR : Can't open dsspfile "2bmcB.bssp"
#ERROR : Can't open dsspfile "2bmcA.bssp"
#ERROR : Can't open dsspfile "1zz2A.bssp"
#ERROR : Can't open dsspfile "2w5hA.bssp"
#ERROR : Can't open dsspfile "2v7aB.bssp"
#ERROR : Can't open dsspfile "2v7aA.bssp"
#ERROR : Can't open dsspfile "2uw4A.bssp"
#ERROR : Can't open dsspfile "1tvoA.bssp"
#ERROR : Can't open dsspfile "2qr8A.bssp"
#ERROR : Can't open dsspfile "2og8B.bssp"
#ERROR : Can't open dsspfile "2ofvA.bssp"
#ERROR : Can't open dsspfile "1jsuA.bssp"
#ERROR : Can't open dsspfile "3hl7A.bssp"
#ERROR : Can't open dsspfile "3gcuA.bssp"
#ERROR : Can't open dsspfile "2g2fB.bssp"
#ERROR : Can't open dsspfile "2fysA.bssp"
#ERROR : Can't open dsspfile "2fysB.bssp"
#ERROR : Can't open dsspfile "3fv8A.bssp"
#ERROR : Can't open dsspfile "2fvdA.bssp"
#ERROR : Can't open dsspfile "3f6xD.bssp"
#ERROR : Can't open dsspfile "3erkA.bssp"
#ERROR : Can't open dsspfile "2erkA.bssp"
#ERROR : Can't open dsspfile "1erkA.bssp"
#ERROR : Can't open dsspfile "2e14A.bssp"
#ERROR : Can't open dsspfile "3dqxB.bssp"
#ERROR : Can't open dsspfile "3c9wA.bssp"
#ERROR : Can't open dsspfile "2bakA.bssp"
#ERROR : Can't open dsspfile "2zoqA.bssp"
#ERROR : Can't open dsspfile "2zjwA.bssp"
#ERROR : Can't open dsspfile "2vwiB.bssp"
#ERROR : Can't open dsspfile "2vv9A.bssp"
#ERROR : Can't open dsspfile "2rkpA.bssp"
#ERROR : Can't open dsspfile "2r7iD.bssp"
#ERROR : Can't open dsspfile "2r7iC.bssp"
#ERROR : Can't open dsspfile "2r7iB.bssp"
#ERROR : Can't open dsspfile "2r7iA.bssp"
#ERROR : Can't open dsspfile "2pvrA.bssp"
#ERROR : Can't open dsspfile "1pmeA.bssp"
#ERROR : Can't open dsspfile "1pjkA.bssp"
#ERROR : Can't open dsspfile "2ojiA.bssp"
#ERROR : Can't open dsspfile "2ojgA.bssp"
#ERROR : Can't open dsspfile "1o6yA.bssp"
#ERROR : Can't open dsspfile "1na7A.bssp"
#ERROR : Can't open dsspfile "1jwhB.bssp"
#ERROR : Can't open dsspfile "1jwhA.bssp"
#ERROR : Can't open dsspfile "2iwiB.bssp"
#ERROR : Can't open dsspfile "2ivtA.bssp"
#ERROR : Can't open dsspfile "3h30A.bssp"
#ERROR : Can't open dsspfile "3gp0A.bssp"
#ERROR : Can't open dsspfile "1golA.bssp"
#ERROR : Can't open dsspfile "3ggfB.bssp"
#ERROR : Can't open dsspfile "3ggfA.bssp"
#ERROR : Can't open dsspfile "2g2iB.bssp"
#ERROR : Can't open dsspfile "2g2iA.bssp"
#ERROR : Can't open dsspfile "2g2hA.bssp"
#ERROR : Can't open dsspfile "2g2fA.bssp"
#ERROR : Can't open dsspfile "2f4jA.bssp"
#ERROR : Can't open dsspfile "3dakA.bssp"
#ERROR : Can't open dsspfile "3cohA.bssp"
#ERROR : Can't open dsspfile "3bw5A.bssp"
#ERROR : Can't open dsspfile "3bqcA.bssp"
#ERROR : Can't open dsspfile "1zyjA.bssp"
#ERROR : Can't open dsspfile "2vttA.bssp"
#ERROR : Can't open dsspfile "1ungA.bssp"
#ERROR : Can't open dsspfile "2r3nA.bssp"
#ERROR : Can't open dsspfile "2pwlA.bssp"
#ERROR : Can't open dsspfile "1kv1A.bssp"
#ERROR : Can't open dsspfile "2j9mA.bssp"
#ERROR : Can't open dsspfile "2iwiA.bssp"
#ERROR : Can't open dsspfile "2hw6B.bssp"
#ERROR : Can't open dsspfile "2ghmA.bssp"
#ERROR : Can't open dsspfile "3eb0C.bssp"
#ERROR : Can't open dsspfile "3dqxA.bssp"
#ERROR : Can't open dsspfile "3dlsF.bssp"
#ERROR : Can't open dsspfile "3dlsE.bssp"
#ERROR : Can't open dsspfile "3dlsD.bssp"
#ERROR : Can't open dsspfile "3daeB.bssp"
#ERROR : Can't open dsspfile "2btsA.bssp"
#ERROR : Can't open dsspfile "1aq1A.bssp"
#ERROR : Can't open dsspfile "1yw2A.bssp"
#ERROR : Can't open dsspfile "2wntB.bssp"
#ERROR : Can't open dsspfile "2wntA.bssp"
#ERROR : Can't open dsspfile "2w05A.bssp"
#ERROR : Can't open dsspfile "2vtqA.bssp"
#ERROR : Can't open dsspfile "2qd9A.bssp"
#ERROR : Can't open dsspfile "2pziB.bssp"
#ERROR : Can't open dsspfile "2pziA.bssp"
#ERROR : Can't open dsspfile "2psqA.bssp"
#ERROR : Can't open dsspfile "1oitA.bssp"
#ERROR : Can't open dsspfile "2ivvA.bssp"
#ERROR : Can't open dsspfile "2gqgB.bssp"
#ERROR : Can't open dsspfile "2gqgA.bssp"
#ERROR : Can't open dsspfile "3gcvA.bssp"
#ERROR : Can't open dsspfile "1g5sA.bssp"
#ERROR : Can't open dsspfile "3eqrA.bssp"
#ERROR : Can't open dsspfile "3el8A.bssp"
#ERROR : Can't open dsspfile "3eh9A.bssp"
#ERROR : Can't open dsspfile "3dlsB.bssp"
#ERROR : Can't open dsspfile "3dakB.bssp"
#ERROR : Can't open dsspfile "3d14A.bssp"
#ERROR : Can't open dsspfile "3byuA.bssp"
#ERROR : Can't open dsspfile "2bheA.bssp"
#ERROR : Can't open dsspfile "2ac3A.bssp"
#ERROR : Can't open dsspfile "2vtnA.bssp"
#ERROR : Can't open dsspfile "1r39A.bssp"
#ERROR : Can't open dsspfile "3hp2A.bssp"
#ERROR : Can't open dsspfile "3hllA.bssp"
#ERROR : Can't open dsspfile "3ehaA.bssp"
#ERROR : Can't open dsspfile "3dlsC.bssp"
#ERROR : Can't open dsspfile "3c5uA.bssp"
#ERROR : Can't open dsspfile "3bv3A.bssp"
#ERROR : Can't open dsspfile "2bajA.bssp"
#ERROR : Can't open dsspfile "1zxeD.bssp"
#ERROR : Can't open dsspfile "2w7xA.bssp"
#ERROR : Can't open dsspfile "1ua2A.bssp"
#ERROR : Can't open dsspfile "2r9sA.bssp"
#ERROR : Can't open dsspfile "2pwlB.bssp"
#ERROR : Can't open dsspfile "2pkjA.bssp"
#ERROR : Can't open dsspfile "2pk9A.bssp"
#ERROR : Can't open dsspfile "1mruB.bssp"
#ERROR : Can't open dsspfile "1mruA.bssp"
#ERROR : Can't open dsspfile "2ivuA.bssp"
#ERROR : Can't open dsspfile "3gqlB.bssp"
#ERROR : Can't open dsspfile "3gcsA.bssp"
#ERROR : Can't open dsspfile "2fumB.bssp"
#ERROR : Can't open dsspfile "3f6xC.bssp"
#ERROR : Can't open dsspfile "3eqiA.bssp"
#ERROR : Can't open dsspfile "3eqfA.bssp"
#ERROR : Can't open dsspfile "3en4B.bssp"
#ERROR : Can't open dsspfile "2vwiA.bssp"
#ERROR : Can't open dsspfile "2vu3A.bssp"
#ERROR : Can't open dsspfile "1r78A.bssp"
#ERROR : Can't open dsspfile "2qg5D.bssp"
#ERROR : Can't open dsspfile "2qg5B.bssp"
#ERROR : Can't open dsspfile "2qg5A.bssp"
#ERROR : Can't open dsspfile "2ptjA.bssp"
#ERROR : Can't open dsspfile "2oiqA.bssp"
#ERROR : Can't open dsspfile "2ivsB.bssp"
#ERROR : Can't open dsspfile "2gphA.bssp"
#ERROR : Can't open dsspfile "1fmkA.bssp"
#ERROR : Can't open dsspfile "3f69A.bssp"
#ERROR : Can't open dsspfile "2f57B.bssp"
#ERROR : Can't open dsspfile "2f57A.bssp"
#ERROR : Can't open dsspfile "3f3zA.bssp"
#ERROR : Can't open dsspfile "3dlsA.bssp"
#ERROR : Can't open dsspfile "3dfaA.bssp"
#ERROR : Can't open dsspfile "2clqB.bssp"
#ERROR : Can't open dsspfile "2bdjA.bssp"
#ERROR : Can't open dsspfile "2bdfB.bssp"
#ERROR : Can't open dsspfile "2bdfA.bssp"
#ERROR : Can't open dsspfile "2zb1A.bssp"
#ERROR : Can't open dsspfile "2z7lA.bssp"
#ERROR : Can't open dsspfile "1q97B.bssp"
#ERROR : Can't open dsspfile "1q8zB.bssp"
#ERROR : Can't open dsspfile "1q8zA.bssp"
#ERROR : Can't open dsspfile "1q8yA.bssp"
#ERROR : Can't open dsspfile "2oiqB.bssp"
#ERROR : Can't open dsspfile "3k2lA.bssp"
#ERROR : Can't open dsspfile "2jd5B.bssp"
#ERROR : Can't open dsspfile "2jd5A.bssp"
#ERROR : Can't open dsspfile "2jbpJ.bssp"
#ERROR : Can't open dsspfile "1howA.bssp"
#ERROR : Can't open dsspfile "3fi3A.bssp"
#ERROR : Can't open dsspfile "3f6xA.bssp"
#ERROR : Can't open dsspfile "3f61A.bssp"
#ERROR : Can't open dsspfile "3eqpA.bssp"
#ERROR : Can't open dsspfile "3eqpB.bssp"
#ERROR : Can't open dsspfile "3el8B.bssp"
#ERROR : Can't open dsspfile "3d7tB.bssp"
#ERROR : Can't open dsspfile "2uv2A.bssp"
#ERROR : Can't open dsspfile "2q0nA.bssp"
#ERROR : Can't open dsspfile "2pzyD.bssp"
#ERROR : Can't open dsspfile "1pmqA.bssp"
#ERROR : Can't open dsspfile "2j0iA.bssp"
#ERROR : Can't open dsspfile "3hmiA.bssp"
#ERROR : Can't open dsspfile "3gqlC.bssp"
#ERROR : Can't open dsspfile "3gqlA.bssp"
#ERROR : Can't open dsspfile "3g6hB.bssp"
#ERROR : Can't open dsspfile "2e2bB.bssp"
#ERROR : Can't open dsspfile "2e2bA.bssp"
#ERROR : Can't open dsspfile "3dj7A.bssp"
#ERROR : Can't open dsspfile "3dajA.bssp"
#ERROR : Can't open dsspfile "3d2iA.bssp"
#ERROR : Can't open dsspfile "3d15A.bssp"
#ERROR : Can't open dsspfile "3comB.bssp"
#ERROR : Can't open dsspfile "3comA.bssp"
#ERROR : Can't open dsspfile "2wipC.bssp"
#ERROR : Can't open dsspfile "2wipA.bssp"
#ERROR : Can't open dsspfile "2w9fB.bssp"
#ERROR : Can't open dsspfile "1unhA.bssp"
#ERROR : Can't open dsspfile "1u5qA.bssp"
#ERROR : Can't open dsspfile "2qkwB.bssp"
#ERROR : Can't open dsspfile "2p5aA.bssp"
#ERROR : Can't open dsspfile "1p4fA.bssp"
#ERROR : Can't open dsspfile "1lufA.bssp"
#ERROR : Can't open dsspfile "2j90A.bssp"
#ERROR : Can't open dsspfile "3gc0A.bssp"
#ERROR : Can't open dsspfile "3gbzA.bssp"
#ERROR : Can't open dsspfile "3en4A.bssp"
#ERROR : Can't open dsspfile "3dj5A.bssp"
#ERROR : Can't open dsspfile "3d2kA.bssp"
#ERROR : Can't open dsspfile "2baqA.bssp"
#ERROR : Can't open dsspfile "1zwsA.bssp"
#ERROR : Can't open dsspfile "1wmkH.bssp"
#ERROR : Can't open dsspfile "1wmkB.bssp"
#ERROR : Can't open dsspfile "1wmkE.bssp"
#ERROR : Can't open dsspfile "1wmkA.bssp"
#ERROR : Can't open dsspfile "2qr7A.bssp"
#ERROR : Can't open dsspfile "2j90B.bssp"
#ERROR : Can't open dsspfile "3hyhA.bssp"
#ERROR : Can't open dsspfile "3gqiA.bssp"
#ERROR : Can't open dsspfile "3geqB.bssp"
#ERROR : Can't open dsspfile "3geqA.bssp"
#ERROR : Can't open dsspfile "3eqrB.bssp"
#ERROR : Can't open dsspfile "3en5B.bssp"
#ERROR : Can't open dsspfile "3e3bX.bssp"
#ERROR : Can't open dsspfile "2ckeB.bssp"
#ERROR : Can't open dsspfile "2ckeA.bssp"
#ERROR : Can't open dsspfile "2a2aB.bssp"
#ERROR : Can't open dsspfile "2a2aA.bssp"
#ERROR : Can't open dsspfile "2a27A.bssp"
#ERROR : Can't open dsspfile "2pzyC.bssp"
#ERROR : Can't open dsspfile "2pzyB.bssp"
#ERROR : Can't open dsspfile "2pzyA.bssp"
#ERROR : Can't open dsspfile "2pmiC.bssp"
#ERROR : Can't open dsspfile "2p3gX.bssp"
#ERROR : Can't open dsspfile "2ozaA.bssp"
#ERROR : Can't open dsspfile "2onlD.bssp"
#ERROR : Can't open dsspfile "2onlC.bssp"
#ERROR : Can't open dsspfile "2ofvB.bssp"
#ERROR : Can't open dsspfile "1kwpB.bssp"
#ERROR : Can't open dsspfile "1kwpA.bssp"
#ERROR : Can't open dsspfile "1k9aB.bssp"
#ERROR : Can't open dsspfile "2jbpL.bssp"
#ERROR : Can't open dsspfile "2jbpK.bssp"
#ERROR : Can't open dsspfile "2jbpI.bssp"
#ERROR : Can't open dsspfile "2jbpH.bssp"
#ERROR : Can't open dsspfile "2jbpG.bssp"
#ERROR : Can't open dsspfile "2jbpF.bssp"
#ERROR : Can't open dsspfile "2jbpE.bssp"
#ERROR : Can't open dsspfile "2jbpD.bssp"
#ERROR : Can't open dsspfile "2jbpC.bssp"
#ERROR : Can't open dsspfile "2jbpB.bssp"
#ERROR : Can't open dsspfile "2jbpA.bssp"
#ERROR : Can't open dsspfile "2jboA.bssp"
#ERROR : Can't open dsspfile "3h4jA.bssp"
#ERROR : Can't open dsspfile "3h4jB.bssp"
#ERROR : Can't open dsspfile "3fpmA.bssp"
#ERROR : Can't open dsspfile "1zxeF.bssp"
#ERROR : Can't open dsspfile "1wfcA.bssp"
#ERROR : Can't open dsspfile "1q3dB.bssp"
#ERROR : Can't open dsspfile "2pv8A.bssp"
#ERROR : Can't open dsspfile "2ptoA.bssp"
#ERROR : Can't open dsspfile "2oicA.bssp"
#ERROR : Can't open dsspfile "2nruB.bssp"
#ERROR : Can't open dsspfile "2nruA.bssp"
#ERROR : Can't open dsspfile "3ha8A.bssp"
#ERROR : Can't open dsspfile "1h00A.bssp"
#ERROR : Can't open dsspfile "2gfsA.bssp"
#ERROR : Can't open dsspfile "1g3nA.bssp"
#ERROR : Can't open dsspfile "3fi2A.bssp"
#ERROR : Can't open dsspfile "2eufB.bssp"
#ERROR : Can't open dsspfile "3e8nA.bssp"
#ERROR : Can't open dsspfile "3dy7A.bssp"
#ERROR : Can't open dsspfile "3dv3A.bssp"
#ERROR : Can't open dsspfile "3c4fA.bssp"
#ERROR : Can't open dsspfile "1blxA.bssp"
#ERROR : Can't open dsspfile "1xo2B.bssp"
#ERROR : Can't open dsspfile "1urwA.bssp"
#ERROR : Can't open dsspfile "1u4dB.bssp"
#ERROR : Can't open dsspfile "1ny3A.bssp"
#ERROR : Can't open dsspfile "1nxkD.bssp"
#ERROR : Can't open dsspfile "1nxkC.bssp"
#ERROR : Can't open dsspfile "1nxkB.bssp"
#ERROR : Can't open dsspfile "1nxkA.bssp"
#ERROR : Can't open dsspfile "1k9aE.bssp"
#ERROR : Can't open dsspfile "1k9aD.bssp"
#ERROR : Can't open dsspfile "1k9aA.bssp"
#ERROR : Can't open dsspfile "2wajA.bssp"
#ERROR : Can't open dsspfile "1ukiA.bssp"
#ERROR : Can't open dsspfile "1u4dA.bssp"
#ERROR : Can't open dsspfile "2pmiA.bssp"
#ERROR : Can't open dsspfile "1pmuA.bssp"
#ERROR : Can't open dsspfile "2ow3A.bssp"
#ERROR : Can't open dsspfile "2o0uA.bssp"
#ERROR : Can't open dsspfile "1k9aF.bssp"
#ERROR : Can't open dsspfile "2h96A.bssp"
#ERROR : Can't open dsspfile "2gmxB.bssp"
#ERROR : Can't open dsspfile "2gmxA.bssp"
#ERROR : Can't open dsspfile "2g01B.bssp"
#ERROR : Can't open dsspfile "2g01A.bssp"
#ERROR : Can't open dsspfile "2fumD.bssp"
#ERROR : Can't open dsspfile "2fslX.bssp"
#ERROR : Can't open dsspfile "3f3wB.bssp"
#ERROR : Can't open dsspfile "3f3wA.bssp"
#ERROR : Can't open dsspfile "3e7oA.bssp"
#ERROR : Can't open dsspfile "3da6A.bssp"
#ERROR : Can't open dsspfile "1ym7D.bssp"
#ERROR : Can't open dsspfile "1ym7C.bssp"
#ERROR : Can't open dsspfile "1ym7A.bssp"
#ERROR : Can't open dsspfile "2w9zB.bssp"
#ERROR : Can't open dsspfile "2w99B.bssp"
#ERROR : Can't open dsspfile "2w96B.bssp"
#ERROR : Can't open dsspfile "2w0jA.bssp"
#ERROR : Can't open dsspfile "1ungB.bssp"
#ERROR : Can't open dsspfile "1s9jA.bssp"
#ERROR : Can't open dsspfile "2qnjB.bssp"
#ERROR : Can't open dsspfile "2pv5A.bssp"
#ERROR : Can't open dsspfile "1omwA.bssp"
#ERROR : Can't open dsspfile "2oibD.bssp"
#ERROR : Can't open dsspfile "1k9aC.bssp"
#ERROR : Can't open dsspfile "2j0lA.bssp"
#ERROR : Can't open dsspfile "3hyhB.bssp"
#ERROR : Can't open dsspfile "3g6gA.bssp"
#ERROR : Can't open dsspfile "3fc1X.bssp"
#ERROR : Can't open dsspfile "2ewaA.bssp"
#ERROR : Can't open dsspfile "3eqcA.bssp"
#ERROR : Can't open dsspfile "2cn8A.bssp"
#ERROR : Can't open dsspfile "3cikA.bssp"
#ERROR : Can't open dsspfile "2bcjA.bssp"
#ERROR : Can't open dsspfile "2w17A.bssp"
#ERROR : Can't open dsspfile "2vrxB.bssp"
#ERROR : Can't open dsspfile "1u54A.bssp"
#ERROR : Can't open dsspfile "1u46A.bssp"
#ERROR : Can't open dsspfile "2qi8A.bssp"
#ERROR : Can't open dsspfile "2nryD.bssp"
#ERROR : Can't open dsspfile "3hgkC.bssp"
#ERROR : Can't open dsspfile "3hgkB.bssp"
#ERROR : Can't open dsspfile "3hgkA.bssp"
#ERROR : Can't open dsspfile "1gjoA.bssp"
#ERROR : Can't open dsspfile "3g6gB.bssp"
#ERROR : Can't open dsspfile "3famA.bssp"
#ERROR : Can't open dsspfile "3f3uB.bssp"
#ERROR : Can't open dsspfile "2eu9A.bssp"
#ERROR : Can't open dsspfile "3d7uD.bssp"
#ERROR : Can't open dsspfile "3d7uB.bssp"
#ERROR : Can't open dsspfile "3d7uA.bssp"
#ERROR : Can't open dsspfile "2c30A.bssp"
#ERROR : Can't open dsspfile "2b1pA.bssp"
#ERROR : Can't open dsspfile "2zm3B.bssp"
#ERROR : Can't open dsspfile "1u54B.bssp"
#ERROR : Can't open dsspfile "2pvfA.bssp"
#ERROR : Can't open dsspfile "2j0jA.bssp"
#ERROR : Can't open dsspfile "1fgiA.bssp"
#ERROR : Can't open dsspfile "1yomB.bssp"
#ERROR : Can't open dsspfile "1yomA.bssp"
#ERROR : Can't open dsspfile "2vgpA.bssp"
#ERROR : Can't open dsspfile "1r0eA.bssp"
#ERROR : Can't open dsspfile "2qkrA.bssp"
#ERROR : Can't open dsspfile "1pyxB.bssp"
#ERROR : Can't open dsspfile "1pyxA.bssp"
#ERROR : Can't open dsspfile "2oj9A.bssp"
#ERROR : Can't open dsspfile "2oicD.bssp"
#ERROR : Can't open dsspfile "1m17A.bssp"
#ERROR : Can't open dsspfile "1m14A.bssp"
#ERROR : Can't open dsspfile "2jiuB.bssp"
#ERROR : Can't open dsspfile "2jiuA.bssp"
#ERROR : Can't open dsspfile "2jitB.bssp"
#ERROR : Can't open dsspfile "2jitA.bssp"
#ERROR : Can't open dsspfile "2j6mA.bssp"
#ERROR : Can't open dsspfile "2itwA.bssp"
#ERROR : Can't open dsspfile "2i6lA.bssp"
#ERROR : Can't open dsspfile "1i09A.bssp"
#ERROR : Can't open dsspfile "2fsmX.bssp"
#ERROR : Can't open dsspfile "2cl1A.bssp"
#ERROR : Can't open dsspfile "2cdzA.bssp"
#ERROR : Can't open dsspfile "2bfxB.bssp"

## Summary of PDB Search
:305
    6e-29  31%  1ckjB  [d.144.1] RECOMBINANT CASEIN KINASE I DELTA
    6e-29  31%  1ckjA  [d.144.1] RECOMBINANT CASEIN KINASE I DELTA
    2e-28  31%  1ckiB  [d.144.1] CASEIN KINASE I DELTA
    2e-28  31%  1ckiA  [d.144.1] CASEIN KINASE I DELTA
    1e-24  32%  2cmwA  [x.x.x] CASEIN KINASE I ISOFORM GAMMA-1
    2e-23  33%  1csnA  [d.144.1 (1eh4A)] CASEIN KINASE-1
    2e-23  28%  2c47B  [x.x.x] CASEIN KINASE 1 GAMMA 2 ISOFORM
    2e-23  28%  2c47A  [x.x.x] CASEIN KINASE 1 GAMMA 2 ISOFORM
    4e-23  29%  2c47C  [x.x.x] CASEIN KINASE 1 GAMMA 2 ISOFORM
    6e-23  28%  2c47D  [x.x.x] CASEIN KINASE 1 GAMMA 2 ISOFORM
    1e-22  29%  2chlA  [x.x.x] CASEIN KINASE I ISOFORM GAMMA-3
    2e-22  28%  2izuA  [x.x.x] CASEIN KINASE I ISOFORM GAMMA-3
    2e-22  28%  2iztA  [x.x.x] CASEIN KINASE I ISOFORM GAMMA-3
    2e-22  28%  2izrA  [x.x.x] CASEIN KINASE I ISOFORM GAMMA-3
    6e-15  30%  2v62B  [x.x.x] SERINE/THREONINE-PROTEIN KINASE VRK2
    4e-14  29%  2v62A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE VRK2
    1e-11  34%  2jamB  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    1e-11  34%  2jamA  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    7e-11  27%  3hrfA  [x.x.x] 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1
    7e-11  30%  3dbqA  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE TTK
    1e-10  30%  2zmcA  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE TTK
    1e-10  35%  2vd5B  [x.x.x] DMPK PROTEIN
    1e-10  35%  2vd5A  [x.x.x] DMPK PROTEIN
    2e-10  24%  1qcfA  [b.34.2 - d.93.1 - d.144.1] HAEMATOPOETIC CELL KINASE (HCK)
    2e-10  30%  3h9fA  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE TTK
    2e-10  31%  3gfwA  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE TTK
    4e-10  31%  1kobA  [d.144.1] TWITCHIN
    5e-10  31%  3cekA  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE TTK
    5e-10  31%  3blhA  [x.x.x] CELL DIVISION PROTEIN KINASE 9
    8e-10  34%  3hztA  [x.x.x] CALCIUM-DEPENDENT PROTEIN KINASE 3
    1e-09  30%  2zmdA  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE TTK
    1e-09  24%  1qpjA  [d.144.1] LCK TYROSINE KINASE
    1e-09  24%  1qpcA  [d.144.1] LCK KINASE
    1e-09  24%  2ofuA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    1e-09  27%  3hrcA  [x.x.x] 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1
    1e-09  27%  1h1wA  [d.144.1] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
    1e-09  24%  3bymA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    1e-09  27%  2biyA  [x.x.x] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
    1e-09  30%  1zydA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    1e-09  30%  1zycC  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    1e-09  33%  1zycB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    1e-09  34%  1u7eA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-09  34%  3fhiA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    2e-09  30%  1zydB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    2e-09  30%  1zycA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    2e-09  29%  1yhwA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 1
    2e-09  29%  1yhvA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 1
    2e-09  23%  2pl0A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    2e-09  23%  2of2A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    2e-09  30%  1zy4A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    2e-09  34%  1rejA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-09  35%  1rdqE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-09  34%  2qvsE  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-09  34%  2qurA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-09  34%  1jbpE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-09  34%  3idbA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    2e-09  24%  2hk5A  [x.x.x] TYROSINE-PROTEIN KINASE HCK
    2e-09  34%  2gu8A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-09  28%  3fxzA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 1
    2e-09  34%  1fmoE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    2e-09  34%  3fjqE  [d.144.1 (1atpE)] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC
    2e-09  31%  3e7eA  [x.x.x] MITOTIC CHECKPOINT SERINE/THREONINE-PROTEIN
    2e-09  34%  1bkxA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    3e-09  27%  1uu7A  [d.144.1] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
    3e-09  23%  2jiiB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE VRK3 MOLECULE:
    3e-09  23%  2jiiA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE VRK3 MOLECULE:
    3e-09  29%  3idpA  [x.x.x] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    3e-09  25%  2dq7X  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE FYN
    4e-09  31%  1zycD  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    4e-09  33%  2z7qA  [x.x.x] RIBOSOMAL PROTEIN S6 KINASE ALPHA-1
    4e-09  32%  1unlA  [d.144.1] CYCLIN-DEPENDENT KINASE 5
    4e-09  36%  1sykB  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    4e-09  36%  1sykA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    4e-09  36%  1j3hB  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    4e-09  36%  1j3hA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    5e-09  31%  2wmqA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-09  29%  1wccA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-09  29%  1hckA  [d.144.1 (1pw2A)] HUMAN CYCLIN-DEPENDENT KINASE 2
    5e-09  33%  1apmE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    7e-09  39%  2jc6C  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    7e-09  38%  2jc6A  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    7e-09  29%  2iw9A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    7e-09  29%  3fz1A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    7e-09  29%  3eidC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    9e-09  31%  1ctpE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    9e-09  31%  1cmkE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    9e-09  31%  1cdkA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    9e-09  22%  3b2wA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    1e-08  34%  2qcsA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-08  34%  1l3rE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-08  34%  2cpkE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, CATALYTIC SUBUNIT
    1e-08  32%  2z7rA  [x.x.x] RIBOSOMAL PROTEIN S6 KINASE ALPHA-1
    1e-08  33%  1ydrE  [d.144.1] C-AMP-DEPENDENT PROTEIN KINASE
    1e-08  33%  1xh8A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-08  33%  1xh6A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-08  35%  2uztA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-08  33%  1stcE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    1e-08  33%  1q8uA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-08  33%  1q8tA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-08  28%  1ia8A  [d.144.1] CHK1 CHECKPOINT KINASE
    1e-08  28%  3hkoA  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE WITH
    1e-08  29%  3gc9B  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 11
    1e-08  35%  2f7xE  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-08  32%  1f3mC  [d.144.1] SERINE/THREONINE-PROTEIN KINASE PAK-ALPHA
    1e-08  33%  3e8eI  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    1e-08  33%  3e8cE  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    1e-08  33%  3e8cB  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    1e-08  33%  3dneA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    1e-08  33%  3dndA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    1e-08  28%  2cgxA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    1e-08  28%  2cgvA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    1e-08  28%  2cguA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    1e-08  28%  2c3kA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    1e-08  33%  2c1aA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE
    1e-08  28%  2brnA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    1e-08  29%  2b9fA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE FUS3
    2e-08  30%  1zy5B  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    2e-08  30%  1zy4B  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    2e-08  29%  1uwjB  [d.144.1] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    2e-08  26%  1okyA  [d.144.1] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE 1
    2e-08  29%  3gc8B  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 11
    2e-08  29%  3gc8A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 11
    2e-08  29%  2cgwA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-08  33%  2z7sA  [x.x.x] RIBOSOMAL PROTEIN S6 KINASE ALPHA-1
    3e-08  33%  1smhA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    3e-08  29%  2iw8C  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-08  29%  2iw8A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-08  29%  2gdoA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-08  29%  2fa2B  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE FUS3
    3e-08  29%  2fa2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE FUS3
    3e-08  29%  2f49A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE FUS3
    3e-08  31%  3blrA  [x.x.x] CELL DIVISION PROTEIN KINASE 9
    3e-08  31%  3blqA  [x.x.x] CELL DIVISION PROTEIN KINASE 9
    3e-08  29%  2b9hA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE FUS3
    3e-08  28%  1zysA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-08  28%  1ykrA  [d.144.1 (1finA)] CELL DIVISION PROTEIN KINASE 2
    3e-08  33%  1xh9A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    3e-08  28%  1w98A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-08  30%  2vz6B  [x.x.x] CALCIUM CALMODULIN DEPENDENT PROTEIN KINASE TYPE
    3e-08  28%  1vywC  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-08  28%  1vywA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-08  35%  1v0bA  [d.144.1] CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
    3e-08  28%  1uwjA  [d.144.1] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    3e-08  28%  1okvC  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-08  28%  1okvA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-08  28%  1oiuC  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-08  28%  1oguC  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-08  35%  1ob3A  [d.144.1] CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
    3e-08  28%  1nvrA  [d.144.1] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-08  28%  1jstA  [d.144.1] CYCLIN-DEPENDENT KINASE-2
    3e-08  28%  2jgzA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-08  28%  2iw9C  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-08  28%  2iw6C  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-08  28%  2hogA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-08  28%  1h27C  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-08  28%  1h26C  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-08  28%  1h25C  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-08  28%  1h24A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-08  31%  1h08A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-08  33%  2gnlA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    3e-08  33%  2gnjA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    3e-08  28%  2g9xC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-08  28%  2g9xA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-08  29%  2f9gA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE FUS3
    3e-08  28%  3f5xA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-08  28%  1e9hA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-08  24%  3dqwD  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-08  24%  3dqwC  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-08  24%  3dqwA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-08  28%  3dogC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-08  28%  3ddqC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-08  28%  2cchA  [d.144.1 (1e9hC)] CELL DIVISION PROTEIN KINASE 2
    3e-08  28%  2c4gC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-08  28%  2c4gA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-08  29%  2brmA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-08  30%  2brhA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-08  28%  2bkzC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-08  28%  3bhuC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-08  28%  3bhtC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-08  29%  2b9iA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE FUS3
    4e-08  23%  2zvaA  [x.x.x] TYROSINE-PROTEIN KINASE LYN
    4e-08  30%  1uwhA  [d.144.1] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    4e-08  23%  1qpdA  [d.144.1] LCK KINASE
    4e-08  33%  1q62A  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    4e-08  33%  1q24A  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    4e-08  28%  2e9nA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    4e-08  29%  3d4qA  [x.x.x] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    4e-08  29%  2c3lA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    4e-08  28%  2aypA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    4e-08  23%  1ad5A  [b.34.2 - d.93.1 - d.144.1] HAEMATOPOETIC CELL KINASE HCK
    6e-08  29%  2w06A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    6e-08  29%  2vtoA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    6e-08  30%  2vo0A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    6e-08  35%  1v0oA  [d.144.1] CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
    6e-08  30%  2uvxA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    6e-08  26%  1uu8A  [d.144.1] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
    6e-08  33%  2r5tA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE SGK1
    6e-08  33%  1q61A  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    6e-08  30%  1oi9A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    6e-08  29%  1ke6A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    6e-08  29%  1jvpP  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    6e-08  30%  2jdtA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE
    6e-08  33%  3hdnA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE SGK1
    6e-08  33%  3hdmA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE SGK1
    6e-08  29%  1h0wA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    6e-08  29%  1h0vA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    6e-08  29%  1h0uA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    6e-08  29%  1gz8A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    6e-08  29%  1fvtA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    6e-08  32%  3fbvI  [x.x.x] SERINE/THREONINE-PROTEIN KINASE/ENDORIBONUCLEASE
    6e-08  32%  3fbvD  [x.x.x] SERINE/THREONINE-PROTEIN KINASE/ENDORIBONUCLEASE
    6e-08  32%  3fbvA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE/ENDORIBONUCLEASE
    6e-08  30%  3dogA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    6e-08  28%  2b52A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    7e-08  29%  1y91A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    7e-08  23%  1y57A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    7e-08  33%  1xh7A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    7e-08  30%  2welA  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    7e-08  30%  2vn9A  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    7e-08  23%  2srcA  [x.x.x] TYROSINE-PROTEIN KINASE SRC
    7e-08  33%  1q8wA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    7e-08  27%  1oiyA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    7e-08  27%  1oguA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    7e-08  27%  2iw6A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    7e-08  27%  2i40A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    7e-08  26%  3h9oA  [x.x.x] 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1
    7e-08  23%  2h8hA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    7e-08  29%  3gc9A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 11
    7e-08  29%  2fb8A  [x.x.x] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    7e-08  29%  1f3mD  [d.144.1] SERINE/THREONINE-PROTEIN KINASE PAK-ALPHA
    7e-08  27%  3eocC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    7e-08  27%  3ej1C  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    7e-08  27%  3ej1A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    7e-08  27%  3eidA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    7e-08  33%  3dxnA  [x.x.x] CALMODULIN-LIKE DOMAIN PROTEIN KINASE ISOFORM 3
    7e-08  27%  3ddqA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    7e-08  33%  3bwjA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    7e-08  28%  1buhA  [d.144.1] PROTEIN (CDK2 HUMAN)
    7e-08  27%  3bhtA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-07  28%  1zxeC  [x.x.x] SERINE/THREONINE-PROTEIN KINASE
    1e-07  26%  1uu9A  [d.144.1] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
    1e-07  26%  1okzA  [d.144.1] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE 1
    1e-07  30%  3e5aA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    1e-07  25%  3dk6A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    1e-07  29%  2c5yA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-07  26%  1z5mA  [x.x.x] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
    1e-07  36%  1v0oB  [d.144.1] CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
    1e-07  37%  1v0bB  [d.144.1] CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
    1e-07  26%  1uu3A  [d.144.1] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
    1e-07  26%  2r7bA  [x.x.x] PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1
    1e-07  23%  1kswA  [b.34.2 - d.93.1 - d.144.1] PROTO-ONCOGENE TYROSINE-PROTEIN
    1e-07  30%  2jfmA  [x.x.x] STE20-LIKE SERINE-THREONINE KINASE
    1e-07  30%  2jflA  [x.x.x] STE20-LIKE SERINE/THREONINE-PROTEIN KINASE
    1e-07  30%  2j51A  [x.x.x] STE20-LIKE SERINE/THREONINE-PROTEIN KINASE
    1e-07  32%  2gngA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-07  32%  2gnfA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-07  30%  3c4cB  [x.x.x] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    1e-07  30%  3c4cA  [x.x.x] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    2e-07  23%  2zv7A  [x.x.x] TYROSINE-PROTEIN KINASE LYN
    2e-07  29%  3idpB  [x.x.x] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    2e-07  24%  2c0tB  [x.x.x] TYROSINE-PROTEIN KINASE HCK
    2e-07  24%  2c0tA  [x.x.x] TYROSINE-PROTEIN KINASE HCK
    2e-07  24%  2c0iA  [x.x.x] TYROSINE-PROTEIN KINASE HCK
    2e-07  30%  1yxsA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    2e-07  38%  2w4oA  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    2e-07  28%  1h07A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    2e-07  30%  1h01A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    2e-07  37%  1a06A  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE
    3e-07  30%  2wmrA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-07  30%  2vtpA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-07  30%  2vtiA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-07  30%  2vo6A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    3e-07  30%  2uvzA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    3e-07  30%  2uvyA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    3e-07  32%  1szmB  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    3e-07  32%  1szmA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    3e-07  30%  2r3iA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-07  28%  2okrD  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-07  30%  3ig7A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-07  31%  1giiA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-07  30%  1e1vA  [d.144.1] CYCLIN-DEPENDENT PROTEIN KINASE 2
    3e-07  31%  2ds1A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-07  29%  3dakD  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    3e-07  28%  3ctqA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-07  30%  2clxA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-07  30%  1ckpA  [d.144.1] PROTEIN (CYCLIN-DEPENDENT PROTEIN KINASE 2)
    4e-07  29%  1zxeA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE
    4e-07  30%  1vyzA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    4e-07  30%  2vtsA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-07  30%  2vtrA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-07  28%  2vthA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-07  35%  2rioA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE/ENDORIBONUCLEASE
    4e-07  30%  2r3qA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-07  30%  1oirA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    4e-07  30%  1jsvA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    4e-07  30%  2j2iB  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    4e-07  31%  3h10B  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    4e-07  31%  3h10A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    4e-07  29%  2c3iB  [x.x.x] PROTO-ONCOGENE SERINE THREONINE PROTEIN KINASE
    4e-07  30%  2bzhB  [x.x.x] PROTO-ONCOGENE SERINE THREONINE PROTEIN KINASE
    4e-07  30%  2bilB  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    5e-07  30%  1ywvA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    5e-07  30%  1xwsA  [d.144.1] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    5e-07  30%  1xqzA  [d.144.1] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    5e-07  30%  2v7oA  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    5e-07  31%  2v55C  [x.x.x] RHO-ASSOCIATED PROTEIN KINASE 1
    5e-07  31%  2v55A  [x.x.x] RHO-ASSOCIATED PROTEIN KINASE 1
    5e-07  28%  2uznA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-07  28%  2r3hA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-07  28%  1lezA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 14
    5e-07  31%  2etkB  [x.x.x] RHO-ASSOCIATED PROTEIN KINASE 1
    5e-07  31%  2etkA  [x.x.x] RHO-ASSOCIATED PROTEIN KINASE 1
    5e-07  29%  1di8A  [d.144.1] CYCLIN-DEPENDENT KINASE 2
    5e-07  29%  3d83A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    5e-07  35%  1cm8A  [d.144.1] PHOSPHORYLATED MAP KINASE P38-GAMMA
    5e-07  30%  3c4eC  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    5e-07  31%  3bhhD  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    5e-07  31%  3bhhC  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    5e-07  31%  3bhhB  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    5e-07  31%  3bhhA  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    5e-07  31%  2bfyB  [x.x.x] LOC398457 PROTEIN
    5e-07  31%  2bfyA  [x.x.x] LOC398457 PROTEIN
    6e-07  24%  1yi6A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    6e-07  34%  2rioB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE/ENDORIBONUCLEASE
    6e-07  28%  2r3lA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    6e-07  29%  1lewA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 14
    6e-07  29%  2ivsA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR
    6e-07  29%  2c6iA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    6e-07  29%  2c68A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    6e-07  29%  2a4lA  [x.x.x] HOMO SAPIENS CYCLIN-DEPENDENT KINASE 2
    8e-07  22%  2zv9A  [x.x.x] TYROSINE-PROTEIN KINASE LYN
    8e-07  30%  2r3jA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    8e-07  32%  2objA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    8e-07  36%  1ob3B  [d.144.1] CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
    8e-07  30%  2ghlA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    8e-07  33%  2fh9A  [x.x.x] SNF1 KINASE
    8e-07  32%  3f2aA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    8e-07  32%  3dcvA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    8e-07  29%  1bmkA  [d.144.1] PROTEIN (MAP KINASE P38)
    8e-07  32%  2bikB  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    1e-06  24%  2z60A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    1e-06  28%  1ywrA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-06  29%  2weiA  [x.x.x] CALMODULIN-DOMAIN PROTEIN KINASE 1, PUTATIVE
    1e-06  30%  2r3kA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-06  31%  1mq4A  [d.144.1] AURORA-RELATED KINASE 1
    1e-06  32%  1h4lA  [d.144.1] CELL DIVISION PROTEIN KINASE 5
    1e-06  29%  3gc7A  [d.144.1 (1oveA)] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-06  23%  3dk6B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    1e-06  32%  3cy2A  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    1e-06  32%  3cxwA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    1e-06  28%  3coiA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 13
    1e-06  32%  2bzkB  [x.x.x] PROTO-ONCOGENE SERINE THREONINE PROTEIN KINASE
    1e-06  31%  3bgzA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    1e-06  27%  2bdwB  [x.x.x] HYPOTHETICAL PROTEIN K11E8.1D
    1e-06  27%  2bdwA  [x.x.x] HYPOTHETICAL PROTEIN K11E8.1D
    1e-06  28%  2vtjA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-06  25%  2qohB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    1e-06  29%  2puuA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-06  31%  1ol7A  [d.144.1] SERINE/THREONINE KINASE 6
    1e-06  31%  1ol5A  [d.144.1] SERINE/THREONINE KINASE 6
    1e-06  31%  3ha6A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    1e-06  28%  3gcqA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-06  27%  3gcpA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-06  24%  3dk3B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    1e-06  24%  3dk3A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    1e-06  37%  3d5vA  [x.x.x] POLO-LIKE KINASE 1
    1e-06  28%  2brgA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    2e-06  28%  1zxeE  [x.x.x] SERINE/THREONINE-PROTEIN KINASE
    2e-06  29%  1zxeB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE
    2e-06  29%  2zb0A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-06  29%  1yqjA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-06  29%  1wbsA  [d.144.1 (1bl6A)] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-06  32%  2w5bA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE NEK2
    2e-06  32%  2w5aA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE NEK2
    2e-06  29%  2vz6A  [x.x.x] CALCIUM CALMODULIN DEPENDENT PROTEIN KINASE TYPE
    2e-06  30%  2vwiD  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    2e-06  31%  2vgpB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 12-A
    2e-06  31%  2vgoA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 12-A
    2e-06  24%  1tkiA  [d.144.1] TITIN
    2e-06  30%  1oz1A  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-06  29%  1ouyA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-06  29%  2onlA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-06  29%  2okrA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-06  22%  2og8A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    2e-06  31%  1koaA  [x.x.x] TWITCHIN
    2e-06  24%  1k2pA  [d.144.1] TYROSINE-PROTEIN KINASE BTK
    2e-06  30%  2j4zB  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    2e-06  30%  2j4zA  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    2e-06  23%  2hyyD  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-06  29%  3gfeA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-06  28%  1f5qA  [d.144.1] CYCLIN DEPENDENT KINASE 2
    2e-06  28%  3e92A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-06  31%  2dwbA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    2e-06  29%  3ds6A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-06  23%  3dk7B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-06  23%  3dk7A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-06  29%  1di9A  [d.144.1] P38 KINASE
    2e-06  29%  3dakC  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    2e-06  29%  3d7zA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-06  35%  3d5wA  [x.x.x] POLO-LIKE KINASE 1
    2e-06  31%  2cn5A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK2
    2e-06  27%  3ckxA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 24
    2e-06  28%  2cjmC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-06  31%  2cjmA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-06  22%  3bysA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    2e-06  29%  3bx5A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-06  29%  3bv2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-06  31%  2bfxA  [x.x.x] LOC398457 PROTEIN
    2e-06  28%  2balA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-06  28%  2vwiC  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    2e-06  31%  2vgoB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 12-A
    2e-06  28%  1v1kA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    2e-06  24%  2qohA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-06  24%  1opjB  [d.144.1] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-06  24%  1opjA  [d.144.1] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-06  24%  1m52B  [d.144.1] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-06  24%  1m52A  [d.144.1] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-06  24%  1iepA  [d.144.1] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL
    2e-06  24%  2hznA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-06  23%  2hyyB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-06  33%  2h9vA  [x.x.x] RHO-ASSOCIATED PROTEIN KINASE 2
    2e-06  24%  1fpuA  [d.144.1] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL
    2e-06  33%  2f2uB  [x.x.x] RHO-ASSOCIATED PROTEIN KINASE 2
    2e-06  33%  2f2uA  [x.x.x] RHO-ASSOCIATED PROTEIN KINASE 2
    2e-06  27%  3ezvA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-06  30%  3eb0A  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    2e-06  36%  3dbeA  [x.x.x] POLO-LIKE KINASE 1
    2e-06  36%  3db8A  [x.x.x] POLO-LIKE KINASE 1
    2e-06  36%  3db6A  [x.x.x] POLO-LIKE KINASE 1
    2e-06  31%  3daeA  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    2e-06  36%  3d5xA  [x.x.x] POLO-LIKE KINASE 1
    2e-06  36%  3d5uA  [x.x.x] POLO-LIKE KINASE 1
    2e-06  35%  3cy3A  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    2e-06  30%  3cqwA  [x.x.x] RAC-ALPHA SERINE/THREONINE-PROTEIN KINASE
    2e-06  30%  3cquA  [x.x.x] RAC-ALPHA SERINE/THREONINE-PROTEIN KINASE
    3e-06  33%  2wqeA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    3e-06  28%  2ozaB  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-06  31%  1o6lA  [d.144.1] RAC-BETA SERINE/THREONINE PROTEIN KINASE
    3e-06  31%  1o6kA  [d.144.1] RAC-BETA SERINE/THREONINE PROTEIN KINASE
    3e-06  31%  2jdoA  [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
    3e-06  28%  3igoA  [x.x.x] CALMODULIN-DOMAIN PROTEIN KINASE 1
    3e-06  32%  2hw7A  [x.x.x] MAP KINASE-INTERACTING SERINE/THREONINE-PROTEIN
    3e-06  28%  2gtnA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-06  30%  2gtmA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-06  34%  3f69B  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PKNB
    3e-06  33%  3efwB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    3e-06  33%  3efwA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    3e-06  31%  3e8dB  [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
    3e-06  31%  3e8dA  [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
    3e-06  31%  3e88A  [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
    3e-06  31%  3e87A  [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
    3e-06  31%  3d0eA  [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
    4e-06  49%  1zohA  [x.x.x] PROTEIN KINASE CK2, ALPHA SUBUNIT
    4e-06  30%  2zazA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    4e-06  33%  2wmxA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    4e-06  33%  2wmwA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    4e-06  33%  2wmvA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    4e-06  33%  2wmuA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    4e-06  33%  2wmtA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    4e-06  33%  2wmsA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    4e-06  30%  2rg6A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    4e-06  30%  2rg5A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    4e-06  33%  2r0uA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    4e-06  33%  2qhnA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    4e-06  49%  2qc6A  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    4e-06  49%  2pvkA  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    4e-06  49%  2pvjA  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    4e-06  49%  1om1A  [d.144.1] CASEIN KINASE II, ALPHA CHAIN
    4e-06  49%  1lp4A  [d.144.1] PROTEIN KINASE CK2
    4e-06  33%  3jvsA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    4e-06  33%  3jvrA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    4e-06  32%  3i79A  [x.x.x] CALMODULIN-DOMAIN PROTEIN KINASE 1
    4e-06  23%  2hz4C  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    4e-06  25%  2hz4B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    4e-06  25%  2hz4A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    4e-06  34%  3hx4A  [x.x.x] CALMODULIN-DOMAIN PROTEIN KINASE 1
    4e-06  29%  2hw6A  [x.x.x] MAP KINASE-INTERACTING SERINE/THREONINE-PROTEIN
    4e-06  30%  3hrbA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    4e-06  28%  3hp5A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    4e-06  33%  3h0zC  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    4e-06  30%  1gijA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    4e-06  24%  3g6hA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    4e-06  40%  2fumA  [x.x.x] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB
    4e-06  24%  1fpuB  [d.144.1] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL
    4e-06  29%  1fotA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE TYPE 1
    4e-06  49%  3fl5A  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    4e-06  33%  3f9nA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    4e-06  49%  1f0qA  [d.144.1] PROTEIN KINASE CK2, ALPHA SUBUNIT
    4e-06  29%  2duvA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-06  49%  1ds5A  [d.144.1] CASEIN KINASE, ALPHA CHAIN
    4e-06  26%  3clyA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    4e-06  30%  3cg2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    4e-06  33%  2c3jA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    4e-06  27%  2b55A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-06  34%  2ac5A  [x.x.x] MAP KINASE-INTERACTING SERINE/THREONINE KINASE 2
    5e-06  33%  2w1gA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    5e-06  33%  2w1fA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    5e-06  33%  2w1eA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    5e-06  33%  2w1dA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    5e-06  33%  2np8A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    5e-06  33%  1muoA  [d.144.1] AURORA-RELATED KINASE 1
    5e-06  33%  2j50A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    5e-06  23%  2hziB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    5e-06  23%  2hziA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    5e-06  23%  2hz0A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    5e-06  23%  2hyyC  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    5e-06  23%  2hyyA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    5e-06  23%  2hiwA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    5e-06  33%  3h10D  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    5e-06  33%  3h0zA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    5e-06  33%  3h0yA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    5e-06  30%  1gihA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    5e-06  23%  2g1tD  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    5e-06  23%  2g1tC  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    5e-06  23%  2g1tB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    5e-06  23%  2g1tA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    5e-06  33%  3fdnA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    5e-06  28%  1f5qC  [d.144.1] CYCLIN DEPENDENT KINASE 2
    5e-06  28%  3ezrA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-06  28%  3e93A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    5e-06  23%  3cs9D  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    5e-06  23%  3cs9A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    5e-06  32%  2clqA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 5
    5e-06  33%  2c6eB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    5e-06  33%  2c6eA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    5e-06  33%  2c6dA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    5e-06  29%  2btrA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-06  33%  2bmcF  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    5e-06  33%  2bmcC  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    5e-06  33%  2bmcB  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    5e-06  33%  2bmcA  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    7e-06  28%  1zz2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    7e-06  32%  2w5hA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE NEK2
    7e-06  23%  2v7aB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    7e-06  23%  2v7aA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    7e-06  30%  2uw4A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    7e-06  28%  1tvoA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    7e-06  35%  2qr8A  [x.x.x] RIBOSOMAL PROTEIN S6 KINASE ALPHA-3
    7e-06  22%  2og8B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    7e-06  24%  2ofvA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    7e-06  27%  1jsuA  [d.144.1] CYCLIN-DEPENDENT KINASE-2
    7e-06  28%  3hl7A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    7e-06  28%  3gcuA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    7e-06  25%  2g2fB  [x.x.x] ABL KINASE
    7e-06  28%  2fysA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    7e-06  28%  2fysB  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    7e-06  35%  3fv8A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    7e-06  28%  2fvdA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    7e-06  24%  3f6xD  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    7e-06  28%  3erkA  [x.x.x] EXTRACELLULAR REGULATED KINASE 2
    7e-06  28%  2erkA  [x.x.x] EXTRACELLULAR SIGNAL-REGULATED KINASE 2
    7e-06  28%  1erkA  [x.x.x] EXTRACELLULAR REGULATED KINASE 2
    7e-06  28%  2e14A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    7e-06  23%  3dqxB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    7e-06  28%  3c9wA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    7e-06  29%  2bakA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    9e-06  27%  2zoqA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 3
    9e-06  46%  2zjwA  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    9e-06  29%  2vwiB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    9e-06  28%  2vv9A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    9e-06  46%  2rkpA  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    9e-06  46%  2r7iD  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    9e-06  46%  2r7iC  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    9e-06  46%  2r7iB  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    9e-06  46%  2r7iA  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    9e-06  46%  2pvrA  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA, CATALYTIC
    9e-06  27%  1pmeA  [x.x.x] ERK2
    9e-06  46%  1pjkA  [d.144.1] CASEIN KINASE II, ALPHA CHAIN
    9e-06  29%  2ojiA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    9e-06  29%  2ojgA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    9e-06  37%  1o6yA  [d.144.1] PROBABLE SERINE/THREONINE-PROTEIN KINASE
    9e-06  46%  1na7A  [d.144.1] CASEIN KINASE II, ALPHA CHAIN
    9e-06  46%  1jwhB  [d.144.1] CASEIN KINASE II, ALPHA CHAIN
    9e-06  46%  1jwhA  [d.144.1] CASEIN KINASE II, ALPHA CHAIN
    9e-06  33%  2iwiB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PIM-2
    9e-06  30%  2ivtA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR
    9e-06  46%  3h30A  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    9e-06  32%  3gp0A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 11
    9e-06  28%  1golA  [x.x.x] EXTRACELLULAR REGULATED KINASE 2
    9e-06  37%  3ggfB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MST4
    9e-06  38%  3ggfA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MST4
    9e-06  23%  2g2iB  [x.x.x] ABL TYROSINE KINASE
    9e-06  23%  2g2iA  [x.x.x] ABL TYROSINE KINASE
    9e-06  23%  2g2hA  [x.x.x] ABL TYROSINE
    9e-06  23%  2g2fA  [x.x.x] ABL KINASE
    9e-06  23%  2f4jA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    9e-06  29%  3dakA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    9e-06  33%  3cohA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    9e-06  46%  3bw5A  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    9e-06  46%  3bqcA  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    1e-05  29%  1zyjA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-05  28%  2vttA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-05  31%  1ungA  [d.144.1] CELL DIVISION PROTEIN KINASE 5
    1e-05  29%  2r3nA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-05  25%  2pwlA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    1e-05  29%  1kv1A  [d.144.1] P38 MAP KINASE
    1e-05  29%  2j9mA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-05  31%  2iwiA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PIM-2
    1e-05  31%  2hw6B  [x.x.x] MAP KINASE-INTERACTING SERINE/THREONINE-PROTEIN
    1e-05  28%  2ghmA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-05  29%  3eb0C  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    1e-05  23%  3dqxA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-05  27%  3dlsF  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    1e-05  27%  3dlsE  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    1e-05  27%  3dlsD  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    1e-05  31%  3daeB  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    1e-05  27%  2btsA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-05  29%  1aq1A  [x.x.x] CYCLIN-DEPENDENT PROTEIN KINASE 2
    2e-05  28%  1yw2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-05  33%  2wntB  [x.x.x] RIBOSOMAL PROTEIN S6 KINASE
    2e-05  33%  2wntA  [x.x.x] RIBOSOMAL PROTEIN S6 KINASE
    2e-05  27%  2w05A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-05  27%  2vtqA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-05  32%  2qd9A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-05  29%  2pziB  [x.x.x] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNG
    2e-05  29%  2pziA  [x.x.x] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNG
    2e-05  27%  2psqA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    2e-05  31%  1oitA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    2e-05  30%  2ivvA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR
    2e-05  23%  2gqgB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-05  23%  2gqgA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-05  28%  3gcvA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-05  27%  1g5sA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    2e-05  29%  3eqrA  [x.x.x] ACTIVATED CDC42 KINASE 1
    2e-05  24%  3el8A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-05  31%  3eh9A  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 1
    2e-05  27%  3dlsB  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    2e-05  28%  3dakB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    2e-05  32%  3d14A  [x.x.x] SERINE/THREONINE KINASE 6
    2e-05  22%  3byuA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    2e-05  27%  2bheA  [d.144.1 (1dm2A)] CELL DIVISION PROTEIN KINASE 2
    2e-05  34%  2ac3A  [x.x.x] MAP KINASE-INTERACTING SERINE/THREONINE KINASE 2
    2e-05  29%  2vtnA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-05  28%  1r39A  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-05  28%  3hp2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-05  28%  3hllA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-05  30%  3ehaA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 1
    2e-05  27%  3dlsC  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    2e-05  28%  3c5uA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-05  28%  3bv3A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-05  30%  2bajA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-05  29%  1zxeD  [x.x.x] SERINE/THREONINE-PROTEIN KINASE
    3e-05  31%  2w7xA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK2
    3e-05  29%  1ua2A  [d.144.1] CELL DIVISION PROTEIN KINASE 7
    3e-05  29%  2r9sA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    3e-05  27%  2pwlB  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    3e-05  27%  2pkjA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-05  31%  2pk9A  [x.x.x] CYCLIN-DEPENDENT PROTEIN KINASE PHO85
    3e-05  38%  1mruB  [d.144.1] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB
    3e-05  38%  1mruA  [d.144.1] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB
    3e-05  30%  2ivuA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR
    3e-05  31%  3gqlB  [x.x.x] BASIC FIBROBLAST GROWTH FACTOR RECEPTOR 1
    3e-05  29%  3gcsA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-05  38%  2fumB  [x.x.x] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB
    3e-05  25%  3f6xC  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-05  29%  3eqiA  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE
    3e-05  29%  3eqfA  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE
    3e-05  25%  3en4B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-05  43%  2vwiA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    3e-05  28%  2vu3A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-05  27%  1r78A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-05  26%  2qg5D  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE
    3e-05  26%  2qg5B  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE
    3e-05  26%  2qg5A  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE
    3e-05  27%  2ptjA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-05  24%  2oiqA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-05  31%  2ivsB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR
    3e-05  28%  2gphA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    3e-05  24%  1fmkA  [x.x.x] TYROSINE-PROTEIN KINASE SRC
    3e-05  38%  3f69A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PKNB
    3e-05  26%  2f57B  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 7
    3e-05  26%  2f57A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 7
    3e-05  26%  3f3zA  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE WITH
    3e-05  27%  3dlsA  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    3e-05  29%  3dfaA  [x.x.x] CALCIUM-DEPENDENT PROTEIN KINASE CGD3_920
    3e-05  32%  2clqB  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 5
    3e-05  24%  2bdjA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-05  24%  2bdfB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-05  24%  2bdfA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    4e-05  28%  2zb1A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    4e-05  27%  2z7lA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    4e-05  28%  1q97B  [d.144.1] SR PROTEIN KINASE
    4e-05  28%  1q8zB  [d.144.1] SR PROTEIN KINASE
    4e-05  28%  1q8zA  [d.144.1] SR PROTEIN KINASE
    4e-05  28%  1q8yA  [d.144.1] SR PROTEIN KINASE
    4e-05  24%  2oiqB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    4e-05  30%  3k2lA  [x.x.x] DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-
    4e-05  28%  2jd5B  [x.x.x] SERINE/THREONINE-PROTEIN KINASE SKY1
    4e-05  28%  2jd5A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE SKY1
    4e-05  33%  2jbpJ  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    4e-05  28%  1howA  [d.144.1] SERINE/THREONINE-PROTEIN KINASE YMR216C
    4e-05  33%  3fi3A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    4e-05  26%  3f6xA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    4e-05  35%  3f61A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PKNB
    4e-05  28%  3eqpA  [x.x.x] ACTIVATED CDC42 KINASE 1
    4e-05  28%  3eqpB  [x.x.x] ACTIVATED CDC42 KINASE 1
    4e-05  26%  3el8B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    4e-05  24%  3d7tB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    6e-05  29%  2uv2A  [x.x.x] STE20-LIKE SERINE-THREONINE KINASE
    6e-05  27%  2q0nA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 4
    6e-05  33%  2pzyD  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    6e-05  47%  1pmqA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 10
    6e-05  27%  2j0iA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 4
    6e-05  23%  3hmiA  [x.x.x] TYROSINE-PROTEIN KINASE ABL2
    6e-05  27%  3gqlC  [x.x.x] BASIC FIBROBLAST GROWTH FACTOR RECEPTOR 1
    6e-05  27%  3gqlA  [x.x.x] BASIC FIBROBLAST GROWTH FACTOR RECEPTOR 1
    6e-05  23%  3g6hB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    6e-05  23%  2e2bB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-05  23%  2e2bA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-05  31%  3dj7A  [x.x.x] SERINE/THREONINE KINASE 6
    6e-05  31%  3dajA  [x.x.x] SERINE/THREONINE KINASE 6
    6e-05  31%  3d2iA  [x.x.x] SERINE/THREONINE KINASE 6
    6e-05  31%  3d15A  [x.x.x] SERINE/THREONINE KINASE 6
    6e-05  27%  3comB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 4
    6e-05  27%  3comA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 4
    8e-05  27%  2wipC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    8e-05  27%  2wipA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    8e-05  28%  2w9fB  [x.x.x] CELL DIVISION PROTEIN KINASE 4
    8e-05  31%  1unhA  [d.144.1] CYCLIN-DEPENDENT KINASE 5
    8e-05  31%  1u5qA  [d.144.1] SERINE/THREONINE PROTEIN KINASE TAO2
    8e-05  22%  2qkwB  [x.x.x] PROTEIN KINASE
    8e-05  30%  2p5aA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    8e-05  26%  1p4fA  [d.144.1] DEATH-ASSOCIATED PROTEIN KINASE 1
    8e-05  31%  1lufA  [d.144.1] MUSCLE-SPECIFIC TYROSINE KINASE RECEPTOR MUSK
    8e-05  31%  2j90A  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 3
    8e-05  30%  3gc0A  [x.x.x] KINASE, CMGC CDK
    8e-05  31%  3gbzA  [x.x.x] KINASE, CMGC CDK
    8e-05  24%  3en4A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    8e-05  30%  3dj5A  [x.x.x] SERINE/THREONINE KINASE 6
    8e-05  30%  3d2kA  [x.x.x] SERINE/THREONINE KINASE 6
    8e-05  30%  2baqA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-04  30%  1zwsA  [x.x.x] DAP-KINASE RELATED PROTEIN 1
    1e-04  30%  1wmkH  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    1e-04  30%  1wmkB  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    1e-04  30%  1wmkE  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    1e-04  30%  1wmkA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    1e-04  35%  2qr7A  [x.x.x] RIBOSOMAL PROTEIN S6 KINASE ALPHA-3
    1e-04  37%  2j90B  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 3
    1e-04  30%  3hyhA  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    1e-04  28%  3gqiA  [x.x.x] BASIC FIBROBLAST GROWTH FACTOR RECEPTOR 1
    1e-04  24%  3geqB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-04  24%  3geqA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-04  28%  3eqrB  [x.x.x] ACTIVATED CDC42 KINASE 1
    1e-04  23%  3en5B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-04  41%  3e3bX  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA'
    1e-04  30%  2ckeB  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    1e-04  30%  2ckeA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    1e-04  30%  2a2aB  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    1e-04  30%  2a2aA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    1e-04  30%  2a27A  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    1e-04  34%  2pzyC  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-04  34%  2pzyB  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-04  34%  2pzyA  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-04  29%  2pmiC  [x.x.x] CYCLIN-DEPENDENT PROTEIN KINASE PHO85
    1e-04  34%  2p3gX  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-04  34%  2ozaA  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-04  34%  2onlD  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-04  34%  2onlC  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-04  24%  2ofvB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    1e-04  34%  1kwpB  [d.144.1] MAP KINASE ACTIVATED PROTEIN KINASE 2
    1e-04  34%  1kwpA  [d.144.1] MAP KINASE ACTIVATED PROTEIN KINASE 2
    1e-04  24%  1k9aB  [b.34.2 - d.93.1 - d.144.1] CARBOXYL-TERMINAL SRC KINASE
    1e-04  34%  2jbpL  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-04  34%  2jbpK  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-04  34%  2jbpI  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-04  34%  2jbpH  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-04  34%  2jbpG  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-04  34%  2jbpF  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-04  34%  2jbpE  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-04  34%  2jbpD  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-04  34%  2jbpC  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-04  34%  2jbpB  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-04  34%  2jbpA  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-04  34%  2jboA  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-04  31%  3h4jA  [x.x.x] SNF1-LIKE PROTEIN KINASE SSP2
    1e-04  31%  3h4jB  [x.x.x] SNF1-LIKE PROTEIN KINASE SSP2
    1e-04  34%  3fpmA  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-04  27%  1zxeF  [x.x.x] SERINE/THREONINE-PROTEIN KINASE
    2e-04  27%  1wfcA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE P38
    2e-04  25%  1q3dB  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    2e-04  27%  2pv8A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-04  28%  2ptoA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-04  29%  2oicA  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    2e-04  28%  2nruB  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    2e-04  28%  2nruA  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    2e-04  27%  3ha8A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-04  30%  1h00A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    2e-04  27%  2gfsA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-04  29%  1g3nA  [d.144.1] CYCLIN-DEPENDENT KINASE 6
    2e-04  42%  3fi2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    2e-04  29%  2eufB  [x.x.x] CELL DIVISION PROTEIN KINASE 6
    2e-04  28%  3e8nA  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE
    2e-04  28%  3dy7A  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE
    2e-04  28%  3dv3A  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE
    2e-04  30%  3c4fA  [x.x.x] BASIC FIBROBLAST GROWTH FACTOR RECEPTOR 1
    2e-04  29%  1blxA  [d.144.1] CYCLIN-DEPENDENT KINASE 6
    2e-04  30%  1xo2B  [x.x.x] CELL DIVISION PROTEIN KINASE 6
    2e-04  29%  1urwA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    2e-04  28%  1u4dB  [d.144.1] ACTIVATED CDC42 KINASE 1
    2e-04  40%  1ny3A  [d.144.1] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-04  40%  1nxkD  [d.144.1] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-04  40%  1nxkC  [d.144.1] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-04  40%  1nxkB  [d.144.1] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-04  40%  1nxkA  [d.144.1] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-04  23%  1k9aE  [b.34.2 - d.93.1 - d.144.1] CARBOXYL-TERMINAL SRC KINASE
    2e-04  23%  1k9aD  [b.34.2 - d.93.1 - d.144.1] CARBOXYL-TERMINAL SRC KINASE
    2e-04  23%  1k9aA  [b.34.2 - d.93.1 - d.144.1] CARBOXYL-TERMINAL SRC KINASE
    3e-04  46%  2wajA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    3e-04  46%  1ukiA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 8 ISOFORM 4
    3e-04  28%  1u4dA  [d.144.1] ACTIVATED CDC42 KINASE 1
    3e-04  27%  2pmiA  [x.x.x] CYCLIN-DEPENDENT PROTEIN KINASE PHO85
    3e-04  46%  1pmuA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 10
    3e-04  25%  2ow3A  [x.x.x] GLYCOGEN SYNTHASE KINASE-3 BETA
    3e-04  46%  2o0uA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    3e-04  23%  1k9aF  [b.34.2 - d.93.1 - d.144.1] CARBOXYL-TERMINAL SRC KINASE
    3e-04  46%  2h96A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 8
    3e-04  46%  2gmxB  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 8
    3e-04  46%  2gmxA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 8
    3e-04  46%  2g01B  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 8
    3e-04  46%  2g01A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 8
    3e-04  36%  2fumD  [x.x.x] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB
    3e-04  28%  2fslX  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-04  23%  3f3wB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-04  23%  3f3wA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-04  46%  3e7oA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 9
    3e-04  46%  3da6A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    4e-04  25%  1ym7D  [x.x.x] BETA-ADRENERGIC RECEPTOR KINASE 1
    4e-04  25%  1ym7C  [x.x.x] BETA-ADRENERGIC RECEPTOR KINASE 1
    4e-04  25%  1ym7A  [x.x.x] BETA-ADRENERGIC RECEPTOR KINASE 1
    4e-04  28%  2w9zB  [x.x.x] CELL DIVISION PROTEIN KINASE 4
    4e-04  28%  2w99B  [x.x.x] CELL DIVISION PROTEIN KINASE 4
    4e-04  28%  2w96B  [x.x.x] CELL DIVISION PROTEIN KINASE 4
    4e-04  43%  2w0jA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK2
    4e-04  33%  1ungB  [d.144.1] CELL DIVISION PROTEIN KINASE 5
    4e-04  28%  1s9jA  [d.144.1] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN
    4e-04  26%  2qnjB  [x.x.x] MAP/MICROTUBULE AFFINITY-REGULATING KINASE 3
    4e-04  27%  2pv5A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    4e-04  25%  1omwA  [a.91.1 - d.144.1 - b.55.1] G-PROTEIN COUPLED RECEPTOR KINASE
    4e-04  28%  2oibD  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    4e-04  23%  1k9aC  [b.34.2 - d.93.1 - d.144.1] CARBOXYL-TERMINAL SRC KINASE
    4e-04  28%  2j0lA  [x.x.x] FOCAL ADHESION KINASE 1
    4e-04  27%  3hyhB  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    4e-04  23%  3g6gA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    4e-04  27%  3fc1X  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    4e-04  29%  2ewaA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    4e-04  28%  3eqcA  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE
    4e-04  43%  2cn8A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK2
    4e-04  25%  3cikA  [x.x.x] BETA-ADRENERGIC RECEPTOR KINASE 1
    4e-04  25%  2bcjA  [x.x.x] G-PROTEIN COUPLED RECEPTOR KINASE 2
    5e-04  26%  2w17A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-04  29%  2vrxB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 12-A
    5e-04  26%  1u54A  [d.144.1] ACTIVATED CDC42 KINASE 1
    5e-04  27%  1u46A  [d.144.1] ACTIVATED CDC42 KINASE 1
    5e-04  26%  2qi8A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    5e-04  28%  2nryD  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    5e-04  22%  3hgkC  [x.x.x] PROTEIN KINASE
    5e-04  22%  3hgkB  [x.x.x] PROTEIN KINASE
    5e-04  22%  3hgkA  [x.x.x] PROTEIN KINASE
    5e-04  26%  1gjoA  [d.144.1] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    5e-04  23%  3g6gB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    5e-04  27%  3famA  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    5e-04  24%  3f3uB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    5e-04  25%  2eu9A  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE CLK3
    5e-04  23%  3d7uD  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    5e-04  23%  3d7uB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    5e-04  23%  3d7uA  [x.x.x] TYROSINE-PROTEIN KINASE CSK
    5e-04  26%  2c30A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 6
    5e-04  33%  2b1pA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    6e-04  30%  2zm3B  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
    6e-04  27%  1u54B  [d.144.1] ACTIVATED CDC42 KINASE 1
    6e-04  28%  2pvfA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    6e-04  30%  2j0jA  [x.x.x] FOCAL ADHESION KINASE 1
    6e-04  28%  1fgiA  [d.144.1] FGF RECEPTOR 1
    8e-04  22%  1yomB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    8e-04  22%  1yomA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    8e-04  30%  2vgpA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 12-A
    8e-04  23%  1r0eA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    8e-04  38%  2qkrA  [x.x.x] CDC2-LIKE CDK2/CDC28 LIKE PROTEIN KINASE
    8e-04  23%  1pyxB  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    8e-04  23%  1pyxA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    8e-04  30%  2oj9A  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR PRECURSOR
    8e-04  31%  2oicD  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    8e-04  24%  1m17A  [d.144.1] EPIDERMAL GROWTH FACTOR RECEPTOR
    8e-04  24%  1m14A  [d.144.1] EPIDERMAL GROWTH FACTOR RECEPTOR
    8e-04  24%  2jiuB  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    8e-04  24%  2jiuA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    8e-04  24%  2jitB  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    8e-04  24%  2jitA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    8e-04  24%  2j6mA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    8e-04  24%  2itwA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    8e-04  36%  2i6lA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 6
    8e-04  22%  1i09A  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    8e-04  28%  2fsmX  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    8e-04  29%  2cl1A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE NEK2
    8e-04  26%  2cdzA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 4
    8e-04  30%  2bfxB  [x.x.x] LOC398457 PROTEIN
:305

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxELVQLPVGSECGKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEV
1ckjB           -------MELRVGN---RYRLGRKIGSGSFGDIYLGTDIAAGE-EVAIKLECVKTKHPQLHIESKIYKMM
1ckjA           -------MELRVGN---RYRLGRKIGSGSFGDIYLGTDIAAGE-EVAIKLECVKTKHPQLHIESKIYKMM
1ckiB           -------MELRVGN---RYRLGRKIGSGSFGDIYLGTDIAAGE-EVAIKLECVKTKHPQLHIESKIYKMM
1ckiA           -------MELRVGN---RYRLGRKIGSGSFGDIYLGTDIAAGE-EVAIKLECVKTKHPQLHIESKIYKMM
2cmwA           ----------------------KKIGCGNFGELRL--GKNLYTNEYAIKLEPIKSRAPQLHLEY------
1csnA           ----------------------------------------------------------------------
2c47B           ----------------------------------------------------------------------
2c47A           ----------------------------------------------------------------------
2c47C           ----------------------------------------------------------------------
2c47D           ----------------------------------------------------------------------
2chlA           ----------------------KKIGCGNFGELRL--GKNLYTNEYAIKLEPMKSRAPQLHLEY------
2izuA           ---------------------------------------------------------------VAIKLEP
2iztA           ---------------------------------------------------------------VAIKLEP
2izrA           ---------------------------------------------------------------VAIKLEP
2v62B           --------------EGNQWVLGKKIG-----LIYLAFPTNKPEKDHVVKVEYQEGPLSELKFYQRVAKKD
2v62A           --------------EGNQWVLGKKI------LIYLAFPTNKPEKDHVVKVEYQEGPLSELKFYQRVAKKD
2jamB           ---------------------MEVLGSGAFSEVFLVKQRLTGKL-FALKCIKKSS----LENEIAVLKKI
2jamA           ---------------------MEVLGSGAFSEVFLVKQRLTGKL-FALKCIKKSS----LENEIAVLKKI
3hrfA           ----------------------KILGEGSFSTVVLARELATSR-EYAIKILEKRHIIKENKVPYVTRERD
3dbqA           ------------------YSILKQIGSGGSSKVFQVLNEKKQAIKYVNLEEADNQTLDSYRNEIAYLLQQ
2zmcA           ------------------YSILKQIGSGGSSKVFQVLNEKKQAIKYVNLEEADNQTLDSYRNEIAYLLQQ
2vd5B           --------------------ILKVIGRGAFSEVAVVKMKQTGQV-YAMKIMNKWDMLK--RGEVSCFREE
2vd5A           --------------------ILKVIGRGAFSEVAVVKMKQTGQV-YAMKIMNKWDMLK--RGEVSCFREE
1qcfA           ----------------------KKLGAGQFGEVWMATYNKHTKV--AVKMKPGSMSVEAFLAEANVMKTL
3h9fA           ------------------YSILKQIGSGGSSKVFQVLNEKKQAIKYVNLEEADNQTLDSYRNEIAYLLQQ
3gfwA           ------------------YSILKQIGSGGSSKVFQVLNEKKQAIKYVNLEEADNQTLDSYRNEIAYLLQQ
1kobA           -------VEVKQGSVYDYYDILEELGSGAFGVVHRCVEKATGRV-FVAKFINTPYPLDTVKNEISIMNQL
3cekA           ------------------YSILKQIGSGGSSKVFQVLNEKKQAIKYVNLEEADNQTLDSYRNEIAYLLQQ
3blhA           -------VECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVEKEGFPITALR-EIKILQLL
3hztA           ---------------------VKKLGSGAYGEVLLCKDK-LTGAERAIKIIKKSSVTGALLDEVAVLKQL
2zmdA           ------------------YSILKQIGSGGSSKVFQVLNEKKQAIKYVNLEEADNQTLDSYRNEIAYLLQQ
1qpjA           --------------------LVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLA-EANLMKQL
1qpcA           --------------------LVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLA-EANLMKQL
2ofuA           --------------------LVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLA-EANLMKQL
3hrcA           ----------------------KILGEGSFSTVVLARELATSR-EYAIKILEKRHIIKENKVPYVTRERD
1h1wA           ----------------------KILGEGSFSTVVLARELATSR-EYAIKILEKRHIIKENKVPYVTRERD
3bymA           --------------------LVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLA-EANLMKQL
2biyA           ----------------------KILGEGSFSTVVLARELATSR-EYAIKILEKRHIIKENKVPYVTRERD
1zydA           ------------------------LGQGAFGQVVKARNALDSRYYAIKKIRHTEEKLSTILSEVMLLASL
1zycC           ------------------------LGQGAFGQVVKARNALDSRYYAIKKIRHTEEKLSTILSEVMLLASL
1zycB           ------------------------LGQGAFGQV-VKARNALDSRYYAIKKIRHTEKLSTILSEVMLLASL
1u7eA           ---------------------IKTLGTGSFGRVMLVKHKESGN-HYAMKILDKQKVVKLKQIE-HTLNEK
3fhiA           ---------------------IKTLGTGSFGRVMLVKHKESGN-HYAMKILDKQKVVKLKQIE-HTLNEK
1zydB           ------------------------LGQGAFGQVVKARNALDSRYYAIKKIRHTEEKLSTILSEVMLLASL
1zycA           ------------------------LGQGAFGQVVKARNALDSRYYAIKKIRHTEEKLSTILSEVMLLASL
1yhwA           -----------VGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIRQMNLQQQPKKLIINEILVMREN
1yhvA           -----------VGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIRQMNLQQQPKKLIINEILVMREN
2pl0A           --------------------LVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLA-EANLMKQL
2of2A           --------------------LVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLA-EANLMKQL
1zy4A           ------------------------LGQGAFGQVVKARNALDSRYYAIKKIRHTEEKLSTILSEVMLLASL
1rejA           ---------------------IKTLGTGSFGRVMLVKHKESGN-HYAMKILDKQKVVKLKQIE-HTLNEK
1rdqE           ---------------------IKTLGTGSFGRVMLVKHKESGN-HYAMKILDKQKVVKLKQIE-HTLNEK
2qvsE           ---------------------IKTLGTGSFGRVMLVKHKESGN-HYAMKILDKQKVVKLKQIE-HTLNEK
2qurA           ---------------------IKTLGTGSFGRVMLVKHKESGN-HYAMKILDKQKVVKLKQIE-HTLNEK
1jbpE           ---------------------IKTLGTGSFGRVMLVKHKESGN-HYAMKILDKQKVVKLKQIE-HTLNEK
3idbA           ---------------------IKTLGTGSFGRVMLVKHKESGN-HYAMKILDKQKVVKLKQIE-HTLNEK
2hk5A           ----------------------KKLGAGQFGEVWMATYNKHTKV--AVKMKPGSMSVEAFLAEANVMKTL
2gu8A           ---------------------IKTLGTGSFGRVMLVKHKESGN-HYAMKILDKQKVVKLKQIE-HTLNEK
3fxzA           -----------VGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIRQMNLQQQPKKLIINEILVMREN
1fmoE           ---------------------IKTLGTGSFGRVMLVKHKESGN-HYAMKILDKQKVVKLKQIE-HTLNEK
3fjqE           ---------------------IKTLGTGSFGRVMLVKHKESGN-HYAMKILDKQKVVKLKQIE-HTLNEK
3e7eA           ------------------------LGEGAFAQVYEATQN---KQKFVLKVQKPANPIGTQLME---RLKP
1bkxA           ---------------------IKTLGTGSFGRVMLVKHKESGN-HYAMKILDKQKVVKLKQIE-HTLNEK
1uu7A           ----------------------KILGEGSFSTVVLARELATSR-EYAIKILEKRHIIKENKVPYVTRERD
2jiiB           ----------------------------------------------------------------------
2jiiA           ----------------------------------------------------------------------
3idpA           ----------------GQITVGQRIGSGSFGTVY----KGKWHGDVAVKMLNVTAPLQAFKNEVGVLRKT
2dq7X           --------------------LIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLE-EAQIMKKL
1zycD           ------------------------LGQGAFGQVVKARNALDSRYYAIKKIRHTEEKLSTILSEVMLLASL
2z7qA           --------------------LLKVLGQGSFGKVFLVRKVTRP------------DSGHLYAMKVLILADV
1unlA           -----------------KYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVALREICLLKEL
1sykB           ---------------------IKTLGTGSFGRVMLVKHKESGN-HYAMKILDKQKVVKLKQIE-HTLNEK
1sykA           ---------------------IKTLGTGSFGRVMLVKHKESGN-HYAMKILDKQKVVKLKQIE-HTLNEK
1j3hB           ---------------------IKTLGTGSFGRVMLVKHKESGN-HYAMKILDKQKVVKLKQIE-HTLNEK
1j3hA           ---------------------IKTLGTGSFGRVMLVKHKESGN-HYAMKILDKQKVVKLKQIE-HTLNEK
2wmqA           ------------------WDLVQTLGEGAYGEVQLAVNRV---TEEAVAVKIVDN----IKKEICINKML
1wccA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRTEGVPSTAIR-EISLLKEL
1hckA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRTEGVPSTAIR-EISLLKEL
1apmE           ---------------------IKTLGTGSFGRVMLVKHKESGN-HYAMKILDKQKVVKLKQIE-HTLNEK
2jc6C           ------------------------LGTGAFSEVVLAEEKATGKL-FAVKCIPKK---ASIENEIAVLRKI
2jc6A           ------------------------LGTGAFSEVVLAEEKATGKL---FAVKCIPKKASSIENEIAVLRKI
2iw9A           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLEGVPSTAIR-EISLLKEL
3fz1A           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRVPSTAI----REISLLKEL
3eidC           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLEGVPSTAIR-EISLLKEL
1ctpE           ---------------------IKTLGTGSFGRVMLVKHKETGN-HFAMKILDKQKVVKLKQIE-HTLNEK
1cmkE           ---------------------IKTLGTGSFGRVMLVKHKETGN-HFAMKILDKQKVVKLKQIE-HTLNEK
1cdkA           ---------------------IKTLGTGSFGRVMLVKHKETGN-HFAMKILDKQKVVKLKQIE-HTLNEK
3b2wA           --------------------LVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLA-EANLMKQL
2qcsA           ---------------------IKTLGTGSFGRVMLVKHKESGN-HYAMKILDKQKVVKLKQIE-HTLNEK
1l3rE           ---------------------IKTLGTGSFGRVMLVKHKESGN-HYAMKILDKQKVVKLKQIE-HTLNEK
2cpkE           ---------------------IKTLGTGSFGRVMLVKHKESGN-HYAMKILDKQKVVKLKQIE-HTLNEK
2z7rA           --------------------LLKVLGQGSFGKVFLVRKVTRPDSGYAMKV--------LKKATLKVILAD
1ydrE           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
1xh8A           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
1xh6A           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
2uztA           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
1stcE           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
1q8uA           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
1q8tA           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
1ia8A           ------------------WDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRCPENI-KKEICINKML
3hkoA           -----------------KYHLKGAIGQGSYGVVRVAIENQTRAIR-AIKIKIRQKDVERIKTEVRLMKKL
3gc9B           ---------------------LRPVGSGAYGSVYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHL
2f7xE           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
1f3mC           -----------VGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIRQMNLQQQPKKLIINEILVMREN
3e8eI           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
3e8cE           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
3e8cB           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
3dneA           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
3dndA           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
2cgxA           ------------------WDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRCPENI-KKEICINKML
2cgvA           ------------------WDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRCPENI-KKEICINKML
2cguA           ------------------WDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRCPENI-KKEICINKML
2c3kA           ------------------WDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRCPENI-KKEICINKML
2c1aA           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
2brnA           ------------------WDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRCPENI-KKEICINKML
2b9fA           ------------------------LGEGAYGVVCSATHKPTGEIVAIKKIEPFDKPLFALRTEIKILKHF
1zy5B           ------------------------LGQGAFGQVVKARNALDSRYYAIKKIRHTEEKLSTILSEVMLLASL
1zy4B           ------------------------LGQGAFGQVVKARNALDSRYYAIKKIRHTEEKLSTILSEVMLLASL
1uwjB           ----------------GQITVGQRIGSGSFGTVY----KGKWHGDVAVKMLNVTAPLQAFKNEVGVLRKT
1okyA           ----------------------KILGEGSFSTVVLARELATSR-EYAIKILEKRHIIKENKVPYVTRERD
3gc8B           ---------------------LRPVGSGAYGSVYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHL
3gc8A           ---------------------LRPVGSGAYGSVYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHL
2cgwA           ------------------WDLVQTLGEGAYGEVQLAVNRVTEEA-VAVKIVDMKRPENI-KKEICINKML
2z7sA           --------------------LLKVLGQGSFGKVFLVRKVTRPDSGYAMKV-------------LKILADV
1smhA           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKEIE-HTLNEK
2iw8C           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
2iw8A           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
2gdoA           ------------------WDLVQTLGEGAYGEVQLAVNRVTEEA-VAVKIVDMKCPENI-KKEICINKML
2fa2B           ------------------------LGEGAYGVVCSATHKPTGEIVAIKKIEPFDKPLFALRTEIKILKHF
2fa2A           ------------------------LGEGAYGVVCSATHKPTGEIVAIKKIEPFDKPLFALRTEIKILKHF
2f49A           ------------------------LGEGAYGVVCSATHKPTGEIVAIKKIEPFDKPLFALRTEIKILKHF
3blrA           -------VECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVEKEGFPITALR-EIKILQLL
3blqA           -------VECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVEKEGFPITALR-EIKILQLL
2b9hA           ------------------------LGEGAYGVVCSATHKPTGEIVAIKKIEPFDKPLFALRTEIKILKHF
1zysA           ------------------WDLVQTLGEGAYGEVQLAVNREEAVAVKIVDMKRAVDCPENIKKEICINAML
1ykrA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
1xh9A           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKEIE-HTLNEK
1w98A           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
2vz6B           ------------------YQLFEELGKGAFSVVVLAGQEYAAKIINTKKLSARDHQK--LEREARICRLL
1vywC           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
1vywA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
1v0bA           -----------------KYHGLEKIGEGTYGVVYK-AQNNYGETFALKKIRLEKEDEGIPSTEISILKEL
1uwjA           ----------------GQITVGQRIGSGSFGTVY----KGKWHGDVAVKMLNVTAPLQAFKNEVGVLRKT
1okvC           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
1okvA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
1oiuC           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
1oguC           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
1ob3A           -----------------KYHGLEKIGEGTYGVVYK-AQNNYGETFALKKIRLEKEDEGIPSTEISILKEL
1nvrA           ------------------WDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKN-----IKKEICINKML
1jstA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
2jgzA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
2iw9C           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
2iw6C           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
2hogA           ------------------WDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKN-----IKKEICINKML
1h27C           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
1h26C           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
1h25C           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
1h24A           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
1h08A           ---------------------VEKIGEGTYGVVYKARNKLTGEV-VALKKIVPSTAI----REISLLKEL
2gnlA           ---------------------IKTIGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
2gnjA           ---------------------IKTIGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
2g9xC           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
2g9xA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
2f9gA           ------------------------LGEGAYGVVCSATHKPTGEIVAIKKIEPFDKPLFALRTEIKILKHF
3f5xA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
1e9hA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
3dqwD           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
3dqwC           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
3dqwA           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
3dogC           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
3ddqC           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
2cchA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
2c4gC           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
2c4gA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
2brmA           ------------------WDLVQTLGEGAYGEVQLAVNRV---TEEAVAVKIVDMCPENIKKEICINKML
2brhA           ------------------WDLVQTLGEGAYGEVQLAVNRV---TEEAVAVKIVDN----IKKEICINKML
2bkzC           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
3bhuC           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
3bhtC           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
2b9iA           ------------------------LGEGAYGVVCSATHKPTGEIVAIKKIEPFDKPLFALRTEIKILKHF
2zvaA           --------------------LVKKLGAGQFGEVWMGYYNNSTKV--AVKTLKPGTMSVQAFLEEANLMKT
1uwhA           ----------------GQITVGQRIGSGSFGTVY----KGKWHGDVAVKMLNVTAPLQAFKNEVGVLRKT
1qpdA           --------------------LVERLGAGQAGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLA-EANLMKQL
1q62A           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
1q24A           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
2e9nA           ------------------WDLVQTLGEGAYGEVQLAVNREEAVAVKIVDMKRAVDCPENIKKEICINKML
3d4qA           ----------------GQITVGQRIGSGSFGTVY----KGKWHGDVAVKMLNVTAPLQAFKNEVGVLRKT
2c3lA           ------------------WDLVQTLGEGAYGEVQLAVNRV---TEEAVAVKIVD--MKRIKKEICINKML
2aypA           ------------------WDLVQTLGEGAYGEVQLAVNREEAVAVKIVDMKRAVDCPENIKKEICINKML
1ad5A           ----------------------KKLGAGQFGEVWMATYNKHTKV--AVKMKPGSMSVEAFLAEANVMKTL
2w06A           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRVPSTAI----REISLLKEL
2vtoA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRVPSTAI----REISLLKEL
2vo0A           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIEHTLILQA
1v0oA           -----------------KYHGLEKIGEGTYGVVY------KAQNNYGETFALKKIRLSTTIREISILKEL
2uvxA           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIEHTLILQA
1uu8A           ----------------------KILGEGSFSTVVLARELATSR-EYAIKILEKRHIIKENKVPYVTRERD
2r5tA           ---------------------LKVIGKGSFGKVLLARHKAE-EVFYAVKV--------LQKKAILVLLKV
1q61A           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
1oi9A           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIETEGVPSTAIR-EISLLKEL
1ke6A           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRVPSTAI----REISLLKEL
1jvpP           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRVPSTAI----REISLLKEL
2jdtA           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIEHTLILQA
3hdnA           ---------------------LKVIGKGSFGKVLLARHKAE-EVFYAVKV--------LQKKAILVLLKV
3hdmA           ---------------------LKVIGKGSFGKVLLARHKAE-EVFYAVKV--------LQKKAILVLLKV
1h0wA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRVPSTAI----REISLLKEL
1h0vA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRVPSTAI----REISLLKEL
1h0uA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRVPSTAI----REISLLKEL
1gz8A           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRVPSTAI----REISLLKEL
1fvtA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRVPSTAI----REISLLKEL
3fbvI           -------------------------------------------------------------MEIKLLTES
3fbvD           -------------------------------------------------------------MEIKLLTES
3fbvA           -------------------------------------------------------------MEIKLLTES
3dogA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIETEGVPSTAIR-EISLLKEL
2b52A           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRTEGVPSTAIR-EISLLKEL
1y91A           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLPSTAI----REISLLKEL
1y57A           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
1xh7A           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
2welA           -----------------EYQLFEELGKGAFSVVRRC-MKIPTGQEYAAKIKLSARDHQKLEREARICRLL
2vn9A           -----------------EYQLFEELGKGAFSVVRRC-MKIPTGQEYAAKIKLSARDHQKLEREARICRLL
2srcA           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
1q8wA           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
1oiyA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLTEGVPSTAIREISLLKEL
1oguA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLTEGVPSTAIREISLLKEL
2iw6A           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLTEGVPSTAIREISLLKEL
2i40A           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLTEGVPSTAIREISLLKEL
3h9oA           ----------------------KILGEGSFSTVVLARELATSR-EYAIKILEKRHIIKENKVPYVTRERD
2h8hA           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
3gc9A           ---------------------LRPVGSGAYGSVYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHL
2fb8A           ----------------GQITVGQRIGSGSFGTVY----KGKWHGDVAVKMLNVTAPLQAFKNEVGVLRKT
1f3mD           -----------VGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIRQMNLQQQPKKLIINEILVMREN
3eocC           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLTEGVPSTAIREISLLKEL
3ej1C           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLTEGVPSTAIREISLLKEL
3ej1A           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLTEGVPSTAIREISLLKEL
3eidA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLTEGVPSTAIREISLLKEL
3dxnA           ---------------------VKKLG--SYGEVLLC--KDKTGAERAIKIIKKSSVTGALLDEVAVLKQL
3ddqA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTEGVPSTAIEISLLKEL
3bwjA           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
1buhA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTTAI----REISLLKEL
3bhtA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTEGVPSTAIEISLLKEL
1zxeC           ------------------------LGQGAFGQVVKARNALDSRYYAIKKIRHTEEKLSTILSEV--LLAS
1uu9A           ----------------------KILGEGSFSTVVLARELATSR-EYAIKILEKRHIIKENKVPYVTRERD
1okzA           ----------------------KILGEGSFSTVVLARELATSR-EYAIKILEKRHIIKENKVPYVTRERD
3e5aA           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
3dk6A           -------------------TMKHKLGQ--FGEVY-----EGVWKKYSLTVAVKTLEVEEFLKEAAVMKEI
2c5yA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIGVPSTAI----REISLLKEL
1z5mA           ----------------------KILGEGSFSTVVLARELATSR-EYAIKILEKRHIIKENKVPYVTRERD
1v0oB           -----------------KYHGLEKIGEGTYGVVYKAQNNYGET--FALK------KIRLTIREISILKEL
1v0bB           -----------------KYHGLEKIGEGTYGVVY------KAQNNYG-----ETFALKKIIREISILKEL
1uu3A           ----------------------KILGEGSFSTVVLARELATSR-EYAIKILEKRHIIKENKVPYVTRERD
2r7bA           ----------------------KILGEGSFSTVVLARELATSR-EYAIKILEKRHIIKENKVPYVTRERD
1kswA           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
2jfmA           ------------------WEIIGELGDGAFGKVYKAQNKETSVLAAAKVIDTKSEELEDYMVEIDILASC
2jflA           ------------------WEIIGELGDGAFGKVYKAQNKETSVLAAAKVIDTKSEELEDYMVEIDILASC
2j51A           ------------------WEIIGELGDGAFGKVYKAQNKETSVLAAAKVIDTKSEELEDYMVEIDILASC
2gngA           ---------------------IKTIGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
2gnfA           ---------------------IKTIGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
3c4cB           ----------------GQITVGQRIGSGSFGTVY----KGKWHGDVAVKMLNVTAPLQAFKNEVGVLRKT
3c4cA           ----------------GQITVGQRIGSGSFGTVY----KGKWHGDVAVKMLNVTAPLQAFKNEVGVLRKT
2zv7A           --------------------LVKKLGAGQFGEVWMGYYNNSTKV--AVKTLKPGTMSVQAFLEEANLMKT
3idpB           ----------------GQITVGQRIGSGSFGTVY----KGKWHGDVAVKMLNVTAPLQAFKNEVGVLRKT
2c0tB           ----------------------KKLGAGQFGEVWMATYNKHTKV--AVKMKPGSMSVEAFLAEANVMKTL
2c0tA           ----------------------KKLGAGQFGEVWMATYNKHTKV--AVKMKPGSMSVEAFLAEANVMKTL
2c0iA           ----------------------KKLGAGQFGEVWMATYNKHTKV--AVKMKPGSMSVEAFLAEANVMKTL
1yxsA           ------------------------LGSGGFGSVYS-GIRVSDNLPVAIK-HVEKDRIGELPNGTRVPMEV
2w4oA           -----------------------ELGRGATSIVYRCKQKGTQK-PYALKV---------LK-KIGVLLRL
1h07A           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRVPSTAI----REISLLKEL
1h01A           ---------------------VEKIGEGTYGVVYKARNKLTGEV-VALKIRSTAI------REISLLKEL
1a06A           ------------------------LGTGAFSEVILAEDKRTQKL-VAIKCIAKEN-------EIAVLHKI
2wmrA           ------------------WDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMN------IKKEICINKML
2vtpA           ---------------------VEKIGEGTYGVVYKARNKLTGEV-VALKKIVPSTAI----REISLLKEL
2vtiA           ---------------------VEKIGEGTYGVVYKARNKLTGEV-VALKKIVPSTAI----REISLLKEL
2vo6A           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIEHTLILQA
2uvzA           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIEHTLILQA
2uvyA           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIEHTLILQA
1szmB           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
1szmA           ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
2r3iA           ---------------------VEKIGEGTYGVVYKARNKLTGEV-VALKKIVPSTAI----REISLLKEL
2okrD           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
3ig7A           ---------------------VEKIGEGTYGVVYKARNKLTGEV-VALKKIVPSTAI----REISLLKEL
1giiA           ---------------------VEKIGEGTYGVVYKARNKLTGEV-VALKKIVPSTAI----REISLLKEL
1e1vA           ---------------------VEKIGEGTYGVVYKARNKLTGEV-VALKKIVPSTAI----REISLLKEL
2ds1A           ---------------------VEKIGEGTYGVVYKARNKLTGEV-VALKKIVPSTAI----REISLLKEL
3dakD           ---------LPWSINRDDYELQEVIGSGATAVVYCAPKKEKVAIKRINLEKCQTSMDELLK-EIQAMSQC
3ctqA           ---------------------LSPVGSGAYGSVCAAFDT---KTGHRVAVKKLSRPFQSIYRELRLLKHM
2clxA           ---------------------VEKIGEGTYGVVYKARNKLTGEV-VALKKIRLGVPSTAIR-EISLLKEL
1ckpA           ---------------------VEKIGEGTYGVVYKARNKLTGEV-VALKKIVPSTAI----REISLLKEL
1zxeA           ------------------------LGQGAFGQVVKARNALDSRYYAIKKIRHTEEKLSTILSEV--LLAS
1vyzA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKITAIR--------EISLLKEL
2vtsA           ---------------------VEKIGEGTYGVVYKARNKLTGEV-VALKKIRPSTAI----REISLLKEL
2vtrA           ---------------------VEKIGEGTYGVVYKARNKLTGEV-VALKKIRPSTAI----REISLLKEL
2vthA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRSTAI------REISLLKEL
2rioA           -------------------------------------------------------------MEIKLLTES
2r3qA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKITAIR--------EISLLKEL
1oirA           ---------------------VEKIGEGTYGVVYKARNKLTGEV-VALKIRLTAI------REISLLKEL
1jsvA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKITAIR--------EISLLKEL
2j2iB           ------------------------LGSGGFGSVYS-GIRVSDNLPVAIK-HVEKDRIGELPNGTRVPMEV
3h10B           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
3h10A           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
2c3iB           ------------------------LGSGGFGSVYS-GIRVSDNLPVAIK-HVEKDRISDWGEGTRVPMEV
2bzhB           ------------------------LGSGGFGSVYS-GIRVSDNLPVAIK-HVEKDRIGELPNGTRVPMEV
2bilB           ------------------------LGSGGFGSVYS-GIRVSDNLPVAIK-HVEKDRIGELPNGTRVPMEV
1ywvA           ------------------------LGSGGFGSVYS-GIRVSDNLPVAIK-HVEKDRIGELPNGTRVPMEV
1xwsA           ------------------------LGSGGFGSVYS-GIRVSDNLPVAIK-HVEKDRIGELPNGTRVPMEV
1xqzA           ------------------------LGSGGFGSVYS-GIRVSDNLPVAIK-HVEKDRIGELPNGTRVPMEV
2v7oA           ------------------YQLFEELGKGF--SVVRRCVKKTPTQEYAAKIKLSARDHQKLEREARICRLL
2v55C           ------------------YEVVKVIGRGAFGEVQLVRHKSTRKV-YAMKLLSKFEMISAFFWEERDIMAF
2v55A           ------------------YEVVKVIGRGAFGEVQLVRHKSTRKV-YAMKLLSKFEMISAFFWEERDIMAF
2uznA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIPSTAI------REISLLKEL
2r3hA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIPSTAI------REISLLKEL
1lezA           ---------------------LSPVGSGAYGSVCAAFDT---KTGHRVAVKKLSRPFQSIYRELRLLKHM
2etkB           ------------------YEVVKVIGRGAFGEVQLVRHKSTRKV-YAMKLLSKFEMISAFFWEERDIMAF
2etkA           ------------------YEVVKVIGRGAFGEVQLVRHKSTRKV-YAMKLLSKFEMISAFFWEERDIMAF
1di8A           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRGV--PSTAIR-EISLLKEL
3d83A           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
1cm8A           ----------------------------------------------------------------------
3c4eC           ------------------------LGSGGFGSVYS-GIRVSDNLPVAIK-HVEKDRIGELPNGTRVPMEV
3bhhD           -----------------------------------------------------------LEREARICRLL
3bhhC           -----------------------------------------------------------LEREARICRLL
3bhhB           -----------------------------------------------------------LEREARICRLL
3bhhA           -----------------------------------------------------------LEREARICRLL
2bfyB           --------------------IVRPLGKGKFGNVYLAREKQN-KFIMALKVKSQLEKEGVLRREIEIQSHL
2bfyA           --------------------IVRPLGKGKFGNVYLAREKQN-KFIMALKVKSQLEKEGVLRREIEIQSHL
1yi6A           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
2rioB           -------------------------------------------------------------MEIKLLTES
2r3lA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRVPSTAI----REISLLKEL
1lewA           ---------------------LSPVGSGAYGSVCAAFDT---KTGHRVAVKKLSRPFQSIYRELRLLKHM
2ivsA           ----------------------KTLGEGEFGKVVKATAFHKGRAGYTLKENASPSELRDLLSEFNVLKQV
2c6iA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLV--PSTAIR-EISLLKEL
2c68A           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLV--PSTAIR-EISLLKEL
2a4lA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIAIR---------EISLLKEL
2zv9A           --------------------LVKKLGAGQFGEVWMGYYNNSTKV--AVKTLKPGTMSVQAFLEEANLMKT
2r3jA           ---------------------VEKIGEGTYGVVYKARNKLTGEV-VALKKIVPSTAI----REISLLKEL
2objA           ------------------------LGSGGFGSVYS-GIRVSDNLPVAIK-HVEKDRIGELPNGTRVPMEV
1ob3B           -----------------KYHGLEKIGEGTYGVVYKAQNNYGET--FALK------PSTTIR-EISILKEL
2ghlA           ---------------------LSPVGSGAYGSVCAAFDT---KTGHRVAVKKLSRPFQSIYRELRLLKHM
2fh9A           ------------GAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQ-KVALKI---INKKGRIEREISYLRLL
3f2aA           ------------------------LGSGGFGSVYS-GIRVSDNLPVAIK-HVEKDRIGELPNGTRVPMEV
3dcvA           ------------------------LGSGGFGSVYS-GIRVSDNLPVAIK-HVEKDRIGELPNGTRVPMEV
1bmkA           ---------------------LSPVGSGAYGSVCAAFDT---KTGHRVAVKKLSRPFQSIYRELRLLKHM
2bikB           ------------------------LGSGGFGSVYS-GIRVSDNLPVAIK-HVEKDRIGELPNGTRVPMEV
2z60A           --------------------------------------------------------------EAAVMKEI
1ywrA           ---------------------LSPVGSGAYGSVCAAFDT---KTGHRVAVKKLSRPFQSIYRELRLLKHM
2weiA           ------------GTFAERYNIVCMLGKGSFGEV-LKCKDRITQQEYAVKVSAKNKDTSTILREVELLKKL
2r3kA           ---------------------VEKIGEGTYGVVYKARNKLTGEV-VALKKIVPSTAI----REISLLKEL
1mq4A           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
1h4lA           --------------------------EKIYGTVFKAKNRETHEIVALKRVRLDGVPSSALR-EICLLKEL
3gc7A           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
3dk6B           --------------------------------------------KYSLTVAVKTLEVEEFLKEAAVMKEI
3cy2A           ----------------------------------------------------------------------
3cxwA           ----------------------------------------------------------------------
3coiA           ------------------------VGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRELLLLKHM
2bzkB           ----------------------------------------------------------------------
3bgzA           ------------------------LGSGGFGSVYSVSDNLPVAIKHVEK-DRISDWGERVPMEVVLL---
2bdwB           ------------------YDVKEELGKGAFSVVRRCVHKTTG-LEFAAKIKLSARDFQKLEREARICRKL
2bdwA           ------------------YDVKEELGKGAFSVVRRCVHKTTG-LEFAAKIKLSARDFQKLEREARICRKL
2vtjA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRSTAI------REISLLKEL
2qohB           -----------------------------------------------LKMEVEE----FLK-EAAVMKEI
2puuA           --------------------------------------------------------------ELRLLKHM
1ol7A           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
1ol5A           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
3ha6A           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
3gcqA           --------------------------------------------------------------ELRLLKHM
3gcpA           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
3dk3B           --------------------------------------------------------------EAAVMKEI
3dk3A           --------------------------------------------------------------EAAVMKEI
3d5vA           ------------------------LGKGGFAKCYEITDMDTKEV-FAGKVVPKSMLHQKEKMEIAIHKSL
2brgA           ------------------WDLVQTLGEGAYGEVQLAVNRVTEEA-VAVKIVDMXXXXXXXXXXXXMLNHE
1zxeE           ------------------------LGQGAFGQVVKARNALDSRYYAIKKIRHTEEKLSTILSEV--LLAS
1zxeB           ------------------------LGQGAFGQVVKARNALDSRYYAIKKIRHTEEKLSTILSEV--LLAS
2zb0A           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
1yqjA           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
1wbsA           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
2w5bA           -------------SRAEDYEVLYTIGTGSYGRCQKIRRKSDGKIDYGSMTEAEKQ---MLVSEVNLLREL
2w5aA           -------------SRAEDYEVLYTIGTGSYGRCQKIRRKSDGKIDYGSMTEAEKQ---MLVSEVNLLREL
2vz6A           --------------ELGKFSVVRRCVK------VLAGQEYAAKIINTKKLSARDHQK--LEREARICRLL
2vwiD           ---------LPWSINRDDYELQEVIGSGATAVVYCAPKKEKVAIKRINLEKCQTSMDELLK-EIQAMSQC
2vgpB           ----------------------RPLGKGKFGNVYLAREKQN-KFIMALKVKSQLEKEGVLRREIEIQSHL
2vgoA           ----------------------RPLGKGKFGNVYLAREKQN-KFIMALKVKSQLEKEGVLRREIEIQSHL
1tkiA           -----------------KYMIAEDLGRGEFGIVHRCVETSSKKTYMAKFVKVKGTDQVLVKKEISILNIA
1oz1A           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
1ouyA           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
2onlA           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
2okrA           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
2og8A           --------------------LVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLA-EANLMKQL
1koaA           ------------------YDIHEELGTGAFGVVHRVTERATGN-NFAAKTPHESDKETVRK-EIQTMSVL
1k2pA           -------------------TFLKELGTGQFGVVKYGKWRGQYDVAIKMIKEGSMSEDEFIE-EAKVMMNL
2j4zB           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
2j4zA           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
2hyyD           ---------------------------------------KKYSLTVAVKTLKEMEVEEFLK-EAAVMKEI
3gfeA           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
1f5qA           --------------------------EGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
3e92A           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
2dwbA           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
3ds6A           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
3dk7B           --------------------------------------------------------------EAAVMKEI
3dk7A           --------------------------------------------------------------EAAVMKEI
1di9A           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
3dakC           ---------LPWSINRDDYELQEVIGSGATAVVYCAPKKEKVAIKRINLEKCQTSMDELLK-EIQAMSQC
3d7zA           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
3d5wA           ------------------------LGKGGFAKCYEITDMDTKEVFAGKVVPKSMLPHQKEKMEIAIHKSL
2cn5A           -----------------EYIMSKTLGSGACGEVKLAFERKTCK-KVAIKIISKRN----VETEIEILKKL
3ckxA           ------------------FTKLEKIGKGSFGEVFKGIDNRTQKVVAIKXXXXXXXXXXXXXXXXTVLSQC
2cjmC           ---------------------VEKIGEGT-GVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
2cjmA           ---------------------VEKIGEGT-GVVYKARNKLTGEV-VALKKIREGVPSTAIR-EISLLKEL
3bysA           --------------------LVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLA-EANLMKQL
3bx5A           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
3bv2A           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
2bfxA           ----------------------RPLGKGKFGNVYLAREKQN-KFIMALKVKSQLEKEGVLRREIEIQSHL
2balA           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
2vwiC           ------------------------IGSGATAVVYCAPKKEKVAIKRINLEKCQTSMDELLK-EIQAMSQC
2vgoB           ----------------------RPLGKGKFGNVYLAREKQN-KFIMALKVLFKSQLEKVLRREIEIQSHL
1v1kA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLTAI------REISLLKEL
2qohA           --------------------------------------------------------------EAAVMKEI
1opjB           --------------------------------------------------------------EAAVMKEI
1opjA           --------------------------------------------------------------EAAVMKEI
1m52B           --------------------------------------------------------------EAAVMKEI
1m52A           --------------------------------------------------------------EAAVMKEI
1iepA           --------------------------------------------------------------EAAVMKEI
2hznA           --------------------------------------------------------------EAAVMKEI
2hyyB           ---------------------------------------KKYSLTVAVKTLKETMEVEEFLKEAAVMKEI
2h9vA           ------------------YDVVKVIGRGAFGEVQLVRHKASQKV-YAMKLLSKFEMISAFFWEERDIMAF
1fpuA           --------------------------------------------------------------EAAVMKEI
2f2uB           ------------------YDVVKVIGRGAFGEVQLVRHKASQKV-YAMKLLSKFEMISAFFWEERDIMAF
2f2uA           ------------------YDVVKVIGRGAFGEVQLVRHKASQKV-YAMKLLSKFEMISAFFWEERDIMAF
3ezvA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRVPSTAI----REISLLKEL
3eb0A           -----------------KYSLGKTLGTG-FGIVCEVFDIESGK-RFALKKVLQDPRYKNRELDIMKVLDH
3dbeA           ------------------------LGKGGFAKCYEITDMDTKEV-FAGKVVPKSMLLKKMSTEIAIHKSL
3db8A           ------------------------LGKGGFAKCYEITDMDTKEV-FAGKVVPKSMLLKKMSTEIAIHKSL
3db6A           ------------------------LGKGGFAKCYEITDMDTKEV-FAGKVVPKSMLLKKMSTEIAIHKSL
3daeA           ------------GAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQ-KVALKINKKVLAQGRIEREISYLRLL
3d5xA           ------------------------LGKGGFAKCYEITDMDTKEV-FAGKVVPKSMLLKKMSTEIAIHKSL
3d5uA           ------------------------LGKGGFAKCYEITDMDTKEV-FAGKVVPKSMLLKKMSTEIAIHKSL
3cy3A           ----------------------------------------------------------------------
3cqwA           ---------------------LKLLGKGTFGKVILVKEKATGRY-YAMKI---------LKKEVIVAKDE
3cquA           ---------------------LKLLGKGTFGKVILVKEKATGRY-YAMKI---------LKKEVIVAKDE
2wqeA           ----------------------RPLGKGKFGNVYLAREKQR-KFILALKVKAQLEKAGVLRREVEIQSHL
2ozaB           ---------------------LSPVGSGAYGSVCAAFDT---KTGHRVAVKKLSRPFQSIYRELRLLKHM
1o6lA           ---------------------LKLLGKGTFGKVILVREKATGRY-YAMKILRKE--VIIAKDEVAHTVTE
1o6kA           ---------------------LKLLGKGTFGKVILVREKATGRY-YAMKILRKE--VIIAKDEVAHTVTE
2jdoA           ---------------------LKLLGKGTFGKVILVREKATGRY-YAMKILRKE--VIIAKDEVAHTVTE
3igoA           ------------GTFAERYNIVCMLGKGSFGEV-LKCKDRITQQEYAVKVASAKNKTSTILREVELLKKL
2hw7A           ------------------------LGEGAHARVQTCINLITSQ-EYAVKI-IEKQP-GHIRSRVFREVEM
2gtnA           ---------------------LSPVGSGAYGSVCAAFDT---KTGHRVAVKKLSRPFQSIYRELRLLKHM
2gtmA           ---------------------LSPVGSGAYGSVCAAFDT---KTGHRVAVKKLSRPFQSIYRELRLLKHM
3f69B           ----------------------------------------------------------------------
3efwB           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
3efwA           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
3e8dB           ---------------------LKLLGKGTFGKVILVREKATGRY-YAMKILRKE--VIIAKDEVAHTVTE
3e8dA           ---------------------LKLLGKGTFGKVILVREKATGRY-YAMKILRKE--VIIAKDEVAHTVTE
3e88A           ---------------------LKLLGKGTFGKVILVREKATGRY-YAMKILRKE--VIIAKDEVAHTVTE
3e87A           ---------------------LKLLGKGTFGKVILVREKATGRY-YAMKILRKE--VIIAKDEVAHTVTE
3d0eA           ---------------------LKLLGKGTFGKVILVREKATGRY-YAMKILRKE--VIIAKDEVAHTVTE
1zohA           ----------------------------------------------------------------------
2zazA           --------------------------------------------------------------ELRLLKHM
2wmxA           ----------------------------------------------------------------------
2wmwA           ----------------------------------------------------------------------
2wmvA           ----------------------------------------------------------------------
2wmuA           ----------------------------------------------------------------------
2wmtA           ----------------------------------------------------------------------
2wmsA           ----------------------------------------------------------------------
2rg6A           --------------------------------------------------------------ELRLLKHM
2rg5A           --------------------------------------------------------------ELRLLKHM
2r0uA           ----------------------------------------------------------------------
2qhnA           ----------------------------------------------------------------------
2qc6A           ----------------------------------------------------------------------
2pvkA           ----------------------------------------------------------------------
2pvjA           ----------------------------------------------------------------------
1om1A           ----------------------------------------------------------------------
1lp4A           ----------------------------------------------------------------------
3jvsA           ----------------------------------------------------------------------
3jvrA           ----------------------------------------------------------------------
3i79A           ------------------------LGKGSFGEVILTGQECAVKVISKRQVKQKTDKESLLR-EVQLLKQL
2hz4C           --------------------------------------------KYTVAVKTLKDTMEVEEFEAAVMKEI
2hz4B           -------------------TMKHKLGEVYEGVKYSLTVAVKTLKEDTMEVEE------FLK-EAAVMKEI
2hz4A           -------------------TMKHKLGEVYEGVKYSLTVAVKTLKEDTMEVEE------FLK-EAAVMKEI
3hx4A           ------------------------LGKGSFGEVILCKDKITGQ-ECAVKVISK-DKESLLR-EVQLLKQL
2hw6A           ------------------------LGEGAYAKVQGAVSLQNGK-EYAVKIIEKQ--AGHSRSRVFREVET
3hrbA           --------------------------------------------------------------ELRLLKHM
3hp5A           --------------------------------------------------------------ELRLLKHM
3h0zC           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
1gijA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRAIR--------EISLLKEL
3g6hA           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
2fumA           ----------------------------------------------------------------------
1fpuB           --------------------------------------------------------------EAAVMKEI
1fotA           --------------------ILRTLGTGSFGRVHLIRSRHNGRY-YAMKVLKKEIVVRLKQVEERLMLSI
3fl5A           ----------------------------------------------------------------------
3f9nA           ----------------------------------------------------------------------
1f0qA           ----------------------------------------------------------------------
2duvA           ---------------------VEKIGEGTYGVVYKARNK----------LTGEVVALKKIIREISLLKEL
1ds5A           ----------------------------------------------------------------------
3clyA           -----------------KLTLGKPLGEGAFGQVVMAEDKDKPKEAVTVAVKMLKDD-ATEKDLSDLVSEM
3cg2A           --------------------------------------------------------------ELRLLKHM
2c3jA           ----------------------------------------------------------------------
2b55A           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIGVPSTAI----REISLLKEL
2ac5A           ------------------------LGEGAHARVQTCINLITSQ-EYAVKI-IEKQP-GHIRSRVFREVEM
2w1gA           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
2w1fA           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
2w1eA           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
2w1dA           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
2np8A           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
1muoA           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
2j50A           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
2hziB           --------------------------------------------------------------EAAVMKEI
2hziA           --------------------------------------------------------------EAAVMKEI
2hz0A           --------------------------------------------------------------EAAVMKEI
2hyyC           ---------------------------------------KKYSLTVAVKTLKETMEVEEFLKEAAVMKEI
2hyyA           --------------------------------------------------------------EAAVMKEI
2hiwA           --------------------------------------------------------------EAAVMKEI
3h10D           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
3h0zA           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
3h0yA           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
1gihA           ---------------------VEKIGEGTYGVVYKARNKLTGEV-VALKKIRPSTAI----REISLLKEL
2g1tD           --------------------------------------------------------------EAAVMKEI
2g1tC           --------------------------------------------------------------EAAVMKEI
2g1tB           --------------------------------------------------------------EAAVMKEI
2g1tA           --------------------------------------------------------------EAAVMKEI
3fdnA           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
1f5qC           --------------------------EGTYGVVYKARNGEVVALKIRLDTETEGVPSTAIR-EISLLKEL
3ezrA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRVPSTAI----REISLLKEL
3e93A           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
3cs9D           --------------------------------------------------------------EAAVMKEI
3cs9A           --------------------------------------------------------------EAAVMKEI
2clqA           ------------------------LGKGTYGIVY-AGRDLSNQVRIAIKEIPERDSQPLHE-EIALHKHL
2c6eB           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
2c6eA           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
2c6dA           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
2btrA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKITAIR--------EISLLKEL
2bmcF           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
2bmcC           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
2bmcB           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
2bmcA           ----------------------RPLGKGKFGNVYLAREKQS-KFILALKVKAQLEKAGVLRREVEIQSHL
1zz2A           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
2w5hA           -------------SRAEDYEVLYTIGTGSYGRCQKIRRKSDGKIDYGSMTEAEKQ---MLVSEVNLLREL
2v7aB           --------------------------------------------------------------EAAVMKEI
2v7aA           --------------------------------------------------------------EAAVMKEI
2uw4A           ---------------------IKTLGTGS-GRVMLVKHMETGN-HYAMKILDKQKVVKLKQIEHTLILQA
1tvoA           -----EMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVN-KVRVAIKKISPFEHQTYCQREIKILLRF
2qr8A           ----------------------------------------------------------------------
2og8B           --------------------LVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLA-EANLMKQL
2ofvA           --------------------LVERLGAGQFGEVWMGYYNGHTKVA------VKSLKQGLA--EANLMKQL
1jsuA           ---------------------------GTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
3hl7A           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
3gcuA           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
2g2fB           -------------------TMKHKLGEVYEGVKYSLTVAVKTLKEDTMEVEE------FLK-EAAVMKEI
2fysA           -----EMVRGQVFDVGPRYTNLSYIGEGAYGMV-CSAYDNLNKVRVAIKKISPFEHQTYCQREIKILLRF
2fysB           -----EMVRGQVFDVGPRYTNLSYIGEGAYGMV-CSAYDNLNKVRVAIKKISPFEHQTYCQREIKILLRF
3fv8A           ----------------------------------------------------------------------
2fvdA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLR---------EISLLKEL
3f6xD           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
3erkA           -----EMVRGQVFDVGPRYTNLSYIGEGAYGMV-CSAYDNLNKVRVAIKKISPFEHQTYCQREIKILLRF
2erkA           -----EMVRGQVFDVGPRYTNLSYIGEGAYGMV-CSAYDNLNKVRVAIKKISPFEHQTYCQREIKILLRF
1erkA           -----EMVRGQVFDVGPRYTNLSYIGEGAYGMV-CSAYDNLNKVRVAIKKISPFEHQTYCQREIKILLRF
2e14A           -----EMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVN-KVRVAIKKISPFEHQTYCQREIKILLRF
3dqxB           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
3c9wA           -----EMVRGQVFDVGPRYTNLSYIGEGAYGMV-CSAYDNLNKVRVAIKKISPFEHQTYCQREIKILLRF
2bakA           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
2zoqA           -----------------RYTQLQYIGEGAYGMVYDHVRKTRVAIKKISPFEHQTYCQRTLR-EIQILLRF
2zjwA           ----------------------------------------------------------------------
2vwiB           ------------------------IGSAVVQAAYCAPKKEKVAIKRINLEKCQTSMDELLK-EIQAMSQC
2vv9A           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLV--PSTAIR-EISLLKEL
2rkpA           ----------------------------------------------------------------------
2r7iD           ----------------------------------------------------------------------
2r7iC           ----------------------------------------------------------------------
2r7iB           ----------------------------------------------------------------------
2r7iA           ----------------------------------------------------------------------
2pvrA           ----------------------------------------------------------------------
1pmeA           -----------------RYTNLSYIGYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLR-EIKILLRF
1pjkA           ----------------------------------------------------------------------
2ojiA           -----------------RYTNLSYIGEGAYGMVCSAYDNVN-KVRVAIKKISPFEHQTYCQREIKILLRF
2ojgA           -----------------RYTNLSYIGEGAYGMVCSAYDNVN-KVRVAIKKISPFEHQTYCQREIKILLRF
1o6yA           ----------------------------------------------------------------------
1na7A           ----------------------------------------------------------------------
1jwhB           ----------------------------------------------------------------------
1jwhA           ----------------------------------------------------------------------
2iwiB           ------------------------LGKGGFGTVF-AGHRLTDRLQVAIKVIPRTCPL-----EVALLWKV
2ivtA           ----------------------KTLGEGEFGKVVKATAFHKGRAGYTLKENASPSELRDLLSEFNVLKQV
3h30A           ----------------------------------------------------------------------
3gp0A           --------------------------------------------------------------ELRLLKHL
1golA           -----EMVRGQVFDVGPRYTNLSYIGEGAYGMVYDNLNKVRVAIRKISPFEHQTYCQRTLR-EIKILLRF
3ggfB           ----------------------------------------------------------------------
3ggfA           ----------------------------------------------------------------------
2g2iB           --------------------------------------------------------------EAAVMKEI
2g2iA           --------------------------------------------------------------EAAVMKEI
2g2hA           --------------------------------------------------------------EAAVMKEI
2g2fA           --------------------------------------------------------------EAAVMKEI
2f4jA           --------------------------------------------------------------EAAVMKEI
3dakA           ---------LPWSINRDDYELQEVIGSGATAVVYCAPKKEKVAIKRINLEKCQTSMDELLK-EIQAMSQC
3cohA           ----------------------RPLGKGKFGNVYLAREKNS-KFILALKVKAQLEKAGVLRREVEIQSHL
3bw5A           ----------------------------------------------------------------------
3bqcA           ----------------------------------------------------------------------
1zyjA           --------------------------------------------------------------ELRLLKHM
2vttA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKITAIR--------EISLLKEL
1ungA           --------------------------EKIYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSEICLLKEL
2r3nA           ---------------------VEKIGEGTYGVVYKARNKLTGEV-VALKKIVPSTAI----REISLLKEL
2pwlA           -----------------KLTLGKPLGEGAFGQVVMAEDKDKPKEAVTVAVKMLKDD-ATEKDLSDLVSEM
1kv1A           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
2j9mA           ---------------------VEKIGEGTYGVVYKARNKLTGEV-VALKKIRPSTAI----REISLLKEL
2iwiA           ------------------------LGKGGFGTVF-AGHRLTDRLQVAIKVIPRNRVLVTCPLEVALLWKV
2hw6B           ------------------------LGEGAYAKVQGAVSLQNGK-EYAVKIIEKQ--AGHSRSRVFREVET
2ghmA           ---------------------LSPVGSGAYGSVCAAFDT---KTGHRVAVKKLSRPFQSIYRELRLLKHM
3eb0C           -----------------KYSLGKTLG--TFGIVCEVFDIESGK-RFALKKVLQDPRYKNRELDIMKVLDH
3dqxA           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
3dlsF           ------------GEYSQKYSTMSPLGSGAFGFVWTAXXXXXXXXXXXXXXXXEDPKLGKVTLEIAILSRV
3dlsE           ------------GEYSQKYSTMSPLGSGAFGFVWTAXXXXXXXXXXXXXXXXEDPKLGKVTLEIAILSRV
3dlsD           ------------GEYSQKYSTMSPLGSGAFGFVWTAXXXXXXXXXXXLDCWIEDPKLGKVTLEIAILSRV
3daeB           ----------------GNYQIVKTLGEGSFGKVKLAYHTTTGQ-KVALKINKKVLAQGRIEREISYLRLL
2btsA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRSTAI------REISLLKEL
1aq1A           ---------------------VEKIGEGTYGVVYKARNKLTGEV-VALKKIVPSTAI----REISLLKEL
1yw2A           ---------------------LSPVGSGAYGSVCAAFDT---KTGHRVAVKKLSRPFQSIYRELRLLKHM
2wntB           ------------------YVVKETIGVGSYSECKRCVHKAT-NMEYAVKVKSKRDP----SEEIEILLRY
2wntA           ------------------YVVKETIGVGSYSECKRCVHKAT-NMEYAVKV-IDKDP----SEEIEILLRY
2w05A           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRSTAI------REISLLKEL
2vtqA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRSTAI------REISLLKEL
2qd9A           --------------------------------------------------------------ELRLLKHM
2pziB           ----------------GQYEVKGCIAHGGLGWIYLALDRNRPVVLKGLVHSGDXXXXXXXXXXXXFLAEV
2pziA           ----------------GQYEVKGCIAHGGLGWIYLALDRNRPVVLKGLVHSGDXXXXXXXXXXXXFLAEV
2psqA           -----------------KLTLGKPLGEGCFGQVVMAEDKDKPKEAVTVAVKMLKDD-ATEKDLSDLVSEM
1oitA           ---------------------VEKIGEGTYGVVYKARNKLGEVV--ALKKITAIREISLLK-------EL
2ivvA           ----------------------KTLGEGEFGKVVKATAFHKGRAGYTLKENASPSELRDLLSEFNVLKQV
2gqgB           --------------------------------------------------------------EAAVMKEI
2gqgA           --------------------------------------------------------------EAAVMKEI
3gcvA           --------------------------------------------------------------ELRLLKHM
1g5sA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRSTAI------REISLLKEL
3eqrA           --------------------LLEKLGDGSFGVVRAPSGKTVSVAVKCLKPEAMDDFI----REVNAMHSL
3el8A           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
3eh9A           ----------------GQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRGVSRED-----IEREVSILKEI
3dlsB           ------------GEYSQKYSTMSPLGSGAFGFVWTAXXXXXXXXXXXXXXXXXXDPLGKVTLEIAILSRV
3dakB           ---------LPWSINRDDYELQEVIGSGATAVVYCAPKKEKVAIKRINLEKCQTSMDELLK-EIQAMSQC
3d14A           ----------PLGSR--QWTIGRPLGKGKFGNVYLARERQS-KFILALKVKTQLEKAGVLRREVEIQSHL
3byuA           --------------------LVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLA-EANLMKQL
2bheA           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIPSTAI------REISLLKEL
2ac3A           ------------------------LGEGAHARVQTCINLITSQ-EYAVKI-IEKQP-GHIRSRVFREVEM
2vtnA           ---------------------VEKIGEGTYGVVYKARNKLTGEV-VALKKIRPSTAI----REISLLKEL
1r39A           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
3hp2A           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
3hllA           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
3ehaA           ----------------GQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSRED----IEREVSILKEI
3dlsC           ------------GEYSQKYSTMSPLGSGAFGFVWTAVDXXXXXXXXXXXXXXXXDPLGKVTLEIAILSRV
3c5uA           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
3bv3A           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
2bajA           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
1zxeD           ---------------------------------------------YAIKIRHTEEKLSTILSEV--LLAS
2w7xA           -----------------EYIMSKTLGSGA-GEVKLAFERKTCK-KVAIKIISKN-----VETEIEILKKL
1ua2A           ------------------------LGEGQFATVYKARDKNTNQIVAIKKINRTA------LREIKLLQEL
2r9sA           ----------------------------------------------------------------------
2pwlB           -----------------KLTLGKPLGEGAFGQVVMAEDKDKPKEAVTVAVKMLKDD-ATEKDLSDLVSEM
2pkjA           --------------------------------------------------------------ELRLLKHM
2pk9A           ---------------------LEKLGNGTYATVYKGLNKTTG-VYVALKLSEEGTPSTAIR-EISLMKEL
1mruB           ----------------------------------------------------------------------
1mruA           ----------------------------------------------------------------------
2ivuA           ----------------------KTLGEGEFGKVVKATAFHKGRAGYTLKENASPSELRDLLSEFNVLKQV
3gqlB           ----------------------KPLGEGAFGQVVLAEALDKDKPNRVTKVAVKMLKSDATEKDLSDLIEM
3gcsA           --------------------------------------------------------------ELRLLKHM
2fumB           ----------------------------------------------------------------------
3f6xC           -----------------------KLGQGCFGEVWMGTWNGTTRVA----IKTLKPPEAFLQ-EAQVMKKL
3eqiA           ---------------------ISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPANQIIRELQVLHEC
3eqfA           ---------------------ISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPANQIIRELQVLHEC
3en4B           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
2vwiA           ----------------------------------------------------------------------
2vu3A           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLTAI------REISLLKEL
1r78A           ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLTAI------REISLLKEL
2qg5D           ------------------YTLENTIGRGSWGEVKIAVQKGTRIRRAAKKIPKYFEDVDRFKQEIEIMKSL
2qg5B           ------------------YTLENTIGRGSWGEVKIAVQKGTRIRRAAKKIPKYFEDVDRFKQEIEIMKSL
2qg5A           ------------------YTLENTIGRGSWGEVKIAVQKGTRIRRAAKKIPKYFEDVDRFKQEIEIMKSL
2ptjA           --------------------------------------------------------------ELRLLKHM
2oiqA           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
2ivsB           ----------------------KTLGEGEFGKVVKATAFHKGRAGYTLKENASPSELRDLLSEFNVLKQV
2gphA           -----EMVRGQVFDVGPRYTNLSYIGEGAYGMV-CSAYDNLNKVRVAIKKISPFEHQTYCQREIKILLRF
1fmkA           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
3f69A           ----------------------------------------------------------------------
2f57B           -----------------------KIGEGSTGIVCIATEKHTGKQVAVKKMDLRKQQRRLLFNEVVIMRDY
2f57A           -----------------------KIGEGSTGIVCIATEKHTGKQVAVKKMDLRKQQRRLLFNEVVIMRDY
3f3zA           ------------------YTLENTIGRGSWGEVKIAVQKGTRIRRAAKKIPKYFEDVDRFKQEIEIMKSL
3dlsA           ------------GEYSQKYSTMSPLGSGAFGFVWTAVDXXXXXXXXXXXXXXEDPKLGKVTLEIAILSRV
3dfaA           ------------GTFAERYNIVCMLGKGSFGEV-LKCKDRITQQEYAVKVSAKNKDTSTILREVELLKKL
2clqB           ------------------------LGKGTYGIVY-AGRDLSNQVRIAIKIPERSQPL---HEEIALHKHL
2bdjA           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
2bdfB           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
2bdfA           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
2zb1A           --------------------------------------------------------------ELRLLKHM
2z7lA           -----------------RYTNLSYIGEGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLR-EIKILLRF
1q97B           -----------------RYILVRKLGWGHFSTVWLAKDMVN-NTHVAMKIEAAEDEIKLLQ-RVNDADNT
1q8zB           -----------------RYILVRKLGWGHFSTVWLAKDMVN-NTHVAMKIEAAEDEIKLLQ-RVNDADNT
1q8zA           -----------------RYILVRKLGWGHFSTVWLAKDMVN-NTHVAMKIEAAEDEIKLLQ-RVNDADNT
1q8yA           -----------------RYILVRKLGWGHFSTVWLAKDMVN-NTHVAMKIEAAEDEIKLLQ-RVNDADNT
2oiqB           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
3k2lA           -------VQVPHDHVAYRYEVLKVIGKG-FGQV-VKAYDHKVHQHVALKVRNEKRFHRQAAEEIRILEHL
2jd5B           -----------------RYILVRKLGWGHFSTVWLAKDMVN-NTHVAMKIEAAEDEIKLLQ-RVNDADNT
2jd5A           -----------------RYILVRKLGWGHFSTVWLAKDMVN-NTHVAMKIEAAEDEIKLLQ-RVNDADNT
2jbpJ           ----------------------------------------------------------------------
1howA           -----------------RYILVRKLGWGHFSTVWLAKDMVN-NTHVAMKIEAAEDEIKLLQ-RVNDADNT
3fi3A           ----------------------------------------------------------------------
3f6xA           -----------------------KLGQGCFGEVWMGTWNGTTRV--AIKTLS---PEAFLQ-EAQVMKKL
3f61A           ----------------------------------------------------------------------
3eqpA           --------------------LLEKLGDGSFGVVRAPSGKTVSVAVKCLQPEAMDDFI----REVNAMHSL
3eqpB           --------------------LLEKLGDGSFGVVRAPSGKTVSVAVKCLQPEAMDDFI----REVNAMHSL
3el8B           -----------------------KLGQGCFGEVWMGTWNGTTRV--AIKTLPEA-----FLQEAQVMKKL
3d7tB           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
2uv2A           ------------------WEIIGELGD--FGKVYKAQNKETSVLAAAKVIDTKSEELEDYMVEIDILASC
2q0nA           -----------------------KIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRLLFNEVVIMRDY
2pzyD           ----------------------------------------------------------------------
1pmqA           ----------------------------------------------------------------------
2j0iA           -----------------------KIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRLLFNEVVIMRDY
3hmiA           --------------------------------------------------------------EAAVMKEI
3gqlC           ----------------------KPLGEGAFGQVVLAEALDKDKPNRVTKVAVKMLKSDATEKDLSDLIEM
3gqlA           ----------------------KPLGEGAFGQVVLAEALDKDKPNRVTKVAVKMLKSDATEKDLSDLIEM
3g6hB           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
2e2bB           --------------------------------------------KYSLTVAVKTLEVEEFLKEAAVMKEI
2e2bA           --------------------------------------------------------------EAAVMKEI
3dj7A           -----------------QWTIGRPLGKGKFGNVYLARERQS-KFILALKVKTQLEKAGVLRREVEIQSHL
3dajA           -----------------QWTIGRPLGKGKFGNVYLARERQS-KFILALKVKTQLEKAGVLRREVEIQSHL
3d2iA           -----------------QWTIGRPLGKGKFGNVYLARERQS-KFILALKVKTQLEKAGVLRREVEIQSHL
3d15A           -----------------QWTIGRPLGKGKFGNVYLARERQS-KFILALKVKTQLEKAGVLRREVEIQSHL
3comB           --------------------VLEKLG----GSVYKAIHKETGQIVAIKQVPVESDLQEIIK-EISIMQQC
3comA           --------------------VLEKLG----GSVYKAIHKETGQIVAIKQVPVESDLQEIIK-EISIMQQC
2wipC           ------------------------------GVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
2wipA           ------------------------------GVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
2w9fB           -----------------------EIGVGAYGTVY---KARDPHSGHFVALKSVRVPNGEEGLPISTVREV
1unhA           --------------------------EKIYGTVF--KAKNRHEIVALKRVRLDGVPSSALR-EICLLKEL
1u5qA           ---------------------LREIGHGSFGAVYFARDVRNSEV-VAIKKMSYSGKQSNEKWQ-DIIKEV
2qkwB           ------------------------IGHGVFGKVYKGVLRDGAKVALKRRTPESSQGIEEFETEIETLSFC
2p5aA           --------------------------------------------------------------ELRLLKHM
1p4fA           ----------------GQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSRED----IEREVSILKEI
1lufA           ---------------------VRDIGEGAFGRVFQARAPGLLPYEKMLKEEASADMQADFQREAALMAEF
2j90A           ----------------------EELGSGQFAIVRKCRQKGTGK-EYAIKKRRLSSRRGVIEREVNILREI
3gc0A           ---------------------ITKLGEGTYGEVYKAIDTVTNETVAIKRIRLEHTAI----REVSLLKEL
3gbzA           ---------------------ITKLGEGTYGEVYKAIDT----------VTNETVAIKRIRLEHAIREVS
3en4A           -----------------------KLGQGCFGEVWMGTWNGTTRV--AIKTLKPMSPEAFLQ-EAQVMKKL
3dj5A           ----------------------RPLGKGKFGNVYLARERQS-KFILALKVKTQLEKAGVLRREVEIQSHL
3d2kA           ----------------------RPLGKGKFGNVYLARERQS-KFILALKVKTQLEKAGVLRREVEIQSHL
2baqA           ---------------------LSPIGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
1zwsA           ------------------YDIGEELGSGQFAIVKKCREKSTG-LEYAAKFQSRASRRGVIEREVSILRQV
1wmkH           ------------------YDIGEELGSGQFAIVKKCREKSTG-LEYAAKFQSRASRRGVIEREVSILRQV
1wmkB           ------------------YDIGEELGSGQFAIVKKCREKSTG-LEYAAKFQSRASRRGVIEREVSILRQV
1wmkE           ------------------YDIGEELGSGQFAIVKKCREKSTG-LEYAAKFQSRASRRGVIEREVSILRQV
1wmkA           ------------------YDIGEELGSGQFAIVKKCREKSTG-LEYAAKFQSRASRRGVIEREVSILRQV
2qr7A           ----------------------------------------------------------------------
2j90B           ----------------------EELGSGQFAIVRKCRQKE-----YAIKKRRLSSRRGVIEREVNILREI
3hyhA           ------------------YQIVKTLGEGKVKLAYHTTTGQK----VALKI-INKKMQGRIEREISYLRLL
3gqiA           ----------------------KPLGEGAFGQVVLAEALDKDKPNRVTKVAVKMLKSDATEKDLSDLIEM
3geqB           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
3geqA           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
3eqrB           --------------------LLEKLGDGSFGVVRAPSGKTVSVAVKCLKPDVLSQPEAMFIREVNAMHSL
3en5B           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
3e3bX           ----------------------------------------------------------------------
2ckeB           ------------------YDIGEELGSGQFAIVKKCREKSTG-LEYAAKFQSRASRRGVIEREVSILRQV
2ckeA           ------------------YDIGEELGSGQFAIVKKCREKSTG-LEYAAKFQSRASRRGVIEREVSILRQV
2a2aB           ------------------YDIGEELGSGQFAIVKKCREKSTG-LEYAAKFQSRASRRGVIEREVSILRQV
2a2aA           ------------------YDIGEELGSGQFAIVKKCREKSTG-LEYAAKFQSRASRRGVIEREVSILRQV
2a27A           ------------------YDIGEELGSGQFAIVKKCREKSTG-LEYAAKFQSRASRRGVIEREVSILRQV
2pzyC           ----------------------------------------------------------------------
2pzyB           ----------------------------------------------------------------------
2pzyA           ----------------------------------------------------------------------
2pmiC           -------------------------------------------VYVALKEVKEGTPSTAIR-EISLMKEL
2p3gX           ----------------------------------------------------------------------
2ozaA           ----------------------------------------------------------------------
2onlD           ----------------------------------------------------------------------
2onlC           ----------------------------------------------------------------------
2ofvB           --------------------LVERLGAGQFGEVWMGYYNGHTKVA------VKSLKQGAFLAEANLMKQL
1kwpB           ----------------------------------------------------------------------
1kwpA           ----------------------------------------------------------------------
1k9aB           --------------------LLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAF---LAEASVMTQL
2jbpL           ----------------------------------------------------------------------
2jbpK           ----------------------------------------------------------------------
2jbpI           ----------------------------------------------------------------------
2jbpH           ----------------------------------------------------------------------
2jbpG           ----------------------------------------------------------------------
2jbpF           ----------------------------------------------------------------------
2jbpE           ----------------------------------------------------------------------
2jbpD           ----------------------------------------------------------------------
2jbpC           ----------------------------------------------------------------------
2jbpB           ----------------------------------------------------------------------
2jbpA           ----------------------------------------------------------------------
2jboA           ----------------------------------------------------------------------
3h4jA           ----------------GPYIIRETLGEGSFGKVKLATHY-KTQQKVALKFISRQ----LLKMHMRVEREI
3h4jB           ----------------GPYIIRETLGEGSFGKVKLATHY-KTQQKVALKFISRQ----LLKMHMRVEREI
3fpmA           ----------------------------------------------------------------------
1zxeF           ---------------------------GQFGQVVKARNALDSRYYAIKKIRHTEEKLSTILSEV--LLAS
1wfcA           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
1q3dB           ------------------YTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKR---FKNRELQIMRKL
2pv8A           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
2ptoA           --------------------------------------------------------------ELRLLKHM
2oicA           -----------------------KMGEGGFGVVYKGYVNNTTVAVKKLKQQFD--------QEIKVMAKC
2nruB           -----------------------KMGEGGFGVVYYVNNTTVAVKKLAAMVDITTEELQQFDQEIKVMAKC
2nruA           -----------------------KMGEGGFGVVYYVNNTTVAVKKLAAMVDITTEELQQFDQEIKVMAKC
3ha8A           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
1h00A           ---------------------VEKIGE--YGVVYKARNKLTGEV-VALKKIVPSTAI----REISLLKEL
2gfsA           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
1g3nA           -----------------QYECVAEIGEGAYGKVFKARDLKNGGRFVALKTGEEGMPLSTIR-EVAVLLET
3fi2A           ----------------------------------------------------------------------
2eufB           -----------------QYECVAEIGEGAYGKVFKARDLKNGGRFVALKTGEEGMPLSTIR-EVAVLLET
3e8nA           ---------------------ISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPANQIIRELQVLHEC
3dy7A           ---------------------ISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPANQIIRELQVLHEC
3dv3A           ---------------------ISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPANQIIRELQVLHEC
3c4fA           ----------------------KPLGEGAFGQVVLAEALDKDKPNRVTKVAVKMLKSDATEKDLSDLIEM
1blxA           -----------------QYECVAEIGEGAYGKVFKARDLKNGGRFVALKTGEEGMPLSTIR-EVAVLLET
1xo2B           -----------------QYECVAEIGEGAYGKVFKARDLKNGGRFVALKTGEEGMPLSTIR-EVAVL---
1urwA           ---------------------VEKIGE--YGVVYKARNKLTGEVVALKKITAIR--------EISLLKEL
1u4dB           --------------------LLEKLGDGSFGVVRR-GEWDAPSVSVAVKCLAMDDFI----REVNAMHSL
1ny3A           ----------------------------------------------------------------------
1nxkD           ----------------------------------------------------------------------
1nxkC           ----------------------------------------------------------------------
1nxkB           ----------------------------------------------------------------------
1nxkA           ----------------------------------------------------------------------
1k9aE           --------------------LLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAF---LAEASVMTQL
1k9aD           --------------------LLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAF---LAEASVMTQL
1k9aA           --------------------LLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAF---LAEASVMTQL
2wajA           ----------------------------------------------------------------------
1ukiA           ----------------------------------------------------------------------
1u4dA           --------------------LLEKLGDGSFGVVRR-GEWDAPSVSVAVKCPEAMDDF---IREVNAMHSL
2pmiA           -----------------------------------------------VKLDSEEGTPSTAIREISLMKEL
1pmuA           ----------------------------------------------------------------------
2ow3A           ------------------YTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKR---FKNRELQIMRKL
2o0uA           ----------------------------------------------------------------------
1k9aF           --------------------LLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAF---LAEASVMTQL
2h96A           ----------------------------------------------------------------------
2gmxB           ----------------------------------------------------------------------
2gmxA           ----------------------------------------------------------------------
2g01B           ----------------------------------------------------------------------
2g01A           ----------------------------------------------------------------------
2fumD           ----------------------------------------------------------------------
2fslX           --------------------------------------------------------------ELRLLKHM
3f3wB           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
3f3wA           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
3e7oA           ----------------------------------------------------------------------
3da6A           ----------------------------------------------------------------------
1ym7D           -------VELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKM-YAMKCLDKKR----IKMKQGETLAL
1ym7C           -------VELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKM-YAMKCLDKKR----IKMKQGETLAL
1ym7A           -------VELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKM-YAMKCLDKKR----IKMKQGETLAL
2w9zB           -----------------------EIGVGAYGTVY---KARDPHSGHFVALKSVRVPNGEEGLPISTVREV
2w99B           -----------------------EIGVGAYGTVY---KARDPHSGHFVALKSVRVPNGEEGLPISTVREV
2w96B           -----------------------EIGVGAYGTVY---KARDPHSGHFVALKSVRVPNGEEGLPISTVREV
2w0jA           ----------------------------------------------------------------------
1ungB           ------------------------------------------------RVRLDGVPSSALR-EICLLKEL
1s9jA           ---------------------ISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPANQIIRELQVLHEC
2qnjB           ----------------GNYRLLKTIGKGNFAKVKLARHILTGR-EVAIKIKTQLNPTSLQKL----FREV
2pv5A           --------------------------------------------------------------ELRLLKHM
1omwA           -------VELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKM-YAMKCLDKKR----IKMKQGETLAL
2oibD           -----------------------KMGEGGFGVVY---KGYVNNTTVAVKKLTTEELKQQFDQEIKVMAKC
1k9aC           --------------------LLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAF---LAEASVMTQL
2j0lA           ------------------------IGEGQFGDVHIYMSPENPAMAVAIKTNCTSDSVREKFLQEALTM--
3hyhB           ------------------YQIVKTLGEKVKLAYHTTTGQK-----VALKIINKKVMQGRIEREISYLRLL
3g6gA           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
3fc1X           --------------------------------------------------------------ELRLLKHM
2ewaA           ---------------------LSPVGSGAYGSVCAAFDT---KTGLRVAVKKLSRPFQSIYRELRLLKHM
3eqcA           ---------------------ISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPANQIIRELQVLHEC
2cn8A           ----------------------------------------------------------------------
3cikA           -------VELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKM-YAMKCLDKKR----IKMKQGETLAL
2bcjA           -------VELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKM-YAMKCLDKKR----IKMKQGETLAL
2w17A           ---------------------VEKIGE-TYGVVYKARNKLTGEVVALKKIRLDVPSTAI--REISLLKEL
2vrxB           ------------------------IGRPLGGNVYLAREKQN-KFIMALKVKSQLEKEGVLRREIEIQSHL
1u54A           ----------------------------------------------------------------------
1u46A           ----------------------------------------------------------------------
2qi8A           -----------------------KLGQGCFGEVWMGTWNGTTRV--AIKT------LEAFLQEAQVMKKL
2nryD           -----------------------KMGEGGFGVVYKGYVNNTTVAVKKLELKQQFD------QEIKVMAKC
3hgkC           ------------------------IGHGVFGKVYKGVLRDGAKVALKRRTPESSQGIEEFETEIETLSFC
3hgkB           ------------------------IGHGVFGKVYKGVLRDGAKVALKRRTPESSQGIEEFETEIETLSFC
3hgkA           ------------------------IGHGVFGKVYKGVLRDGAKVALKRRTPESSQGIEEFETEIETLSFC
1gjoA           -----------------KLTLGKPLGEGCFGQVVMVGIKPKEAVTVAVKMDATEKDLSDLVSEMEMMKMI
3g6gB           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
3famA           ------------GAHIGNYQIVKKVK-----LAYHTTTGQK----VALKIINKKVMQGRIEREISYLRLL
3f3uB           -----------------------KLGQGCFGEVWMGTWNGTTRV--AIKTLKPGSPEAFLQ-EAQVMKKL
2eu9A           -----------------RYEIVGNLGEGTFGKVVECLDHARGKSQVALKIIRNVGKYRAARLEINVLXXX
3d7uD           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
3d7uB           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
3d7uA           --------------------LLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAF---LAEASVMTQL
2c30A           -----------------------KIGEGSTGIVCLAREKHSGR-QVAVKMMRKQQRRELLFNEVVIMRDY
2b1pA           ----------------------------------------------------------------------
2zm3B           -----------------KITMSRELGQGSFGMVYEVAKKDEPETRVAIKTVNEA---ASMRERIEFLNEA
1u54B           ----------------------------------------------------------------------
2pvfA           -----------------KLTLGKPLGEGAFGQVVMAEDKDKPVTVAVLKDDATEKDLSDLVSEMEMMKMI
2j0jA           ------------------------IGEGQFGDVHIYMSPENPAMAVAIKTNCTSDSVREKFLQEALTM--
1fgiA           ----------------------KPLGEGAFGQVVLAEAIGLPNAVKMLKSDATEKDLSDLISEMEMMKMI
1yomB           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
1yomA           -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
2vgpA           ------------------------------GNVYLAREKQN-KFIMALKVKSQLEKEGVLRREIEIQSHL
1r0eA           ------------------YTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKR---FKNRELQIMRKL
2qkrA           ----------------------------------------------------------------------
1pyxB           ------------------YTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKR---FKNRELQIMRKL
1pyxA           ------------------YTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKR---FKNRELQIMRKL
2oj9A           -----------------KITMSRELGQGSFGMVYEVAKKDEPETRVAIKTVNEA---ASMRERIEFLNEA
2oicD           -----------------------KMGEGGFGVVYKYVNNTTVAVKKLLKQQFD--------QEIKVMAKC
1m17A           ---------------------IKVLGSGAFGTVYWIPEGEKVKIPVAIK-----------ELREATSPKA
1m14A           ---------------------IKVLGSGAFGTVYWIPEGEKVKIPVAIK-----------ELREATSPKA
2jiuB           ---------------------IKVLGSGAFGTVYWIPEGEKVKIPVAIK-----------ELREATSPKA
2jiuA           ---------------------IKVLGSGAFGTVYWIPEGEKVKIPVAIK-----------ELREATSPKA
2jitB           ---------------------IKVLGSGAFGTVYWIPEGEKVKIPVAIK-----------ELREATSPKA
2jitA           ---------------------IKVLGSGAFGTVYWIPEGEKVKIPVAIK-----------ELREATSPKA
2j6mA           ---------------------IKVLGSGAFGTVYWIPEGEKVKIPVAIK-----------ELREATSPKA
2itwA           ---------------------IKVLGSGAFGTVYWIPEGEKVKIPVAIK-----------ELREATSPKA
2i6lA           ----------------------------------------------------------------------
1i09A           ------------------YTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKR---FKNRELQIMRKL
2fsmX           --------------------------------------------------------------ELRLLKHM
2cl1A           -------------SRAEDYEVLYTIGTGSYGRCQKIRRKSDGKI--LVWKELDYGSMTMLVSEVNLLREL
2cdzA           -----------------------KIGEGSTGIVCIATVRGKLVAVKKMDLRKQQRR-ELLFNEVVIMRDY
2bfxB           ------------------------------GNVYLAREKQN-KFIMALKVKSQLEKEGVLRREIEIQSHL


                         .         .         *         .         .         .         .:140
query           KKQKIVGRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLHNIG
1ckjB           --QGGVGIPTIRWCGAEG---DYNVMVMELLGPSLEDLFNFCS-RKFSLKTVLLLADQMISRIEYIHSKN
1ckjA           --QGGVGIPTIRWCGAEG---DYNVMVMELLGPSLEDLFNFCS-RKFSLKTVLLLADQMISRIEYIHSKN
1ckiB           --QGGVGIPTIRWCGAEG---DYNVMVMELLGPSLEDLFNFCS-RKFSLKTVLLLADQMISRIEYIHSKN
1ckiA           --QGGVGIPTIRWCGAEG---DYNVMVMELLGPSLEDLFNFCS-RKFSLKTVLLLADQMISRIEYIHSKN
2cmwA           -------RFYKQLGSAGELPQKYNAMVLELLGPSLEDLFDLCD-RTFTLKTVLMIAIQLLSRMEYVHSKN
1csnA           ---------------------------------------------KFSVKTVAMAAKQMLARVQSIHEKS
2c47B           -------------------PGKYNAMVLELLGPSLEDLFDLCD-RTFTLKTVLMIAIQLITRMEYVHTKS
2c47A           -------------------PGKYNAMVLELLGPSLEDLFDLCD-RTFTLKTVLMIAIQLITRMEYVHTKS
2c47C           -------------------PGKYNAMVLELLGPSLEDLFDLCD-RTFTLKTVLMIAIQLITRMEYVHTKS
2c47D           -------------------PGKYNAMVLELLGPSLEDLFDLCD-RTFTLKTVLMIAIQLITRMEYVHTKS
2chlA           -------RFYKQLGSGDGIPQKYNAMVLELLGPSLEDLFDLCD-RTFSLKTVLMIAIQLISRMEYVHSKN
2izuA           MKSRAPQLHYKQLGSGDGIPQKYNAMVLELLGPSLEDLFDLCD-RTFSLKTVLMIAIQLISRMEYVHSKN
2iztA           MKSRAPQLHYKQLGSGDGIPQKYNAMVLELLGPSLEDLFDLCD-RTFSLKTVLMIAIQLISRMEYVHSKN
2izrA           MKSRAPQLHYKQLGSGDGIPQKYNAMVLELLGPSLEDLFDLCD-RTFSLKTVLMIAIQLISRMEYVHSKN
2v62B           CIKKWIERKQLDYL---GIPRSYRFMVMERLGIDLQKI--SGQNGTFKKSTVLQLGIRMLDVLEYIHENE
2v62A           CIKKWIERKQLDYL---GIPRSYRFMVMERLGIDLQKI--SGQNGTFKKSTVLQLGIRMLDVLEYIHENE
2jamB           KHENIV-----TLEDIYESTTHY-YLVMQLVGGELFD--RILERGVYTEKDASLVIQQVLSAVKYLHENG
2jamA           KHENIV-----TLEDIYESTTHY-YLVMQLVGGELFD--RILERGVYTEKDASLVIQQVLSAVKYLHENG
3hrfA           VMSRLDHPFFVKLYFTFQDDEKLYFLSYAKNGELLKYIRKIGSFDETC--TRFYTA-EIVSALEYLHGKG
3dbqA           HSDKIIRLYDYEITDQ------YIYMVMECGNIDLNSLKKKKSIDPWERK---SYWKNMLEAVHTIHQHG
2zmcA           HSDKIIRLYDYEITDQ------YIYMVMECGNIDLNSLKKKKSIDPWERK---SYWKNMLEAVHTIHQHG
2vd5B           RDVLVNGRRWITQLHFAFQDENYLYLVMEYVGGDLLTL-----LSKFGERIPAEMAREIVMAIDSVHRLG
2vd5A           RDVLVNGRRWITQLHFAFQDENYLYLVMEYVGGDLLTL-----LSKFGERIPAEMAREIVMAIDSVHRLG
1qcfA           QHDKLVKLHAV-------VTKEPIYIITEFMAKSLLDFLKSDEGSKQPLPKLIDFSAQIAEGMAFIEQRN
3h9fA           HSDKIIRLYDYEITDQ------YIYMVMECGNIDLNSLKKKKSIDPWERK---SYWKNMLEAVHTIHQHG
3gfwA           HSDKIIRLYDYEITDQ------YIYMVMECGNIDLNSLKKKKSIDPWERK---SYWKNMLEAVHTIHQHG
1kobA           HHPKLINLH-----DAFEDKYEMVLILEFLSGGELFD-RIAAEDYKMSEAEVINYMRQACEGLKHMHEHS
3cekA           HSDKIIRLYDYEITDQ------YIYMVMECGNIDLNSLKKKKSIDPWERK---SYWKNMLEAVHTIHQHG
3blhA           KHENVV--NLIEIC-RTSIYLVFDFCEHDLAGLLSNVL------VKFTLSEIKRVMQMLLNGLYYIHRNK
3hztA           DHPNIMKLYFFE--------DKRNYYLVMEVYRGGELFDEIILRQKFSEVDAAVIMKQVLSGTTYLHKHN
2zmdA           HSDKIIRLYDYEITDQ------YIYMVMECGNIDLNSLKKKKSIDPWERK---SYWKNMLEAVHTIHQHG
1qpjA           QHQRLVRLYAV-------VTQEPIYIITEYMENSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERN
1qpcA           QHQRLVRLYAV-------VTQEPIYIITEYMENSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERN
2ofuA           QHQRLVRLYAV-------VTQEPIYIITEYMENSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERN
3hrcA           VMSRLDHPFFVKLYFTFQDDEKLYFLSYAKNGELLKYIRKIGSFDETC--TRFYTA-EIVSALEYLHGKG
1h1wA           VMSRLDHPFFVKLYFTFQDDEKLYFLSYAKNGELLKYIRKIGSFDETC--TRFYTA-EIVSALEYLHGKG
3bymA           QHQRLVRLYAV-------VTQEPIYIITEYMENSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERN
2biyA           VMSRLDHPFFVKLYFTFQDDEKLYFLSYAKNGELLKYIRKIGSFDETC--TRFYTA-EIVSALEYLHGKG
1zydA           NHQYVV-RYYAAWLERRNFVKKKSTLFIQMENRTLYDLIHSENLNQ-QRDEYWRLFRQILEALSYIHSQG
1zycC           NHQYVV-RYYAAWLERRNFVKKKSTLFIQMENRTLYDLIHSENLNQ-QRDEYWRLFRQILEALSYIHSQG
1zycB           NHQYVV-RYYAAWLERRNKSTLFIQMEYC-ENRTLYDLIHSENLNQ-QRDEYWRLFRQILEALSYIHSQG
1u7eA           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
3fhiA           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
1zydB           NHQYVV-RYYAAWLERRNFKSTLFIQMEYCENRTLYDLIHSENLNQ-QRDEYWRLFRQILEALSYIHSQG
1zycA           NHQYVV-RYYAAWLERRNKKSTLFIQMEYCENRTLYDLIHSENLNQ-QRDEYWRLFRQILEALSYIHSQG
1yhwA           KNPNIVN-----YLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDE---GQIAAVCRECLQALEFLHSNQ
1yhvA           KNPNIVN-----YLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDE---GQIAAVCRECLQALEFLHSNQ
2pl0A           QHQRLVRLYAV-------VTQEPIYIITEYMENSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERN
2of2A           QHQRLVRLYAV-------VTQEPIYIITEYMENSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERN
1zy4A           NHQYVV-RYYAAWLERRNFVKKKSTLFIQMENGTLYDLIHSENLNQ-QRDEYWRLFRQILEALSYIHSQG
1rejA           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
1rdqE           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
2qvsE           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
2qurA           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
1jbpE           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
3idbA           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
2hk5A           QHDKLVKLHAV-------VTKEPIYIITEFMAKSLLDFLKSDEGSKQPLPKLIDFSAQIAEGMAFIEQRN
2gu8A           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
3fxzA           KNPNIVN-----YLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDE---GQIAAVCRECLQALEFLHSNQ
1fmoE           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
3fjqE           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
3e7eA           SMQHMFMKFYAHLFQNGSVLVGELYSYGTLLNAI--NLYKNTPEKVMPQGLVISFAMRMLYMIEQVHDCE
1bkxA           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
1uu7A           VMSRLDHPFFVKLYFTFQDDEKLYFLSYAKNGELLKYIRKIGSFDETC--TRFYTA-EIVSALEYLHGKG
2jiiB           ---------------------KYRFLVLPSLGRSLQSALDVSPKHVLSERSVLQVACRLLDALEFLHENE
2jiiA           ---------------------KYRFLVLPSLGRSLQSALDVSPKHVLSERSVLQVACRLLDALEFLHENE
3idpA           RHVNIL--LFMGYSTKPQLAIVTQWCEGSSLYHHLHIIE-----TKFEMIKLIDIARQTAQGMDYLHAKS
2dq7X           KHDKLVQLYAV-------VSEEPIYIVTEYMNKSLLDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMN
1zycD           NHQYVV-RYYAAWLERRNKSTLFIQMEYC-ENRTLYDLIHSENLNQ-QRDEYWRLFRQILEALSYIHSQG
2z7qA           NHPFVVKLHY-AFQTEGKL-----YLILDFLGDLFTRLSKEVMFTEEDV--KFYLAELAL-GLDHLHSLG
1unlA           KHKNIVRLHDVLHSDK----------KLTLVFEFCQDLKKYFDSCNGDLDPEISFLFQLLKGLGFCHSRN
1sykB           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
1sykA           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
1j3hB           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
1j3hA           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
2wmqA           NHENVVGHLFLEYCSGGELFDRIE-----------PDIGMPEP-------DAQRFFHQLMAGVVYLHGIG
1wccA           NHPNIV-----KLLDVIHTENKL-YLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHR
1hckA           NHPNIV-----KLLDVIHTENKL-YLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHR
1apmE           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFAEPHARFYAAQIVLTFEYLHSLD
2jc6C           KHENIVA-----LEDIYESPNHL-YLVMQLVGGELFDRIVEKGF--YTEKDASTLIRQVLDAVYYLHRMG
2jc6A           KHENIVA-----LEDIYESPNHL-YLVMQLVGGELFDRIVEKGF--YTEKDASTLIRQVLDAVYYLHRMG
2iw9A           NHPNIV-----KLLDVIHTENKL-YLVFEFLHQDLKTFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHR
3fz1A           NHPNIV-----KLLDVIHTENKL-YLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHR
3eidC           NHPNIV-----KLLDVIHTENKL-YLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHR
1ctpE           RILQAVNFPFLVKLEYSFKDNSNLYMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
1cmkE           RILQAVNFPFLVKLEYSFKDNSNLYMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
1cdkA           RILQAVNFPFLVKLEYSFKDNSNLYMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
3b2wA           QHQRLVRLYAV-------VTQEPIYIITEYMENSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERN
2qcsA           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRRIGRFEPH----ARFYAAQIVLTFEYLHSLD
1l3rE           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRRIGRFEPH----ARFYAAQIVLTFEYLHSLD
2cpkE           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRRIGRFEPH----ARFYAAQIVLTFEYLHSLD
2z7rA           VNHPFVVKLHYAFQTEGKL-----YLILDFLGDLFTRLSKEVMFTEEDV--KFYLAELAL-GLDHLHSLG
1ydrE           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
1xh8A           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
1xh6A           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
2uztA           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
1stcE           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
1q8uA           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
1q8tA           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
1ia8A           NHENVV--KFYGHRREGNIQYLF---LEYCSGGELFD--RIEPDIGMPEPDAQRFFHQLMAGVVYLHGIG
3hkoA           HHPNIARLYVMELCHGGHLLDKLNVFIDDSTGKCAMDVVKTQECNEEAINGSINIMRQIFSALHYLHNQG
3gc9B           KHENVIG--LLDVFTPATSIEDFSYLVTTLMGADLNNIVKSQALSDEHVQFLVY---QLLRGLKYIHSAG
2f7xE           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
1f3mC           KNPNIVN-----YLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDE---GQIAAVCRECLQALEFLHSNQ
3e8eI           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
3e8cE           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
3e8cB           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
3dneA           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
3dndA           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
2cgxA           NHENVV--KFYGHRREGNIQYLF---LEYCSGGELFD--RIEPDIGMPEPDAQRFFHQLMAGVVYLHGIG
2cgvA           NHENVV--KFYGHRREGNIQYLF---LEYCSGGELFD--RIEPDIGMPEPDAQRFFHQLMAGVVYLHGIG
2cguA           NHENVV--KFYGHRREGNIQYLF---LEYCSGGELFD--RIEPDIGMPEPDAQRFFHQLMAGVVYLHGIG
2c3kA           NHENVV--KFYGHRREGNIQYLF---LEYCSGGELFD--RIEPDIGMPEPDAQRFFHQLMAGVVYLHGIG
2c1aA           RILQAVNFPFLSFKDNSNL-----YMVMEYVGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
2brnA           NHENVV--KFYGHRREGNIQYLF---LEYCSGGELFD--RIEPDIGMPEPDAQRFFHQLMAGVVYLHGIG
2b9fA           KHENIITIFNIQRPDSFE-----NFNEVYIIQELMQDLHRVISTQMLSDDHIQYFIYQTLRAVKVLHGSN
1zy5B           NHQYVV-RYYAAWLERRNFVKKSTLFIQMCENGTLYDLIHSENLNQ-QRDEYWRLFRQILEALSYIHSQG
1zy4B           NHQYVV-RYYAAWLERRNFVKKSTLFIQMCENGTLYDLIHSENLNQ-QRDEYWRLFRQILEALSYIHSQG
1uwjB           RHVNIL--LFMGYSTKPQLAIVTQWCEGSSLYHHLHIIE-----TKFEMIKLIDIARQTAQGMDYLHAKS
1okyA           VMSRLDHPFFVKLYFTFQDDEKLYFLSYAKNGELLKYIRKIGSFDETC--TRFYTA-EIVSALEYLHGKG
3gc8B           KHENVIG--LLDVFTPATSIEDFSYLVTTLMGADLNNIVKCQALSDEHVQFLVY---QLLRGLKYIHSAG
3gc8A           KHENVIG--LLDVFTPATSIEDFSYLVTTLMGADLNNIVKCQALSDEHVQFLVY---QLLRGLKYIHSAG
2cgwA           NHENVV--KFYGHRREGNIQYLF---LEYCSGGELFD--RIEPDIGMPEPDAQRFFHQLMAGVVYLHGIG
2z7sA           NHPFVVKLHY-AFQTEGKL-----YLILDFLGDLFTRLSKEVMFTEEDV--KFYLAELAL-GLDHLHSLG
1smhA           RILQAVNFPFLSFKDNSNL-----YMVMEYAGEMFSHLRR---IGRFSEPHARFYAAQIVLTFEYLHSLD
2iw8C           NHPNIV-----KLLDVIHTENKL-YLVFEHVDQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHR
2iw8A           NHPNIV-----KLLDVIHTENKL-YLVFEHVDQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHR
2gdoA           NHENVV--KFYGHRREGNIQYLF---LEYCSGGELFD--RIEPDIGMPEPDAQRFFHQLMAGVVYLHGIG
2fa2B           KHENIITIFNIQRPDSFE-----NFNEVYIIQELMQDLHRVISTQMLSDDHIQYFIYQTLRAVKVLHGSN
2fa2A           KHENIITIFNIQRPDSFE-----NFNEVYIIQELMQDLHRVISTQMLSDDHIQYFIYQTLRAVKVLHGSN
2f49A           KHENIITIFNIQRPDSFE-----NFNEVYIIQELMQDLHRVISTQMLSDDHIQYFIYQTLRAVKVLHGSN
3blrA           KHENVV--NLIEIC-RTSIYLVFDFCEHDLAGLLSNVL------VKFTLSEIKRVMQMLLNGLYYIHRNK
3blqA           KHENVV--NLIEIC-RTSIYLVFDFCEHDLAGLLSNVL------VKFTLSEIKRVMQMLLNGLYYIHRNK
2b9hA           KHENIITIFNIQRPDSFE-----NFNEVYIIQELMQDLHRVISTQMLSDDHIQYFIYQTLRA</