[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cele0:C08B11.5

[Show Plain Result]

#ERROR : Can't open dsspfile "1x5uA.bssp"
#ERROR : Can't open dsspfile "1x5tA.bssp"
#ERROR : Can't open dsspfile "1cvjG.bssp"
#ERROR : Can't open dsspfile "1cvjC.bssp"
#ERROR : Can't open dsspfile "1cvjA.bssp"
#ERROR : Can't open dsspfile "1cvjD.bssp"
#ERROR : Can't open dsspfile "1cvjB.bssp"
#ERROR : Can't open dsspfile "1cvjH.bssp"
#ERROR : Can't open dsspfile "1cvjF.bssp"
#ERROR : Can't open dsspfile "1fnxH.bssp"
#ERROR : Can't open dsspfile "2qfjB.bssp"
#ERROR : Can't open dsspfile "2cjkA.bssp"
#ERROR : Can't open dsspfile "1fxlA.bssp"
#ERROR : Can't open dsspfile "2ywkA.bssp"
#ERROR : Can't open dsspfile "1b7fA.bssp"
#ERROR : Can't open dsspfile "2k8gA.bssp"
#ERROR : Can't open dsspfile "1ha1A.bssp"
#ERROR : Can't open dsspfile "1u1pA.bssp"
#ERROR : Can't open dsspfile "2qfjA.bssp"
#ERROR : Can't open dsspfile "1up1A.bssp"
#ERROR : Can't open dsspfile "2cqbA.bssp"
#ERROR : Can't open dsspfile "1l3kA.bssp"
#ERROR : Can't open dsspfile "3sxlA.bssp"
#ERROR : Can't open dsspfile "2dhsA.bssp"
#ERROR : Can't open dsspfile "2fy1A.bssp"
#ERROR : Can't open dsspfile "2dgoA.bssp"
#ERROR : Can't open dsspfile "2d9pA.bssp"
#ERROR : Can't open dsspfile "1p1tA.bssp"
#ERROR : Can't open dsspfile "2dh7A.bssp"
#ERROR : Can't open dsspfile "2dnzA.bssp"
#ERROR : Can't open dsspfile "2jrsA.bssp"
#ERROR : Can't open dsspfile "2g4bA.bssp"
#ERROR : Can't open dsspfile "2sxlA.bssp"
#ERROR : Can't open dsspfile "1fjeB.bssp"
#ERROR : Can't open dsspfile "1x5sA.bssp"
#ERROR : Can't open dsspfile "2u2fA.bssp"
#ERROR : Can't open dsspfile "2cqiA.bssp"
#ERROR : Can't open dsspfile "1u6fA.bssp"
#ERROR : Can't open dsspfile "2ghpB.bssp"
#ERROR : Can't open dsspfile "1d8zA.bssp"
#ERROR : Can't open dsspfile "3bs9A.bssp"
#ERROR : Can't open dsspfile "2cq0A.bssp"
#ERROR : Can't open dsspfile "2e5hA.bssp"
#ERROR : Can't open dsspfile "1p27B.bssp"
#ERROR : Can't open dsspfile "2j0sD.bssp"
#ERROR : Can't open dsspfile "2hyiB.bssp"
#ERROR : Can't open dsspfile "3ex7B.bssp"
#ERROR : Can't open dsspfile "2divA.bssp"
#ERROR : Can't open dsspfile "1d9aA.bssp"
#ERROR : Can't open dsspfile "1n54B.bssp"
#ERROR : Can't open dsspfile "2ghpA.bssp"
#ERROR : Can't open dsspfile "1n52B.bssp"
#ERROR : Can't open dsspfile "1h2vZ.bssp"
#ERROR : Can't open dsspfile "1h2uY.bssp"
#ERROR : Can't open dsspfile "1h2uX.bssp"
#ERROR : Can't open dsspfile "1h2tZ.bssp"
#ERROR : Can't open dsspfile "2do0A.bssp"
#ERROR : Can't open dsspfile "2dguA.bssp"
#ERROR : Can't open dsspfile "2dgsA.bssp"
#ERROR : Can't open dsspfile "1x5oA.bssp"
#ERROR : Can't open dsspfile "2cqcA.bssp"
#ERROR : Can't open dsspfile "2cpzA.bssp"
#ERROR : Can't open dsspfile "2cphA.bssp"
#ERROR : Can't open dsspfile "1h6kZ.bssp"
#ERROR : Can't open dsspfile "1hl6A.bssp"
#ERROR : Can't open dsspfile "1h6kY.bssp"
#ERROR : Can't open dsspfile "1h6kX.bssp"
#ERROR : Can't open dsspfile "2dhgA.bssp"
#ERROR : Can't open dsspfile "2dh9A.bssp"
#ERROR : Can't open dsspfile "1rk8A.bssp"
#ERROR : Can't open dsspfile "3feyB.bssp"
#ERROR : Can't open dsspfile "2dgvA.bssp"
#ERROR : Can't open dsspfile "1oo0B.bssp"
#ERROR : Can't open dsspfile "2dnhA.bssp"
#ERROR : Can't open dsspfile "2dh8A.bssp"
#ERROR : Can't open dsspfile "3fexB.bssp"
#ERROR : Can't open dsspfile "2fc9A.bssp"
#ERROR : Can't open dsspfile "2cqgA.bssp"
#ERROR : Can't open dsspfile "1x4bA.bssp"
#ERROR : Can't open dsspfile "2dk2A.bssp"
#ERROR : Can't open dsspfile "1sxlA.bssp"
#ERROR : Can't open dsspfile "2jwnA.bssp"
#ERROR : Can't open dsspfile "2dgpA.bssp"
#ERROR : Can't open dsspfile "1hd0A.bssp"
#ERROR : Can't open dsspfile "2dnkA.bssp"
#ERROR : Can't open dsspfile "1wtbA.bssp"
#ERROR : Can't open dsspfile "1iqtA.bssp"
#ERROR : Can't open dsspfile "1uawA.bssp"
#ERROR : Can't open dsspfile "2mssA.bssp"
#ERROR : Can't open dsspfile "2fc8A.bssp"
#ERROR : Can't open dsspfile "2errA.bssp"
#ERROR : Can't open dsspfile "1wg4A.bssp"
#ERROR : Can't open dsspfile "1x4gA.bssp"
#ERROR : Can't open dsspfile "2cpxA.bssp"
#ERROR : Can't open dsspfile "2i38A.bssp"
#ERROR : Can't open dsspfile "2i2yA.bssp"
#ERROR : Can't open dsspfile "1wf1A.bssp"
#ERROR : Can't open dsspfile "1oiaB.bssp"
#ERROR : Can't open dsspfile "1oiaA.bssp"
#ERROR : Can't open dsspfile "1fhtA.bssp"
#ERROR : Can't open dsspfile "2cq3A.bssp"
#ERROR : Can't open dsspfile "1hl6C.bssp"
#ERROR : Can't open dsspfile "2dgqA.bssp"
#ERROR : Can't open dsspfile "2cpdA.bssp"
#ERROR : Can't open dsspfile "1x5tA.bssp"
#ERROR : Can't open dsspfile "2ywkA.bssp"
#ERROR : Can't open dsspfile "2k8gA.bssp"
#ERROR : Can't open dsspfile "2cqbA.bssp"
#ERROR : Can't open dsspfile "2fy1A.bssp"
#ERROR : Can't open dsspfile "2d9pA.bssp"
#ERROR : Can't open dsspfile "1p1tA.bssp"
#ERROR : Can't open dsspfile "2dnzA.bssp"
#ERROR : Can't open dsspfile "2jrsA.bssp"
#ERROR : Can't open dsspfile "2sxlA.bssp"
#ERROR : Can't open dsspfile "1x5sA.bssp"
#ERROR : Can't open dsspfile "2u2fA.bssp"
#ERROR : Can't open dsspfile "1d8zA.bssp"
#ERROR : Can't open dsspfile "3bs9A.bssp"
#ERROR : Can't open dsspfile "2cq0A.bssp"
#ERROR : Can't open dsspfile "2e5hA.bssp"
#ERROR : Can't open dsspfile "1p27B.bssp"
#ERROR : Can't open dsspfile "2j0sD.bssp"
#ERROR : Can't open dsspfile "2hyiB.bssp"
#ERROR : Can't open dsspfile "3ex7B.bssp"
#ERROR : Can't open dsspfile "1d9aA.bssp"
#ERROR : Can't open dsspfile "1n52B.bssp"
#ERROR : Can't open dsspfile "1h2vZ.bssp"
#ERROR : Can't open dsspfile "1h2uY.bssp"
#ERROR : Can't open dsspfile "1h2uX.bssp"
#ERROR : Can't open dsspfile "1h2tZ.bssp"
#ERROR : Can't open dsspfile "2dgsA.bssp"
#ERROR : Can't open dsspfile "2cpzA.bssp"
#ERROR : Can't open dsspfile "1h6kZ.bssp"
#ERROR : Can't open dsspfile "1h6kY.bssp"
#ERROR : Can't open dsspfile "1h6kX.bssp"
#ERROR : Can't open dsspfile "2dh8A.bssp"
#ERROR : Can't open dsspfile "3fexB.bssp"
#ERROR : Can't open dsspfile "2cqgA.bssp"
#ERROR : Can't open dsspfile "2dgpA.bssp"
#ERROR : Can't open dsspfile "1hd0A.bssp"
#ERROR : Can't open dsspfile "1wtbA.bssp"
#ERROR : Can't open dsspfile "1iqtA.bssp"
#ERROR : Can't open dsspfile "2errA.bssp"
#ERROR : Can't open dsspfile "2cq3A.bssp"
#ERROR : Can't open dsspfile "2dgqA.bssp"

## Summary of PDB Search
:388
    1e-42  79%  1x5uA  [x.x.x] SPLICING FACTOR 3B SUBUNIT 4 (SPLICEOSOME
    3e-33  85%  1x5tA  [x.x.x] SPLICING FACTOR 3B SUBUNIT 4
    3e-28  39%  1cvjG  [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1
    3e-28  39%  1cvjC  [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1
    3e-28  39%  1cvjA  [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1
    2e-27  40%  1cvjD  [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1
    2e-25  40%  1cvjB  [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1
    3e-18  39%  1cvjH  [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1
    2e-17  38%  1cvjF  [d.58.7 - d.58.7] POLYDENYLATE BINDING PROTEIN 1
    6e-17  32%  1fnxH  [d.58.7 - d.58.7] HU ANTIGEN C
    2e-16  32%  2qfjB  [x.x.x] FBP-INTERACTING REPRESSOR
    4e-16  32%  2cjkA  [x.x.x] NUCLEAR POLYADENYLATED RNA-BINDING PROTEIN 4
    5e-16  30%  1fxlA  [d.58.7 - d.58.7] PARANEOPLASTIC ENCEPHALOMYELITIS ANTIGEN
    7e-16  46%  2ywkA  [x.x.x] PUTATIVE RNA-BINDING PROTEIN 11
    8e-15  29%  1b7fA  [d.58.7 - d.58.7] PROTEIN (SXL-LETHAL PROTEIN)
    3e-14  49%  2k8gA  [x.x.x] POLYADENYLATE-BINDING PROTEIN 1
    9e-14  31%  1ha1A  [x.x.x] HNRNP A1
    1e-13  31%  1u1pA  [d.58.7] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN A1
    3e-13  30%  2qfjA  [x.x.x] FBP-INTERACTING REPRESSOR
    6e-13  30%  1up1A  [x.x.x] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN A1
    1e-12  41%  2cqbA  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE E
    3e-12  31%  1l3kA  [d.58.7 - d.58.7] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN A1
    4e-11  33%  3sxlA  [d.58.7 - d.58.7] PROTEIN (SEX-LETHAL)
    9e-11  32%  2dhsA  [x.x.x] CUG TRIPLET REPEAT RNA-BINDING PROTEIN 1
    3e-10  36%  2fy1A  [x.x.x] RNA-BINDING MOTIF PROTEIN, Y CHROMOSOME, FAMILY
    4e-10  30%  2dgoA  [x.x.x] CYTOTOXIC GRANULE-ASSOCIATED RNA BINDING PROTEIN
    4e-10  35%  2d9pA  [x.x.x] POLYADENYLATE-BINDING PROTEIN 3
    6e-10  34%  1p1tA  [d.58.7] CLEAVAGE STIMULATION FACTOR, 64 KDA SUBUNIT
    8e-10  30%  2dh7A  [x.x.x] NUCLEOLYSIN TIAR
    1e-09  37%  2dnzA  [x.x.x] PROBABLE RNA-BINDING PROTEIN 23
    3e-09  36%  2jrsA  [x.x.x] RNA-BINDING PROTEIN 39
    3e-09  27%  2g4bA  [x.x.x] SPLICING FACTOR U2AF 65 KDA SUBUNIT
    4e-09  38%  2sxlA  [x.x.x] SEX-LETHAL PROTEIN
    5e-09  28%  1fjeB  [d.58.7 - d.58.7] NUCLEOLIN RBD12
    8e-09  31%  1x5sA  [x.x.x] COLD-INDUCIBLE RNA-BINDING PROTEIN
    1e-08  32%  2u2fA  [d.58.7] PROTEIN (SPLICING FACTOR U2AF 65 KD SUBUNIT)
    1e-08  37%  2cqiA  [x.x.x] NUCLEOLYSIN TIAR
    9e-08  32%  1u6fA  [x.x.x] RNA-BINDING PROTEIN UBP1
    9e-08  33%  2ghpB  [x.x.x] U4/U6 SNRNA-ASSOCIATED SPLICING FACTOR PRP24
    9e-08  33%  1d8zA  [d.58.7] HU ANTIGEN C
    9e-08  32%  3bs9A  [x.x.x] NUCLEOLYSIN TIA-1 ISOFORM P40
    2e-07  37%  2cq0A  [x.x.x] EUKARYOTIC TRANSLATION INITIATION FACTOR 3
    2e-07  35%  2e5hA  [x.x.x] ZINC FINGER CCHC-TYPE AND RNA-BINDING MOTIF-
    4e-07  28%  1p27B  [d.58.7] RNA-BINDING PROTEIN 8A
    4e-07  28%  2j0sD  [x.x.x] RNA-BINDING PROTEIN 8A
    4e-07  28%  2hyiB  [x.x.x] RNA-BINDING PROTEIN 8A
    4e-07  28%  3ex7B  [x.x.x] RNA-BINDING PROTEIN 8A
    5e-07  28%  2divA  [x.x.x] TRNA SELENOCYSTEINE ASSOCIATED PROTEIN
    5e-07  35%  1d9aA  [d.58.7] HU ANTIGEN C
    6e-07  26%  1n54B  [d.58.7] 20 KDA NUCLEAR CAP BINDING PROTEIN
    6e-07  35%  2ghpA  [x.x.x] U4/U6 SNRNA-ASSOCIATED SPLICING FACTOR PRP24
    8e-07  29%  1n52B  [d.58.7] 20 KDA NUCLEAR CAP BINDING PROTEIN
    8e-07  29%  1h2vZ  [d.58.7] 20 KDA NUCLEAR CAP BINDING PROTEIN
    8e-07  29%  1h2uY  [d.58.7] 20 KDA NUCLEAR CAP BINDING PROTEIN
    8e-07  29%  1h2uX  [d.58.7] 20 KDA NUCLEAR CAP BINDING PROTEIN
    8e-07  29%  1h2tZ  [d.58.7] 20 KDA NUCLEAR CAP BINDING PROTEIN
    1e-06  36%  2do0A  [x.x.x] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN M
    2e-06  38%  2dguA  [x.x.x] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN Q
    2e-06  31%  2dgsA  [x.x.x] DAZ-ASSOCIATED PROTEIN 1
    3e-06  34%  1x5oA  [x.x.x] RNA BINDING MOTIF, SINGLE-STRANDED INTERACTING
    3e-06  35%  2cqcA  [x.x.x] ARGININE/SERINE-RICH SPLICING FACTOR 10
    3e-06  29%  2cpzA  [x.x.x] CUG TRIPLET REPEAT RNA-BINDING PROTEIN 1
    3e-06  29%  2cphA  [x.x.x] RNA BINDING MOTIF PROTEIN 19
    7e-06  30%  1h6kZ  [d.58.7] 20 KDA NUCLEAR CAP BINDING PROTEIN
    9e-06  28%  1hl6A  [d.58.7] CG8781 PROTEIN
    9e-06  30%  1h6kY  [d.58.7] 20 KDA NUCLEAR CAP BINDING PROTEIN
    9e-06  30%  1h6kX  [d.58.7] 20 KDA NUCLEAR CAP BINDING PROTEIN
    1e-05  29%  2dhgA  [x.x.x] TRNA SELENOCYSTEINE ASSOCIATED PROTEIN (SECP43)
    1e-05  36%  2dh9A  [x.x.x] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN M
    1e-05  29%  1rk8A  [d.58.7] CG8781-PA PROTEIN
    1e-05  32%  3feyB  [x.x.x] NUCLEAR CAP-BINDING PROTEIN SUBUNIT 2
    1e-05  37%  2dgvA  [x.x.x] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN M
    2e-05  27%  1oo0B  [d.58.7] CG8781-PA
    2e-05  38%  2dnhA  [x.x.x] BRUNO-LIKE 5, RNA BINDING PROTEIN
    2e-05  40%  2dh8A  [x.x.x] DAZ-ASSOCIATED PROTEIN 1
    3e-05  30%  3fexB  [x.x.x] NUCLEAR CAP-BINDING PROTEIN SUBUNIT 2
    3e-05  38%  2fc9A  [x.x.x] NCL PROTEIN
    6e-05  36%  2cqgA  [x.x.x] TAR DNA-BINDING PROTEIN-43
    7e-05  30%  1x4bA  [x.x.x] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEINS A2/B1
    7e-05  40%  2dk2A  [x.x.x] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN R
    1e-04  32%  1sxlA  [x.x.x] SEX-LETHAL PROTEIN PROTEIN
    1e-04  36%  2jwnA  [x.x.x] EMBRYONIC POLYADENYLATE-BINDING PROTEIN 2-B
    1e-04  32%  2dgpA  [x.x.x] BRUNO-LIKE 4, RNA BINDING PROTEIN
    1e-04  33%  1hd0A  [d.58.7] PROTEIN (HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN
    1e-04  38%  2dnkA  [x.x.x] BRUNO-LIKE 4, RNA BINDING PROTEIN
    2e-04  37%  1wtbA  [x.x.x] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN D0
    2e-04  37%  1iqtA  [d.58.7] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN D0
    2e-04  33%  1uawA  [d.58.7] MOUSE-MUSASHI-1
    2e-04  30%  2mssA  [d.58.7] PROTEIN (MUSASHI1)
    2e-04  37%  2fc8A  [x.x.x] NCL PROTEIN
    2e-04  28%  2errA  [x.x.x] ATAXIN-2-BINDING PROTEIN 1
    3e-04  37%  1wg4A  [d.58.7] HYPOTHETICAL PROTEIN (RIKEN CDNA 6030486K23)
    4e-04  29%  1x4gA  [x.x.x] NUCLEOLYSIN TIAR
    4e-04  30%  2cpxA  [x.x.x] HYPOTHETICAL PROTEIN FLJ11016
    5e-04  32%  2i38A  [x.x.x] FUSION PROTEIN CONSISTS OF IMMUNOGLOBIN G-
    5e-04  32%  2i2yA  [x.x.x] FUSION PROTEIN CONSISTS OF IMMUNOGLOBIN G-
    6e-04  26%  1wf1A  [d.58.7] RNA-BINDING PROTEIN RALY
    6e-04  34%  1oiaB  [d.58.7] U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
    6e-04  34%  1oiaA  [d.58.7] U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
    6e-04  34%  1fhtA  [x.x.x] U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
    6e-04  33%  2cq3A  [x.x.x] RNA-BINDING PROTEIN 9
    8e-04  28%  1hl6C  [d.58.7] CG8781 PROTEIN
    8e-04  26%  2dgqA  [x.x.x] BRUNO-LIKE 6, RNA BINDING PROTEIN
    8e-04  31%  2cpdA  [x.x.x] APOBEC-1 STIMULATING PROTEIN
    7e-05  29%  1x5tA  [x.x.x] SPLICING FACTOR 3B SUBUNIT 4(query 20->89)
    1e-06  39%  2ywkA  [x.x.x] PUTATIVE RNA-BINDING PROTEIN 11(query 102->175)
    1e-04  23%  2k8gA  [x.x.x] POLYADENYLATE-BINDING PROTEIN 1(query 3->94)
    3e-08  37%  2cqbA  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE E(query 102->177)
    2e-07  38%  2fy1A  [x.x.x] RNA-BINDING MOTIF PROTEIN, Y CHROMOSOME, FAMILY(query 97->179)
    7e-05  29%  2d9pA  [x.x.x] POLYADENYLATE-BINDING PROTEIN 3(query 2->94)
    4e-08  31%  1p1tA  [d.58.7] CLEAVAGE STIMULATION FACTOR, 64 KDA SUBUNIT(query 101->185)
    2e-07  32%  2dnzA  [x.x.x] PROBABLE RNA-BINDING PROTEIN 23(query 15->86)
    2e-08  36%  2jrsA  [x.x.x] RNA-BINDING PROTEIN 39(query 2->86)
    5e-07  31%  2sxlA  [x.x.x] SEX-LETHAL PROTEIN(query 12->89)
    1e-08  34%  1x5sA  [x.x.x] COLD-INDUCIBLE RNA-BINDING PROTEIN(query 102->191)
    9e-06  27%  2u2fA  [d.58.7] PROTEIN (SPLICING FACTOR U2AF 65 KD SUBUNIT)(query 102->177)
    6e-07  32%  1d8zA  [d.58.7] HU ANTIGEN C(query 96->177)
    1e-04  28%  3bs9A  [x.x.x] NUCLEOLYSIN TIA-1 ISOFORM P40(query 15->90)
    2e-06  30%  2cq0A  [x.x.x] EUKARYOTIC TRANSLATION INITIATION FACTOR 3(query 89->188)
    3e-07  29%  2e5hA  [x.x.x] ZINC FINGER CCHC-TYPE AND RNA-BINDING MOTIF-(query 13->89)
    3e-05  27%  1p27B  [d.58.7] RNA-BINDING PROTEIN 8A(query 15->87)
    3e-05  27%  2j0sD  [x.x.x] RNA-BINDING PROTEIN 8A(query 15->87)
    3e-05  27%  2hyiB  [x.x.x] RNA-BINDING PROTEIN 8A(query 15->87)
    3e-05  27%  3ex7B  [x.x.x] RNA-BINDING PROTEIN 8A(query 15->87)
    4e-06  34%  1d9aA  [d.58.7] HU ANTIGEN C(query 100->177)
    3e-05  31%  1n52B  [d.58.7] 20 KDA NUCLEAR CAP BINDING PROTEIN(query 93->176)
    3e-05  31%  1h2vZ  [d.58.7] 20 KDA NUCLEAR CAP BINDING PROTEIN(query 93->176)
    3e-05  31%  1h2uY  [d.58.7] 20 KDA NUCLEAR CAP BINDING PROTEIN(query 93->176)
    3e-05  31%  1h2uX  [d.58.7] 20 KDA NUCLEAR CAP BINDING PROTEIN(query 93->176)
    3e-05  31%  1h2tZ  [d.58.7] 20 KDA NUCLEAR CAP BINDING PROTEIN(query 93->176)
    1e-05  34%  2dgsA  [x.x.x] DAZ-ASSOCIATED PROTEIN 1(query 102->183)
    4e-04  27%  2cpzA  [x.x.x] CUG TRIPLET REPEAT RNA-BINDING PROTEIN 1(query 2->86)
    4e-04  31%  1h6kZ  [d.58.7] 20 KDA NUCLEAR CAP BINDING PROTEIN(query 102->176)
    5e-04  31%  1h6kY  [d.58.7] 20 KDA NUCLEAR CAP BINDING PROTEIN(query 102->176)
    5e-04  31%  1h6kX  [d.58.7] 20 KDA NUCLEAR CAP BINDING PROTEIN(query 102->176)
    5e-04  33%  2dh8A  [x.x.x] DAZ-ASSOCIATED PROTEIN 1(query 102->159)
    7e-05  33%  3fexB  [x.x.x] NUCLEAR CAP-BINDING PROTEIN SUBUNIT 2(query 102->176)
    8e-04  40%  2cqgA  [x.x.x] TAR DNA-BINDING PROTEIN-43(query 7->61)
    6e-04  28%  2dgpA  [x.x.x] BRUNO-LIKE 4, RNA BINDING PROTEIN(query 2->89)
    3e-04  33%  1hd0A  [d.58.7] PROTEIN (HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN(query 102->160)
    5e-04  39%  1wtbA  [x.x.x] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN D0(query 102->160)
    5e-04  39%  1iqtA  [d.58.7] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN D0(query 102->160)
    5e-04  31%  2errA  [x.x.x] ATAXIN-2-BINDING PROTEIN 1(query 94->180)
    8e-04  29%  2cq3A  [x.x.x] RNA-BINDING PROTEIN 9(query 15->91)
    8e-04  36%  2dgqA  [x.x.x] BRUNO-LIKE 6, RNA BINDING PROTEIN(query 102->163)
:388

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSAGPIVERNQDATIYVGGLDEKVSESILWELMVQAGPVVSVNMPKDRVTANHQGFGFVEFMGEEDADYA
1x5uA           -SSGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYA
1x5tA           ----------------------------------------------------------------------
1cvjG           ------------ASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERA
1cvjC           ------------ASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERA
1cvjA           ------------ASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERA
1cvjD           ------------ASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERA
1cvjB           ------------ASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERA
1cvjH           ------------ASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERA
1cvjF           ------------ASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERA
1fnxH           --------------LIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKA
2qfjB           --------------VYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLA
2cjkA           ----------ESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEV
1fxlA           --------------LIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKA
2ywkA           -------QEEADRTVFVGNLEARVREEILYELFLQAGPLTKVTICKDR-EGKPKSFGFVCFKHPESVSYA
1b7fA           -----------NTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSYGYAFVDFTSEMDSQRA
2k8gA           ----------------------------------------------------------------------
1ha1A           -------EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAA
1u1pA           -------EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAA
2qfjA           --------------VYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWD--VTKHKGFAFVEYEVPEAAQLA
1up1A           -------EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAA
2cqbA           --------------LYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAA
1l3kA           -------EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAA
3sxlA           ----------------------------LYALFRAIGPINTCRI-RDYKTGYSFGYAFVDFTSE-DSQRA
2dhsA           --------------MFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGFVTFYTRKAALEA
2fy1A           -----MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDR-TSKSRGFAFITFENPADAKNA
2dgoA           ----------------------------------------------------------------------
2d9pA           ----------------------------------------------------------------------
1p1tA           ----PAVDRSL-RSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSA
2dh7A           ----------------------------------------------------------------------
2dnzA           ----------------------------------------------------------------------
2jrsA           ----------------------------------------------------------------------
2g4bA           --------------LYVGNIPFGITEEAMMDFLTQANPVLAVQINQDK------NFAFLEFRSVDETTQA
2sxlA           ----------------------------------------------------------------------
1fjeB           -----MVEGSESTTLFIGNLNPNKSVA---ELKVAISELFAKNAVVDVRTGTNRKFGYVDFESAEDLEKA
1x5sA           -SSGSSGMASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDA
2u2fA           --------------LFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQA
2cqiA           ----------QPRTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEH--TSNDPYCFVEFYEHRDAAAA
1u6fA           MNPEPDVLRN----LMVNYIPTTVDEVQLRQLFERYGPIESVKIVCDRETRQSRGYGFVKFQSGSSAQQA
2ghpB           ---------------------------------------LSIRLPSLRFNTSRR-FAYIDVTSKEDARYC
1d8zA           --------------LIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKA
3bs9A           ----------------------------------------------------------------------
2cq0A           -SSGPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARA
2e5hA           ----------------------------------------------------------------------
1p27B           ----------------------------------------------------------------------
2j0sD           ----------------------------------------------------------------------
2hyiB           ----------------------------------------------------------------------
3ex7B           ----------------------------------------------------------------------
2divA           ----------------------------------------------------------------------
1d9aA           -----------DANLYVSGLPKTMSQKEMEQLFSQYGRIITSRILLDQATGVSRGVGFIRFDKRIEAEEA
1n54B           ----------KSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENA
2ghpA           -------------------------------------------------------FAYIDVTSKEDARYC
1n52B           ----------KSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENA
1h2vZ           ----------KSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENA
1h2uY           ----------KSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENA
1h2uX           ----------KSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENA
1h2tZ           ----------KSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENA
2do0A           ----------------------------------------------------------------------
2dguA           ----------------------------------------------------------------------
2dgsA           --------------IFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQA
1x5oA           ----------------------------------------------------------------------
2cqcA           ----------------------------------------------------------------------
2cpzA           ----------------------------------------------------------------------
2cphA           -SSGQVPKKQTTSKILVRNIPFQANQREIRELFSTFGELKTVRLPKKMTTGAHRGFGFVDFITKQDAKKA
1h6kZ           ----------KSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKC---GFCFVEYYSRADAENA
1hl6A           -----------------------------------------------------------EFEVDEDGDQG
1h6kY           ----------KSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMC----GFCFVEYYSRADAENA
1h6kX           ----------KSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMC----GFCFVEYYSRADAENA
2dhgA           ----------------------------------------------------------------------
2dh9A           ----------------------------------------------------------------------
1rk8A           ----------------------------------------------------------------------
3feyB           ----------------------------------------------------------------------
2dgvA           ----------------------------------------------------------------------
1oo0B           ----------------------------------------------------------------------
2dnhA           ----------------------------------------------------------------------
2dh8A           --------------LFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKF---------
3fexB           ----------KSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDTAC----GFCFVEYYSRADAENA
2fc9A           ----------------------------------------------------------------------
2cqgA           ----------------------------------------------------------------------
1x4bA           ----------------------------------------------------------------------
2dk2A           ----------------------------------------------------------------------
1sxlA           ----------------------------------------------------------------------
2jwnA           ----------------------------------------------------------------------
2dgpA           ----------------------------------------------------------------------
1hd0A           --------------MFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVD--
2dnkA           ----------------------------------------------------------------------
1wtbA           --------------IFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEE-----
1iqtA           --------------IFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEE-----
1uawA           --------------MFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVD--
2mssA           --------------IFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKV
2fc8A           -SSGPNARSQPSKTLFVKGLSEDTTEETLKESFDGS---VRARIVTDRETGSSKGFGFVDF---------
2errA           --------KSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNE--RGSKGFGFVTFENSADADRA
1wg4A           --------RRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKD-------GMGMVEYLRKEDMEYA
1x4gA           ----------------------------------------------------------------------
2cpxA           ----------------------------------------------------------------------
2i38A           -----------DCKVYVGNLGNNGNKTELERAFGYYGPLRSV-----WVARNPPGFAFVEFEDPRDAADA
2i2yA           -----------DCKVYVGNLGNNGNKTELERAFGYYGPLRSV-----WVARNPPGFAFVEFEDPRDAADA
1wf1A           ----------------------------------------------------------------------
1oiaB           ----------------------------------------------------------------------
1oiaA           ----------------------------------------------------------------------
1fhtA           ----------------------------------------------------------------------
2cq3A           ----------------------------------------------------------------------
1hl6C           -----------------------------------------------------------EFEVDEDGDQG
2dgqA           -SSGVPMKDHDAIKLFVGQIPRGLDEQDLKPLFEEFGRIYELTVLKDRLTGLHKGCAFLTYCARDSALKA
2cpdA           ----------------------------------------------------------------------
1x5tA           -------------------LDPEIDEKLLYDTFSAFGVILQTKIMRDPDTGNSKGYAFINFASFDASDAA
2ywkA           ----------------------------------------------------------------------
2k8gA           --ADPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDE--NGSKGYGFVHFETQEAAERA
2cqbA           ----------------------------------------------------------------------
2fy1A           ----------------------------------------------------------------------
2d9pA           -SSGDRITRYQVVNLYVKNLDDGIDDERLRKAFSPFGTITSAKVMMEG--GRSKGFGFVCFSSPEEATKA
1p1tA           ----------------------------------------------------------------------
2dnzA           --------------LYVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRA
2jrsA           -SAGPM-------RLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKA
2sxlA           -----------NTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSYGYAFVDFTSEMDSQRA
1x5sA           ----------------------------------------------------------------------
2u2fA           ----------------------------------------------------------------------
1d8zA           ----------------------------------------------------------------------
3bs9A           --------------VFVGDLSPEXXXXXXXXXXXPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENA
2cq0A           ----------------------------------------------------------------------
2e5hA           ------------STVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNC
1p27B           --------------LFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAA
2j0sD           --------------LFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAA
2hyiB           --------------LFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAA
3ex7B           --------------LFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAA
1d9aA           ----------------------------------------------------------------------
1n52B           ----------------------------------------------------------------------
1h2vZ           ----------------------------------------------------------------------
1h2uY           ----------------------------------------------------------------------
1h2uX           ----------------------------------------------------------------------
1h2tZ           ----------------------------------------------------------------------
2dgsA           ----------------------------------------------------------------------
2cpzA           -AAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAA
1h6kZ           ----------------------------------------------------------------------
1h6kY           ----------------------------------------------------------------------
1h6kX           ----------------------------------------------------------------------
2dh8A           ----------------------------------------------------------------------
3fexB           ----------------------------------------------------------------------
2cqgA           ------VQKTSD--LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRF---------
2dgpA           -SSGSSGMKDHDAILFIGQIPRNLDEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCERESALKA
1hd0A           ----------------------------------------------------------------------
1wtbA           ----------------------------------------------------------------------
1iqtA           ----------------------------------------------------------------------
2errA           ----------------------------------------------------------------------
2cq3A           --------------LHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNE--RGSKGFGFVTFENSADADRA
2dgqA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IKILNMIKLYGKPIKVNKASAHEKNMDVGANIFVGNLDPEVDEKLLYDTFSAFGVILQVPKIMRDVDSGT
1x5uA           IKIMDMIKLYGKPIRVNKASAHNKNL--------------------------------------------
1x5tA           -----------------------------------NLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGN
1cvjG           LDTMNFDVIKGKPVRISQRDPSLRKSGVG-NIFIKNLDKSIDNKALYDTFSAFGNILSCKVV---CDENG
1cvjC           LDTMNFDVIKGKPVRISQRDPSLRKSGVG-NIFIKNLDKSIDNKALYDTFSAFGNILSCKVV---CDENG
1cvjA           LDTMNFDVIKGKPVRISQRDPSLRKSGVG-NIFIKNLDKSIDNKALYDTFSAFGNILSCKVV---CDENG
1cvjD           LDTMNFDVIKGKPVRISQRDPSLRKSGVG-NIFIKNLDKSIDNKALYDTFSAFGNILSCKVV-------C
1cvjB           LDTMNFDVIKGKPVRISQRDPSLRKSGVG-NIFIKNLDKSIDNKALYDTFSAFGNILSCKVV-------C
1cvjH           LDTMNFDVIKGKPVRISQRDPSLRKSGVG-NIFI---------KALYDTFSAFGNILSCKVV-------C
1cvjF           LDTMNFDVIKGKPVRIMWSQRDPSLRKSG----VGNIN-----KALYDTFSAFGNILSCKVV-------C
1fnxH           INTLNGLKLQTKTIKVSYARPSSASIR-DANLYVSGLPKTMSQKEMEQLFSQYGRII-TSRILLDQATGV
2qfjB           LEQMNSVMLGGRNIKVGRPSNIGQAQPIFNRIYVASVHQDLSDDDIKSVFEAFGKI-KSATLARDPTTGK
2cjkA           VKTQHI--LDGKVIDPKRAIPRDE-QDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDA-QLMLDKDTGQ
1fxlA           INTLNGLRLQTKTIKVSYARPSSASIR-DANLYVSGLPKTMTQKELEQLFSQYGRII-TSRILVDQVTGV
2ywkA           IALLNGIRLYGRPINVSGPSS-------------------------------------------------
1b7fA           IKVLNGITVRNKRLKVSYARPGGESIK-DTNLYVTNLPRTITDDQLDTIFGKYGSIVQ-KNILRDKLTGR
2k8gA           ------------------------------NIFIKNLDKSIDNKALYDTFSAFGNILSCKVV---CDENG
1ha1A           MN-ARPHKVDGRVVEPKRAVSREAHLTV-KKIFVGGIKEDTEEHHLRDYFEQYGKI-EVIEIMTDRGSGK
1u1pA           MN-ARPHKVDGRVVEPKRAVSREDSQRPGAHIFVGGIKEDTEEHHLRDYFEQYGKI-EVIEIMTDRGSGK
2qfjA           LEQMNSVMLVGRPSNIGQAQPIIDQLAEEARIYVASVHQDLSDDDIKSVFEAFGKIKSAT-LARDPTTGK
1up1A           MN-ARPHKVDGRVVEPKRAVSRGAHLTV-KKIFVGGIKEDTEEHHLRDYFEQYGKI-EVIEIMTDRGSGK
2cqbA           IDNMNESELFGRTIRVNLA---------------------------------------------------
1l3kA           MN-ARPHKVDGRVVEPKRAVSTVK------KIFVGGIKEDTEEHHLRDYFEQYGKI-EVIEIMTDRGSGK
3sxlA           IKVLNGITVRNKRLKVSYARPESIK---DTNLYVTNLPRTITDDQLDTIFGKYGSIVQ-KNILRDKLTGR
2dhsA           QNALHNMKVLPHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEEC-RILRGPD-GL
2fy1A           AKDMNGKSLHGKAIKVEQA---------------------------------------------------
2dgoA           ------------------SSGQKKDTSNHFHVFVGDLSPEITTEDIKAAFAPFGRISDA-RVVKDMATGK
2d9pA           ------------------------------NLYVKNLDDGIDDERLRKAFSPFGTITSAKVMM---EGGR
1p1tA           MRNLNGREFSGRALRVDNA-ASEKNKE-------------------------------------------
2dh7A           ------------------SSGQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDA-RVVKDMATGK
2dnzA           -------------------------------LYVGSLHFNITEDMLRGIFEPFGKIDNIV-LMKDSDTGR
2jrsA           -------------------------------LYVGSLHFNITEDMLRGIFEPFGRIESI-QLMMDSETGR
2g4bA           MAFDGII-FQGQSLKIRRP--HDYQPLPGAHLFIGGLPNYLNDDQVKELLTSFGP-LKAFNLVKDSATGL
2sxlA           ------------------------------NLIVNYLPQDMTDRELYALFRAIGPI-NTCRIMRDYKTGY
1fjeB           LELTGL-KVFGNEIKLEKPKGRDKKVRAARTLLAKNLSFNITEDELKEVFED---ALEIRLVSQD---GK
1x5sA           MMAMNGKSVDGRQIRVDQAGKSSDN---------------------------------------------
2u2fA           IAGLNGMQLGDKKLLVQRASVGAKN---------------------------------------------
2cqiA           LAAMNGRKILGKEVKVNWAT--------------------------------------------------
1u6fA           IAGLNGFNILNKRLKVALAASGHQRPGIAGAVGDGN----------------------------------
2ghpB           VEKLNGLKIEGYTL-VTKVS---NPLTLEGREIIRNLSTELDENLLRESFEGFG---SIEKINIPAGQKF
1d8zA           INTLNGLKLQTKTIKVSYA---------------------------------------------------
3bs9A           ------------------------------HVFVGDLSPEXXXXXXXXXXXPFGRISDA-RVVKDMATGK
2cq0A           I---------------------------------------------------------------------
2e5hA           -----------------------------STVYVSNLPFSLTNNDLYRIFSKYGKVVKVT-IMKDKDTRK
1p27B           -------------------------------LFVTGVHEEATEEDIHDKFAEYGEIKNI-HLNLDRRTGY
2j0sD           -------------------------------LFVTGVHEEATEEDIHDKFAEYGEIKNI-HLNLDRRTGY
2hyiB           -------------------------------LFVTGVHEEATEEDIHDKFAEYGEIKNI-HLNLDRRTGY
3ex7B           -------------------------------LFVTGVHEEATEEDIHDKFAEYGEIKNI-HLNLDRRTGY
2divA           ---------------------------MAASLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGI
1d9aA           IKGLNGQKPLGEPITVKFAN--------------------------------------------------
1n54B           MRYINGTRLDDRIIRTDWDAGFKEGRQYG-----------------------------------------
2ghpA           VEKLNGLKIEGYTL-VTKVS---NPLTLEGREIIRNLSTELDENLLRESFEGFG---SIEKINIPAGQKF
1n52B           MRYINGTRLDDRIIRTD-----------------------------------------------------
1h2vZ           MRYINGTRLDDRIIRTD-----------------------------------------------------
1h2uY           MRYINGTRLDDRIIRTD-----------------------------------------------------
1h2uX           MRYINGTRLDDRIIRTD-----------------------------------------------------
1h2tZ           MRYINGTRLDDRIIRTD-----------------------------------------------------
2do0A           -------------------------------VFVANLDYKVGWKKLKEVFSMAGVVVRA-DILEDKD-GK
2dguA           -------------------------------LFVRNLANTVTEEILEKAFSQFGKLERVKKL--------
2dgsA           VN-MHFHDIMGKKVEVKRAEPRD-----------------------------------------------
1x5oA           ------------------------------NLYISNLPLSMDEQELENMLKPFGQVIST-RILRD-SSGT
2cqcA           ------------------SSGNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADV-SIVYDQQSRR
2cpzA           ------------------AAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSA-KVFIDKQTNL
2cphA           FNALHSTHLYGRRLVLEWADS-------------------------------------------------
1h6kZ           MRYINGTRLDDRIIRTD-----------------------------------------------------
1hl6A           I------------VRLKEKAKHRKGRGFGPGLFVTSIHEEAQEDEIQEKFCDYGEIKNI-HLNLDRRTGF
1h6kY           MRYINGTRLDDRIIRTD-----------------------------------------------------
1h6kX           MRYINGTRLDDRIIRTD-----------------------------------------------------
2dhgA           ------------------------------SLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLD-QTGV
2dh9A           -----------------------------SGIFVRNLPFDFTWKMLKDKFNECGHVLYADIKM---ENGK
1rk8A           ---------------------------VGWILFVTSIHEEAQEDEIQEKFCDYGEIKNI-HLNLDRRTGF
3feyB           ----------------------EKLLKKSCTLYVGNLSFYTTEEQIYELFSKSG---DIKKIIMGLD--T
2dgvA           -------------------------------IFVRNLPFDFTWKMLKDKFNECGHVLYADIKM---ENGK
1oo0B           -------------------------------LFVTSIHEEAQEDEIQEKFCDYGEIKNI-HLNLDRRTGF
2dnhA           -------------------------------LFVGMLNKQQSEEDVLRLFQPFGVIDECT-VLRGPD-GS
2dh8A           ----------------------------------------------------------------------
3fexB           MRYINGTRLDDRIIRTD-----------------------------------------------------
2fc9A           -------------------------------LVLSNLSYSATEETLQEVFEK-ATFIKVPQNQ----NGK
2cqgA           -----------------------------SDLIVLGLPWKTTEQDLKEYFSTFGEVLMV-QVKKDLKTGH
1x4bA           -------------------------------LFIGGLSFETTEESLRNYYEQWGKLTDCV-VMRDPASKR
2dk2A           -------------------------------LFVRNLATTVTEEILEKSFSEFGKLERVKKL--------
1sxlA           ------------------------------NLYVTNLPRTITDDQLDTIFGKYGSIVQ-KNILRDKLTGR
2jwnA           -------------------SAEEKKEIDKRSVYVGNVDYGSTAQDLEAHFSSCGSINRIT-ILCDKFSGH
2dgpA           -------------------------------LFIGQIPRNLDEKDLKPLFEEFGKIYEL-TVLKDRFTGM
1hd0A           -KVMDQHKLNGKVIDPKRA---------------------------------------------------
2dnkA           -------------------------------LFVGMLNKQQSEDDVRRLFEAFGNIEECT-ILRGPD-GN
1wtbA           ----------------------------------------------------------------------
1iqtA           ----------------------------------------------------------------------
1uawA           ----------------------------------------------------------------------
2mssA           CEI-HFHEINNKMVECKKA---------------------------------------------------
2fc8A           ----------------------------------------------------------------------
2errA           REKLHGTVVEGRKIEVNNATA-------------------------------------------------
1wg4A           LRKLDDTK--------------------------------------------------------------
1x4gA           -------------------------------VYCGGIASGLTDQLMRQTFSPFGQIMEIRVF-------P
2cpxA           -------------------------------LYLKNLSPRVTERDLVSLFARFQE-KKGPPIQFRMMTGR
2i38A           VRDLDGRTLCGCRVRVELSNGEKR----------------------------------------------
2i2yA           VRELDGRTLCGCRVRVELSNGEKR----------------------------------------------
1wf1A           -------------LKLQASNVTNKNKSINSRVFIGNLNTALVKKSDVETFSKYG---------RVAGCSV
1oiaB           -------------------------------IYINNLNEKIKKKSLYAIFSQFGQILDI-LVSRSLKM--
1oiaA           -------------------------------IYINNLNEKIKKKSLYAIFSQFGQILDI-LVSRSLKM--
1fhtA           -------------------------------IYINNLNEKIKKKSLYAIFSQFGQILDI-LVSRSLKM--
2cq3A           -------------------------------LHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGS--
1hl6C           IVRL---KEKAKHRKGRGFPGPQRSVE-GWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNL------F
2dgqA           QSALHEQKTMNRPIQVKPAA--------------------------------------------------
2cpdA           ------------------SSGDEDTMSSVKILYVRNLMLSTSEEMIEKEFNNIGAVERVKKI--------
1x5tA           IEAMNGQYLCNRPITVSYA---------------------------------------------------
2ywkA           -------------------------------VFVGNLEARVREEILYELFLQAGPLTKV-TICKDRE-GK
2k8gA           IEKMNGMLLNDRKVFVGRFKSRKE----------------------------------------------
2cqbA           -------------------------------LYVGGLAEEVDDKVLHAAFIPFGDITDI-QIPLDYETEK
2fy1A           --------------------------DHPGKLFIGGLNRETNEKMLKAVFGKHGPISEV-LLIKDRTS-K
2d9pA           VTEMNGRIVATKPLYVALAQRKEE----------------------------------------------
1p1tA           ------------------------------SVFVGNIPYEATEEQLKDIFSEVGPVVSF-RLVYDRETGK
2dnzA           LEQLNGFELAGRPMRV------------------------------------------------------
2jrsA           LEQLNGFELAGRPMKV------------------------------------------------------
2sxlA           IKVLNGITVRNKRLKVSYA---------------------------------------------------
1x5sA           -------------------------------LFVGGLSFDTNEQSLEQVFSKYGQISEVV-VVKDRETQR
2u2fA           -------------------------------LFIGGLPNYLNDDQVKELLTSFGP-LKAFNLVKDSATGL
1d8zA           -------------------------MDSKTNLIVNYLPQNMTQDEFKSLFGSIGDI-ESCKLVRDKITGQ
3bs9A           IQQMGGQWLGGRQIRTNWAT--------------------------------------------------
2cq0A           ------------------SSGPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRI-YLAKDKTTGQ
2e5hA           TRAINNKQLFGRVIKASIA---------------------------------------------------
1p27B           MEGLNGQDLMGQPISVD-----------------------------------------------------
2j0sD           MEGLNGQDLMGQPISVD-----------------------------------------------------
2hyiB           MEGLNGQDLMGQPISVD-----------------------------------------------------
3ex7B           MEGLNGQDLMGQPISVD-----------------------------------------------------
1d9aA           -----------------------------ANLYVSGLPKTMSQKEMEQLFSQYGRII-TSRILLDQATGV
1n52B           ----------------------EKLLKKSCTLYVGNLSFYTTEEQIYELFSKSG---DIKKIIMGLDKKT
1h2vZ           ----------------------EKLLKKSCTLYVGNLSFYTTEEQIYELFSKSG---DIKKIIMGLDKKT
1h2uY           ----------------------EKLLKKSCTLYVGNLSFYTTEEQIYELFSKSG---DIKKIIMGLDKKT
1h2uX           ----------------------EKLLKKSCTLYVGNLSFYTTEEQIYELFSKSG---DIKKIIMGLDKKT
1h2tZ           ----------------------EKLLKKSCTLYVGNLSFYTTEEQIYELFSKSG---DIKKIIMGLDKKT
2dgsA           -------------------------------IFVGGIPHNCGETELREYFKKFGVVTEVVMIY-DAEKQR
2cpzA           IQSMNGFQIGMKRLKV------------------------------------------------------
1h6kZ           -------------------------------LYVGNLSFYTTEEQIYELFSKSG---DIKKIIMGLDK-M
1h6kY           -------------------------------LYVGNLSFYTTEEQIYELFSKSG---DIKKIIMGLDK--
1h6kX           -------------------------------LYVGNLSFYTTEEQIYELFSKSG---DIKKIIMGLDK--
2dh8A           -------------------------------LFVGGLDWSTTQETLRSYFSQYGEVVDCV-IMKDKTTNQ
3fexB           -------------------------------LYVGNLSFYTTEEQIYELFSKSG---DIKKIIMGLD--T
2cqgA           ----------------------------------------------------------------------
2dgpA           QSALHEQKTMNRPIQVKPA---------------------------------------------------
1hd0A           -------------------------------MFIGGLSWDTTKKDLKDYFSKFGEVVDC-TLKLDPITGR
1wtbA           -------------------------------IFVGGLSPDTPEEKIREYFGGFG---EVESIELPMDNKT
1iqtA           -------------------------------IFVGGLSPDTPEEKIREYFGGFG---EVESIELPMDNKT
2errA           -----------------------ENKSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGS--
2cq3A           REKLHGTVVEGRKIEVNNATA-------------------------------------------------
2dgqA           -------------------------------LFVGQIPRGLDEQDLKPLFEEFGRIYEL-TVLKDRLTGL


                         +         .         .         .         .         *         .:210
query           SKGFAFINFASFEASDTALEAMNGQFLCNRAITVSYAFKRDSKGERHGTAAERMLAAQNPLFPKDRPHQx
1x5uA           ----------------------------------------------------------------------
1x5tA           SKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAF--------------------------------
1cvjG           SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFV------------------------------------
1cvjC           SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFV------------------------------------
1cvjA           SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFV------------------------------------
1cvjD           SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFV------------------------------------
1cvjB           SKGYGFVHFETQEAAERAIEKMNGRF--------------------------------------------
1cvjH           SKGYGFVHFETQEAAE------------------------------------------------------
1cvjF           SKGYGFVHFETQE---------------------------------------------------------
1fnxH           SRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAITVKFA---------------------------------
2qfjB           HKGYGFIEYEKAQSSQDAVSSMNGQYLVGKAVT-------------------------------------
2cjkA           SRGFGFVTYDSADAVD------------------------------------------------------
1fxlA           SRGVGFIRFDKRIEAEEAIKGLNGQ---------------------------------------------
2ywkA           ----------------------------------------------------------------------
1b7fA           PRGVAFVRYNKREEAQEAISALN-----------------------------------------------
2k8gA           SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFV------------------------------------
1ha1A           KRGFAFVTFDDHDSVD------------------------------------------------------
1u1pA           KRGFAFVTFDDHDSVD------------------------------------------------------
2qfjA           HKGYGFIEYEKAQSSQDAVSSMNGQYLVGKAVT-------------------------------------
1up1A           KRGFAFVTFDDHDSVD------------------------------------------------------
2cqbA           ----------------------------------------------------------------------
1l3kA           KRGFAFVTFDDHDSVD------------------------------------------------------
3sxlA           PRGVAFVRYNKREEAQEAISALN-----------------------------------------------
2dhsA           SRGCAFVTFTTRAMAQTAIKAMH-----------------------------------------------
2fy1A           ----------------------------------------------------------------------
2dgoA           SKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRK------------------------------
2d9pA           SKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEER---------------------------
1p1tA           ----------------------------------------------------------------------
2dh7A           SKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRK------------------------------
2dnzA           SKGYGFITFSDSECARRALEQLNGFELAGRPMRVGHVTER------------------------------
2jrsA           SKGYGFITFSDSECAKKALEQLNGFELAGRPMKVGHVTER------------------------------
2g4bA           SKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRA---------------------------------
2sxlA           SYGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYA---------------------------------
1fjeB           SKGIAYIEFKSEADAEKNLEEKQGAEIDGRSVSLYY----------------------------------
1x5sA           ----------------------------------------------------------------------
2u2fA           ----------------------------------------------------------------------
2cqiA           ----------------------------------------------------------------------
1u6fA           ----------------------------------------------------------------------
2ghpB           NNCCAFV----FENKDSAERALNRSLLGNREISVSLADKK------------------------------
1d8zA           ----------------------------------------------------------------------
3bs9A           SKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWA---------------------------------
2cq0A           ----------------------------------------------------------------------
2e5hA           SKGVAFILFLDKDSAQNCTRAINNKQLFGRVIKASIA---------------------------------
1p27B           LKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVR------------------------------
2j0sD           LKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVR------------------------------
2hyiB           LKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVR------------------------------
3ex7B           LKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVR------------------------------
2divA           PAGYCFVEFADLATAEKCLHKINGK---------------------------------------------
1d9aA           ----------------------------------------------------------------------
1n54B           ----------------------------------------------------------------------
2ghpA           NNCCAFV----FENKDSAERALNRSLLGNREISVSLADKK------------------------------
1n52B           ----------------------------------------------------------------------
1h2vZ           ----------------------------------------------------------------------
1h2uY           ----------------------------------------------------------------------
1h2uX           ----------------------------------------------------------------------
1h2tZ           ----------------------------------------------------------------------
2do0A           SRGIGTVTFEQSIEAVQAISMFNGQLLFDRPMHVKMDERALPKGD---------------FFPPERPQQ-
2dguA           -KDYAFIHFDERDGAVKAMEEMNGKDLEGENIEIVFAKPPDQK--RKERKAQRQAAS-------------
2dgsA           ----------------------------------------------------------------------
1x5oA           SRGVGFARMESTEKCEAVIGHFNGKFI-------------------------------------------
2cqcA           SRGFAFVYFENVDDAKEAKERANGMELDGRRIRVS-----------------------------------
2cpzA           SKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLRSKNDSK---------------------------
2cphA           ----------------------------------------------------------------------
1h6kZ           ----------------------------------------------------------------------
1hl6A           SKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCF--------------------------------
1h6kY           ----------------------------------------------------------------------
1h6kX           ----------------------------------------------------------------------
2dhgA           SKGYGFVKFTELEQKRALTECQGAVGLGSKPVRLSVAIPKASR---------------------------
2dh9A           SKGCGVVKFESPEVAERACRMMNGMKLSGREIDV--RIDRNASGPSSG----------------------
1rk8A           SKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCF--------------------------------
3feyB           ACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDW----------------------------------
2dgvA           SKGCGVVKFESPEVAERACRMMNGMKLSGREIDV--RIDRNASGPSSG----------------------
1oo0B           SKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVKGPK---------------------------
2dnhA           SKGCAFVKFSSHTEAQAAIHALHG----------------------------------------------
2dh8A           ----------------------------------------------------------------------
3fexB           ----------------------------------------------------------------------
2fc9A           SKGYAFIEFASFEDAKEALNSCNKREIEGRAI--------------------------------------
2cqgA           SKGFGFVRFTEYE---------------------------------------------------------
1x4bA           SRGFGFVTFSSMAEVDAAM-AARPHSIDGRVVEPKRAVAREESG--------------------------
2dk2A           -KDYAFVHFEDRGAAVKAMDEMNGK---------------------------------------------
1sxlA           PRGVAFVRYNKREEAQEAISALN-----------------------------------------------
2jwnA           PKGYAYIEFAERNSVDAAV-AMDETVFRGRTIKV------------------------------------
2dgpA           HKGCAFLTYCERESALKAQSALHEQ---------------------------------------------
1hd0A           ----------------------------------------------------------------------
2dnkA           SKGCAFVKYSSHAEAQAAINALHG----------------------------------------------
1wtbA           ----------------------------------------------------------------------
1iqtA           ----------------------------------------------------------------------
1uawA           ----------------------------------------------------------------------
2mssA           ----------------------------------------------------------------------
2fc8A           ----------------------------------------------------------------------
2errA           ----------------------------------------------------------------------
1wg4A           ----------------------------------------------------------------------
1x4gA           EKGYSFVRFSTHESAAHAIVSVNG----------------------------------------------
2cpxA           MRGQAFITFPNKEIAWQALHLVNGYKLYGKILVIEFGKKQRSSGPSSG----------------------
2i38A           ----------------------------------------------------------------------
2i2yA           ----------------------------------------------------------------------
1wf1A           HKGYAFVQYSNERHARAAVLGENGRVLAGQTLDINMA--GEPKPDRSGPSS-------------------
1oiaB           -RGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYA-KTDS----------------------------
1oiaA           -RGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYA-KTDS----------------------------
1fhtA           -RGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYA-KTDS----------------------------
2cq3A           -KGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATAR------------------------------
1hl6C           SKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCF--------------------------------
2dgqA           ----------------------------------------------------------------------
2cpdA           -RDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTLAVDKDSSGPSSG----------------------
1x5tA           ----------------------------------------------------------------------
2ywkA           PKSFGFVCFKHPESVSYAIALLNGIRLYGRPINVS-----------------------------------
2k8gA           ----------------------------------------------------------------------
2cqbA           HRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLA---------------------------------
2fy1A           SRGFAFITFENPADAKNAAKDMNGKSLHGKAIKVEQAKK-------------------------------
2d9pA           ----------------------------------------------------------------------
1p1tA           PKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE-------------------------
2dnzA           ----------------------------------------------------------------------
2jrsA           ----------------------------------------------------------------------
2sxlA           ----------------------------------------------------------------------
1x5sA           SRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGK--SSDNRSGPSS-------------------
2u2fA           SKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRA---------------------------------
1d8zA           SLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSYA---------------------------------
3bs9A           ----------------------------------------------------------------------
2cq0A           SKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAKPSTNSGPSSG----------------------
2e5hA           ----------------------------------------------------------------------
1p27B           ----------------------------------------------------------------------
2j0sD           ----------------------------------------------------------------------
2hyiB           ----------------------------------------------------------------------
3ex7B           ----------------------------------------------------------------------
1d9aA           SRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAITVKFA---------------------------------
1n52B           ACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDW----------------------------------
1h2vZ           ACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDW----------------------------------
1h2uY           ACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDW----------------------------------
1h2uX           ACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDW----------------------------------
1h2tZ           ACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDW----------------------------------
2dgsA           PRGFGFITFEDEQSVDQAVN-MHFHDIMGKKVEVKRAEPRDSK---------------------------
2cpzA           ----------------------------------------------------------------------
1h6kZ           KCGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDW----------------------------------
1h6kY           MCGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDW----------------------------------
1h6kX           MCGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDW----------------------------------
2dh8A           SRGFGFVKFKDPNCVGTVL---------------------------------------------------
3fexB           ACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDW----------------------------------
2cqgA           ----------------------------------------------------------------------
2dgpA           ----------------------------------------------------------------------
1hd0A           SRGFGFVLFKESESVDKVMD--------------------------------------------------
1wtbA           NKGFCFITFKEEEPVKKIME--------------------------------------------------
1iqtA           NKGFCFITFKEEEPVKKIME--------------------------------------------------
2errA           -KGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATAR------------------------------
2cq3A           ----------------------------------------------------------------------
2dgqA           HKGCAFLTYC---ARDSALKAQS-----------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1x5uA           ----------------------------------------------------------------------
1x5tA           ----------------------------------------------------------------------
1cvjG           ----------------------------------------------------------------------
1cvjC           ----------------------------------------------------------------------
1cvjA           ----------------------------------------------------------------------
1cvjD           ----------------------------------------------------------------------
1cvjB           ----------------------------------------------------------------------
1cvjH           ----------------------------------------------------------------------
1cvjF           ----------------------------------------------------------------------
1fnxH           ----------------------------------------------------------------------
2qfjB           ----------------------------------------------------------------------
2cjkA           ----------------------------------------------------------------------
1fxlA           ----------------------------------------------------------------------
2ywkA           ----------------------------------------------------------------------
1b7fA           ----------------------------------------------------------------------
2k8gA           ----------------------------------------------------------------------
1ha1A           ----------------------------------------------------------------------
1u1pA           ----------------------------------------------------------------------
2qfjA           ----------------------------------------------------------------------
1up1A           ----------------------------------------------------------------------
2cqbA           ----------------------------------------------------------------------
1l3kA           ----------------------------------------------------------------------
3sxlA           ----------------------------------------------------------------------
2dhsA           ----------------------------------------------------------------------
2fy1A           ----------------------------------------------------------------------
2dgoA           ----------------------------------------------------------------------
2d9pA           ----------------------------------------------------------------------
1p1tA           ----------------------------------------------------------------------
2dh7A           ----------------------------------------------------------------------
2dnzA           ----------------------------------------------------------------------
2jrsA           ----------------------------------------------------------------------
2g4bA           ----------------------------------------------------------------------
2sxlA           ----------------------------------------------------------------------
1fjeB           ----------------------------------------------------------------------
1x5sA           ----------------------------------------------------------------------
2u2fA           ----------------------------------------------------------------------
2cqiA           ----------------------------------------------------------------------
1u6fA           ----------------------------------------------------------------------
2ghpB           ----------------------------------------------------------------------
1d8zA           ----------------------------------------------------------------------
3bs9A           ----------------------------------------------------------------------
2cq0A           ----------------------------------------------------------------------
2e5hA           ----------------------------------------------------------------------
1p27B           ----------------------------------------------------------------------
2j0sD           ----------------------------------------------------------------------
2hyiB           ----------------------------------------------------------------------
3ex7B           ----------------------------------------------------------------------
2divA           ----------------------------------------------------------------------
1d9aA           ----------------------------------------------------------------------
1n54B           ----------------------------------------------------------------------
2ghpA           ----------------------------------------------------------------------
1n52B           ----------------------------------------------------------------------
1h2vZ           ----------------------------------------------------------------------
1h2uY           ----------------------------------------------------------------------
1h2uX           ----------------------------------------------------------------------
1h2tZ           ----------------------------------------------------------------------
2do0A           ----------------------------------------------------------------------
2dguA           ----------------------------------------------------------------------
2dgsA           ----------------------------------------------------------------------
1x5oA           ----------------------------------------------------------------------
2cqcA           ----------------------------------------------------------------------
2cpzA           ----------------------------------------------------------------------
2cphA           ----------------------------------------------------------------------
1h6kZ           ----------------------------------------------------------------------
1hl6A           ----------------------------------------------------------------------
1h6kY           ----------------------------------------------------------------------
1h6kX           ----------------------------------------------------------------------
2dhgA           ----------------------------------------------------------------------
2dh9A           ----------------------------------------------------------------------
1rk8A           ----------------------------------------------------------------------
3feyB           ----------------------------------------------------------------------
2dgvA           ----------------------------------------------------------------------
1oo0B           ----------------------------------------------------------------------
2dnhA           ----------------------------------------------------------------------
2dh8A           ----------------------------------------------------------------------
3fexB           ----------------------------------------------------------------------
2fc9A           ----------------------------------------------------------------------
2cqgA           ----------------------------------------------------------------------
1x4bA           ----------------------------------------------------------------------
2dk2A           ----------------------------------------------------------------------
1sxlA           ----------------------------------------------------------------------
2jwnA           ----------------------------------------------------------------------
2dgpA           ----------------------------------------------------------------------
1hd0A           ----------------------------------------------------------------------
2dnkA           ----------------------------------------------------------------------
1wtbA           ----------------------------------------------------------------------
1iqtA           ----------------------------------------------------------------------
1uawA           ----------------------------------------------------------------------
2mssA           ----------------------------------------------------------------------
2fc8A           ----------------------------------------------------------------------
2errA           ----------------------------------------------------------------------
1wg4A           ----------------------------------------------------------------------
1x4gA           ----------------------------------------------------------------------
2cpxA           ----------------------------------------------------------------------
2i38A           ----------------------------------------------------------------------
2i2yA           ----------------------------------------------------------------------
1wf1A           ----------------------------------------------------------------------
1oiaB           ----------------------------------------------------------------------
1oiaA           ----------------------------------------------------------------------
1fhtA           ----------------------------------------------------------------------
2cq3A           ----------------------------------------------------------------------
1hl6C           ----------------------------------------------------------------------
2dgqA           ----------------------------------------------------------------------
2cpdA           ----------------------------------------------------------------------
1x5tA           ----------------------------------------------------------------------
2ywkA           ----------------------------------------------------------------------
2k8gA           ----------------------------------------------------------------------
2cqbA           ----------------------------------------------------------------------
2fy1A           ----------------------------------------------------------------------
2d9pA           ----------------------------------------------------------------------
1p1tA           ----------------------------------------------------------------------
2dnzA           ----------------------------------------------------------------------
2jrsA           ----------------------------------------------------------------------
2sxlA           ----------------------------------------------------------------------
1x5sA           ----------------------------------------------------------------------
2u2fA           ----------------------------------------------------------------------
1d8zA           ----------------------------------------------------------------------
3bs9A           ----------------------------------------------------------------------
2cq0A           ----------------------------------------------------------------------
2e5hA           ----------------------------------------------------------------------
1p27B           ----------------------------------------------------------------------
2j0sD           ----------------------------------------------------------------------
2hyiB           ----------------------------------------------------------------------
3ex7B           ----------------------------------------------------------------------
1d9aA           ----------------------------------------------------------------------
1n52B           ----------------------------------------------------------------------
1h2vZ           ----------------------------------------------------------------------
1h2uY           ----------------------------------------------------------------------
1h2uX           ----------------------------------------------------------------------
1h2tZ           ----------------------------------------------------------------------
2dgsA           ----------------------------------------------------------------------
2cpzA           ----------------------------------------------------------------------
1h6kZ           ----------------------------------------------------------------------
1h6kY           ----------------------------------------------------------------------
1h6kX           ----------------------------------------------------------------------
2dh8A           ----------------------------------------------------------------------
3fexB           ----------------------------------------------------------------------
2cqgA           ----------------------------------------------------------------------
2dgpA           ----------------------------------------------------------------------
1hd0A           ----------------------------------------------------------------------
1wtbA           ----------------------------------------------------------------------
1iqtA           ----------------------------------------------------------------------
2errA           ----------------------------------------------------------------------
2cq3A           ----------------------------------------------------------------------
2dgqA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1x5uA           ----------------------------------------------------------------------
1x5tA           ----------------------------------------------------------------------
1cvjG           ----------------------------------------------------------------------
1cvjC           ----------------------------------------------------------------------
1cvjA           ----------------------------------------------------------------------
1cvjD           ----------------------------------------------------------------------
1cvjB           ----------------------------------------------------------------------
1cvjH           ----------------------------------------------------------------------
1cvjF           ----------------------------------------------------------------------
1fnxH           ----------------------------------------------------------------------
2qfjB           ----------------------------------------------------------------------
2cjkA           ----------------------------------------------------------------------
1fxlA           ----------------------------------------------------------------------
2ywkA           ----------------------------------------------------------------------
1b7fA           ----------------------------------------------------------------------
2k8gA           ----------------------------------------------------------------------
1ha1A           ----------------------------------------------------------------------
1u1pA           ----------------------------------------------------------------------
2qfjA           ----------------------------------------------------------------------
1up1A           ----------------------------------------------------------------------
2cqbA           ----------------------------------------------------------------------
1l3kA           ----------------------------------------------------------------------
3sxlA           ----------------------------------------------------------------------
2dhsA           ----------------------------------------------------------------------
2fy1A           ----------------------------------------------------------------------
2dgoA           ----------------------------------------------------------------------
2d9pA           ----------------------------------------------------------------------
1p1tA           ----------------------------------------------------------------------
2dh7A           ----------------------------------------------------------------------
2dnzA           ----------------------------------------------------------------------
2jrsA           ----------------------------------------------------------------------
2g4bA           ----------------------------------------------------------------------
2sxlA           ----------------------------------------------------------------------
1fjeB           ----------------------------------------------------------------------
1x5sA           ----------------------------------------------------------------------
2u2fA           ----------------------------------------------------------------------
2cqiA           ----------------------------------------------------------------------
1u6fA           ----------------------------------------------------------------------
2ghpB           ----------------------------------------------------------------------
1d8zA           ----------------------------------------------------------------------
3bs9A           ----------------------------------------------------------------------
2cq0A           ----------------------------------------------------------------------
2e5hA           ----------------------------------------------------------------------
1p27B           ----------------------------------------------------------------------
2j0sD           ----------------------------------------------------------------------
2hyiB           ----------------------------------------------------------------------
3ex7B           ----------------------------------------------------------------------
2divA           ----------------------------------------------------------------------
1d9aA           ----------------------------------------------------------------------
1n54B           ----------------------------------------------------------------------
2ghpA           ----------------------------------------------------------------------
1n52B           ----------------------------------------------------------------------
1h2vZ           ----------------------------------------------------------------------
1h2uY           ----------------------------------------------------------------------
1h2uX           ----------------------------------------------------------------------
1h2tZ           ----------------------------------------------------------------------
2do0A           ----------------------------------------------------------------------
2dguA           ----------------------------------------------------------------------
2dgsA           ----------------------------------------------------------------------
1x5oA           ----------------------------------------------------------------------
2cqcA           ----------------------------------------------------------------------
2cpzA           ----------------------------------------------------------------------
2cphA           ----------------------------------------------------------------------
1h6kZ           ----------------------------------------------------------------------
1hl6A           ----------------------------------------------------------------------
1h6kY           ----------------------------------------------------------------------
1h6kX           ----------------------------------------------------------------------
2dhgA           ----------------------------------------------------------------------
2dh9A           ----------------------------------------------------------------------
1rk8A           ----------------------------------------------------------------------
3feyB           ----------------------------------------------------------------------
2dgvA           ----------------------------------------------------------------------
1oo0B           ----------------------------------------------------------------------
2dnhA           ----------------------------------------------------------------------
2dh8A           ----------------------------------------------------------------------
3fexB           ----------------------------------------------------------------------
2fc9A           ----------------------------------------------------------------------
2cqgA           ----------------------------------------------------------------------
1x4bA           ----------------------------------------------------------------------
2dk2A           ----------------------------------------------------------------------
1sxlA           ----------------------------------------------------------------------
2jwnA           ----------------------------------------------------------------------
2dgpA           ----------------------------------------------------------------------
1hd0A           ----------------------------------------------------------------------
2dnkA           ----------------------------------------------------------------------
1wtbA           ----------------------------------------------------------------------
1iqtA           ----------------------------------------------------------------------
1uawA           ----------------------------------------------------------------------
2mssA           ----------------------------------------------------------------------
2fc8A           ----------------------------------------------------------------------
2errA           ----------------------------------------------------------------------
1wg4A           ----------------------------------------------------------------------
1x4gA           ----------------------------------------------------------------------
2cpxA           ----------------------------------------------------------------------
2i38A           ----------------------------------------------------------------------
2i2yA           ----------------------------------------------------------------------
1wf1A           ----------------------------------------------------------------------
1oiaB           ----------------------------------------------------------------------
1oiaA           ----------------------------------------------------------------------
1fhtA           ----------------------------------------------------------------------
2cq3A           ----------------------------------------------------------------------
1hl6C           ----------------------------------------------------------------------
2dgqA           ----------------------------------------------------------------------
2cpdA           ----------------------------------------------------------------------
1x5tA           ----------------------------------------------------------------------
2ywkA           ----------------------------------------------------------------------
2k8gA           ----------------------------------------------------------------------
2cqbA           ----------------------------------------------------------------------
2fy1A           ----------------------------------------------------------------------
2d9pA           ----------------------------------------------------------------------
1p1tA           ----------------------------------------------------------------------
2dnzA           ----------------------------------------------------------------------
2jrsA           ----------------------------------------------------------------------
2sxlA           ----------------------------------------------------------------------
1x5sA           ----------------------------------------------------------------------
2u2fA           ----------------------------------------------------------------------
1d8zA           ----------------------------------------------------------------------
3bs9A           ----------------------------------------------------------------------
2cq0A           ----------------------------------------------------------------------
2e5hA           ----------------------------------------------------------------------
1p27B           ----------------------------------------------------------------------
2j0sD           ----------------------------------------------------------------------
2hyiB           ----------------------------------------------------------------------
3ex7B           ----------------------------------------------------------------------
1d9aA           ----------------------------------------------------------------------
1n52B           ----------------------------------------------------------------------
1h2vZ           ----------------------------------------------------------------------
1h2uY           ----------------------------------------------------------------------
1h2uX           ----------------------------------------------------------------------
1h2tZ           ----------------------------------------------------------------------
2dgsA           ----------------------------------------------------------------------
2cpzA           ----------------------------------------------------------------------
1h6kZ           ----------------------------------------------------------------------
1h6kY           ----------------------------------------------------------------------
1h6kX           ----------------------------------------------------------------------
2dh8A           ----------------------------------------------------------------------
3fexB           ----------------------------------------------------------------------
2cqgA           ----------------------------------------------------------------------
2dgpA           ----------------------------------------------------------------------
1hd0A           ----------------------------------------------------------------------
1wtbA           ----------------------------------------------------------------------
1iqtA           ----------------------------------------------------------------------
2errA           ----------------------------------------------------------------------
2cq3A           ----------------------------------------------------------------------
2dgqA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1x5uA           --------------------------------------
1x5tA           --------------------------------------
1cvjG           --------------------------------------
1cvjC           --------------------------------------
1cvjA           --------------------------------------
1cvjD           --------------------------------------
1cvjB           --------------------------------------
1cvjH           --------------------------------------
1cvjF           --------------------------------------
1fnxH           --------------------------------------
2qfjB           --------------------------------------
2cjkA           --------------------------------------
1fxlA           --------------------------------------
2ywkA           --------------------------------------
1b7fA           --------------------------------------
2k8gA           --------------------------------------
1ha1A           --------------------------------------
1u1pA           --------------------------------------
2qfjA           --------------------------------------
1up1A           --------------------------------------
2cqbA           --------------------------------------
1l3kA           --------------------------------------
3sxlA           --------------------------------------
2dhsA           --------------------------------------
2fy1A           --------------------------------------
2dgoA           --------------------------------------
2d9pA           --------------------------------------
1p1tA           --------------------------------------
2dh7A           --------------------------------------
2dnzA           --------------------------------------
2jrsA           --------------------------------------
2g4bA           --------------------------------------
2sxlA           --------------------------------------
1fjeB           --------------------------------------
1x5sA           --------------------------------------
2u2fA           --------------------------------------
2cqiA           --------------------------------------
1u6fA           --------------------------------------
2ghpB           --------------------------------------
1d8zA           --------------------------------------
3bs9A           --------------------------------------
2cq0A           --------------------------------------
2e5hA           --------------------------------------
1p27B           --------------------------------------
2j0sD           --------------------------------------
2hyiB           --------------------------------------
3ex7B           --------------------------------------
2divA           --------------------------------------
1d9aA           --------------------------------------
1n54B           --------------------------------------
2ghpA           --------------------------------------
1n52B           --------------------------------------
1h2vZ           --------------------------------------
1h2uY           --------------------------------------
1h2uX           --------------------------------------
1h2tZ           --------------------------------------
2do0A           --------------------------------------
2dguA           --------------------------------------
2dgsA           --------------------------------------
1x5oA           --------------------------------------
2cqcA           --------------------------------------
2cpzA           --------------------------------------
2cphA           --------------------------------------
1h6kZ           --------------------------------------
1hl6A           --------------------------------------
1h6kY           --------------------------------------
1h6kX           --------------------------------------
2dhgA           --------------------------------------
2dh9A           --------------------------------------
1rk8A           --------------------------------------
3feyB           --------------------------------------
2dgvA           --------------------------------------
1oo0B           --------------------------------------
2dnhA           --------------------------------------
2dh8A           --------------------------------------
3fexB           --------------------------------------
2fc9A           --------------------------------------
2cqgA           --------------------------------------
1x4bA           --------------------------------------
2dk2A           --------------------------------------
1sxlA           --------------------------------------
2jwnA           --------------------------------------
2dgpA           --------------------------------------
1hd0A           --------------------------------------
2dnkA           --------------------------------------
1wtbA           --------------------------------------
1iqtA           --------------------------------------
1uawA           --------------------------------------
2mssA           --------------------------------------
2fc8A           --------------------------------------
2errA           --------------------------------------
1wg4A           --------------------------------------
1x4gA           --------------------------------------
2cpxA           --------------------------------------
2i38A           --------------------------------------
2i2yA           --------------------------------------
1wf1A           --------------------------------------
1oiaB           --------------------------------------
1oiaA           --------------------------------------
1fhtA           --------------------------------------
2cq3A           --------------------------------------
1hl6C           --------------------------------------
2dgqA           --------------------------------------
2cpdA           --------------------------------------
1x5tA           --------------------------------------
2ywkA           --------------------------------------
2k8gA           --------------------------------------
2cqbA           --------------------------------------
2fy1A           --------------------------------------
2d9pA           --------------------------------------
1p1tA           --------------------------------------
2dnzA           --------------------------------------
2jrsA           --------------------------------------
2sxlA           --------------------------------------
1x5sA           --------------------------------------
2u2fA           --------------------------------------
1d8zA           --------------------------------------
3bs9A           --------------------------------------
2cq0A           --------------------------------------
2e5hA           --------------------------------------
1p27B           --------------------------------------
2j0sD           --------------------------------------
2hyiB           --------------------------------------
3ex7B           --------------------------------------
1d9aA           --------------------------------------
1n52B           --------------------------------------
1h2vZ           --------------------------------------
1h2uY           --------------------------------------
1h2uX           --------------------------------------
1h2tZ           --------------------------------------
2dgsA           --------------------------------------
2cpzA           --------------------------------------
1h6kZ           --------------------------------------
1h6kY           --------------------------------------
1h6kX           --------------------------------------
2dh8A           --------------------------------------
3fexB           --------------------------------------
2cqgA           --------------------------------------
2dgpA           --------------------------------------
1hd0A           --------------------------------------
1wtbA           --------------------------------------
1iqtA           --------------------------------------
2errA           --------------------------------------
2cq3A           --------------------------------------
2dgqA           --------------------------------------