[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cele0:AAA81130.1

[Show Plain Result]


## Summary of Sequence Search
    1::914
   20::902       0.0  44%  910 aa  SND1_PONAB RecName: Full=Staphylococcal nuclease domain-containing
   20::902       0.0  44%  910 aa  SND1_BOVIN RecName: Full=Staphylococcal nuclease domain-containing
   20::902       0.0  42%  910 aa  SND1_MOUSE RecName: Full=Staphylococcal nuclease domain-containing
   20::902       0.0  44%  910 aa  SND1_HUMAN RecName: Full=Staphylococcal nuclease domain-containing
   19::901       0.0  42%  909 aa  SND1_RAT RecName: Full=Staphylococcal nuclease domain-containing
   20::896     e-180  41%  897 aa  SND1_DANRE RecName: Full=Staphylococcal nuclease domain-containing
    8::872     5e-58  29%  878 aa  SND1_SCHPO RecName: Full=Staphylococcal nuclease domain-containing
  509::676     1e-10  26% 1180 aa  TDRD1_HUMAN RecName: Full=Tudor domain-containing protein
  980::1113    1e-09  28% 1172 aa  TDRD1_MOUSE RecName: Full=Tudor domain-containing protein 1;
   44::209     2e-09  30% 1019 aa  STK31_HUMAN RecName: Full=Serine/threonine-protein kinase 31;      
  332::493     1e-08  27%  606 aa  TDRKH_HUMAN RecName: Full=Tudor and KH domain-containing protein;
  929::1070    3e-08  29% 1175 aa  TDRD1_DANRE RecName: Full=Tudor domain-containing protein 1;
   44::209     5e-08  34% 1018 aa  STK31_MOUSE RecName: Full=Serine/threonine-protein kinase 31;      
  332::493     6e-08  28%  560 aa  TDRKH_MOUSE RecName: Full=Tudor and KH domain-containing protein;
 2358::2447    2e-07  34% 2515 aa  TUD_DROME RecName: Full=Maternal protein tudor;
 1320::1522    1e-06  22% 2096 aa  TDRD6_HUMAN RecName: Full=Tudor domain-containing protein 6;AltName:
  908::972     2e-06  34% 1133 aa  TDRD1_ORYLA RecName: Full=Tudor domain-containing protein 1;
  489::610     6e-06  26% 1040 aa  TDRD5_MOUSE RecName: Full=Tudor domain-containing protein 5;
  764::893     6e-06  27%  903 aa  AKAP1_HUMAN RecName: Full=A kinase anchor protein 1,
   67::128     1e-05  37%  237 aa  SPF30_DANRE RecName: Full=Survival of motor neuron-related-splicing
  795::939     2e-05  28% 1227 aa  TDRD9_MOUSE RecName: Full=Putative ATP-dependent RNA helicase
 1503::1574    2e-05  35% 1640 aa  RNF17_MOUSE RecName: Full=RING finger protein 17;AltName: Full=Mad
  601::671     3e-05  32%  722 aa  TDRD3_BOVIN RecName: Full=Tudor domain-containing protein 3;
  733::794     3e-05  41% 1623 aa  RNF17_HUMAN RecName: Full=RING finger protein 17;AltName:
  507::603     4e-05  26% 1113 aa  TDRD7_RAT RecName: Full=Tudor domain-containing protein 7;AltName:
  480::576     4e-05  26% 1086 aa  TDRD7_MOUSE RecName: Full=Tudor domain-containing protein
  797::930     5e-05  27% 1228 aa  TDRD9_HUMAN RecName: Full=Putative ATP-dependent RNA helicase
  796::940     8e-05  27% 1228 aa  TDRD9_RAT RecName: Full=Putative ATP-dependent RNA helicase TDRD9; 
  492::588     8e-05  24% 1098 aa  TDRD7_HUMAN RecName: Full=Tudor domain-containing protein
  530::600     8e-05  32%  651 aa  TDRD3_HUMAN RecName: Full=Tudor domain-containing protein 3;
  492::588     1e-04  24% 1098 aa  TDRD7_PONAB RecName: Full=Tudor domain-containing protein 7;
   68::128     1e-04  36%  238 aa  SPF30_XENTR RecName: Full=Survival of motor neuron-related-splicing
  643::705     1e-04  39% 1534 aa  RNF17_MACFA RecName: Full=RING finger protein 17;
  481::611     1e-04  26%  981 aa  TDRD5_HUMAN RecName: Full=Tudor domain-containing protein 5;
  715::844     1e-04  25%  854 aa  AKAP1_RAT RecName: Full=A kinase anchor protein 1,
  718::847     1e-04  25%  857 aa  AKAP1_MOUSE RecName: Full=A kinase anchor protein 1,
 1543::1625    2e-04  28% 2134 aa  TDRD6_MOUSE RecName: Full=Tudor domain-containing protein 6;
  622::692     4e-04  29%  743 aa  TDRD3_MOUSE RecName: Full=Tudor domain-containing protein 3;
  530::600     5e-04  29%  651 aa  TDRD3_RAT RecName: Full=Tudor domain-containing protein 3;
  641::684     5e-04  38%  733 aa  TDRD3_DANRE RecName: Full=Tudor domain-containing protein 3;
    1::914

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxRRGLVKSVLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDS
SND1_PONAB      -----------------------QRGIVKMVLSGCAIIVXXXXXXXXXXXXXINLSNIRAGNLARRAAAT
SND1_BOVIN      -----------------------QRGIVKMVLSGCAIIVXXXXXXXXXXXXXINLSNIRAGNLARRAAPD
SND1_MOUSE      -----------------------QRGIVKMVLSGCAIIVXXXXXXXXXXXXXINLSNIRAGNLARRAAAT
SND1_HUMAN      -----------------------QRGIIKMVLSGCAIIVXXXXXXXXXXXXXINLSNIRAGNLARRAAAT
SND1_RAT        -----------------------QRGIVKMVLSGCAIIVXXXXXXXXXXXXXINLSNIRAGNLARRAAAT
SND1_DANRE      -----------------------QRGIVKMVLSGCAIIVXXXXXXXXXXXXXINLSNIRAGALARRAIQG
SND1_SCHPO      --------------------------MIKYAQSGDSFNILIKDNAKKITEKQFSLAYVECPRFRREG---
TDRD1_HUMAN     ----------------------------------------------------------------------
TDRD1_MOUSE     ----------------------------------------------------------------------
STK31_HUMAN     ----------------------------------------------------------------------
TDRKH_HUMAN     ----------------------------------------------------------------------
TDRD1_DANRE     ----------------------------------------------------------------------
STK31_MOUSE     ----------------------------------------------------------------------
TDRKH_MOUSE     ----------------------------------------------------------------------
TUD_DROME       ----------------------------------------------------------------------
TDRD6_HUMAN     ----------------------------------------------------------------------
TDRD1_ORYLA     ----------------------------------------------------------------------
TDRD5_MOUSE     ----------------------------------------------------------------------
AKAP1_HUMAN     ----------------------------------------------------------------------
SPF30_DANRE     ----------------------------------------------------------------------
TDRD9_MOUSE     ----------------------------------------------------------------------
RNF17_MOUSE     ----------------------------------------------------------------------
TDRD3_BOVIN     ----------------------------------------------------------------------
RNF17_HUMAN     ----------------------------------------------------------------------
TDRD7_RAT       ----------------------------------------------------------------------
TDRD7_MOUSE     ----------------------------------------------------------------------
TDRD9_HUMAN     ----------------------------------------------------------------------
TDRD9_RAT       ----------------------------------------------------------------------
TDRD7_HUMAN     ----------------------------------------------------------------------
TDRD3_HUMAN     ----------------------------------------------------------------------
TDRD7_PONAB     ----------------------------------------------------------------------
SPF30_XENTR     ----------------------------------------------------------------------
RNF17_MACFA     ----------------------------------------------------------------------
TDRD5_HUMAN     ----------------------------------------------------------------------
AKAP1_RAT       ----------------------------------------------------------------------
AKAP1_MOUSE     ----------------------------------------------------------------------
TDRD6_MOUSE     ----------------------------------------------------------------------
TDRD3_MOUSE     ----------------------------------------------------------------------
TDRD3_RAT       ----------------------------------------------------------------------
TDRD3_DANRE     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ASATPDEPYAWDSREYLRQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQ
SND1_PONAB      AKDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLG--KDTNGENIAESLVAEGLATRRE
SND1_BOVIN      AKDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLG--KDTNGENIAESLVAEGLATRRE
SND1_MOUSE      GKDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLG--KDTNGENIAESLVAEGLATRRE
SND1_HUMAN      AKDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLG--KDTNGENIAESLVAEGLATRRE
SND1_RAT        GKDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLG--KDTNGENIAESLVAEGLASRRE
SND1_DANRE      TKDTPDEPWAFQAREFMRKKVIGKEVCFTVENKTPQGREYGMVYLG--KDTSGENIAESLVAEGLAMVRR
SND1_SCHPO      -----DEPFAFEAQEFSRRLVVGRPASVSTLYVITSKREYGRIR---TSEFD---LAESLLREGLAKLRE
TDRD1_HUMAN     ----------------------------------------------------------------------
TDRD1_MOUSE     ----------------------------------------------------------------------
STK31_HUMAN     ----------------------------------------------------------------------
TDRKH_HUMAN     ----------------------------------------------------------------------
TDRD1_DANRE     ----------------------------------------------------------------------
STK31_MOUSE     ----------------------------------------------------------------------
TDRKH_MOUSE     ----------------------------------------------------------------------
TUD_DROME       ----------------------------------------------------------------------
TDRD6_HUMAN     ----------------------------------------------------------------------
TDRD1_ORYLA     ----------------------------------------------------------------------
TDRD5_MOUSE     ----------------------------------------------------------------------
AKAP1_HUMAN     ----------------------------------------------------------------------
SPF30_DANRE     ----------------------------------------------------------------------
TDRD9_MOUSE     ----------------------------------------------------------------------
RNF17_MOUSE     ----------------------------------------------------------------------
TDRD3_BOVIN     ----------------------------------------------------------------------
RNF17_HUMAN     ----------------------------------------------------------------------
TDRD7_RAT       ----------------------------------------------------------------------
TDRD7_MOUSE     ----------------------------------------------------------------------
TDRD9_HUMAN     ----------------------------------------------------------------------
TDRD9_RAT       ----------------------------------------------------------------------
TDRD7_HUMAN     ----------------------------------------------------------------------
TDRD3_HUMAN     ----------------------------------------------------------------------
TDRD7_PONAB     ----------------------------------------------------------------------
SPF30_XENTR     ----------------------------------------------------------------------
RNF17_MACFA     ----------------------------------------------------------------------
TDRD5_HUMAN     ----------------------------------------------------------------------
AKAP1_RAT       ----------------------------------------------------------------------
AKAP1_MOUSE     ----------------------------------------------------------------------
TDRD6_MOUSE     ----------------------------------------------------------------------
TDRD3_MOUSE     ----------------------------------------------------------------------
TDRD3_RAT       ----------------------------------------------------------------------
TDRD3_DANRE     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GKVADEYSTKLLELQEQAKSAGRGKWNSNAGTIRDIRWVIDNPRELVDKYAQKPIDAVIEMVRDGSTVRA
SND1_PONAB      GMRANNEQNRLSECEEQAKAAKKGMWSEGNGTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRDGSVVRA
SND1_BOVIN      GMRANNEQNRLAECEEQAKASKKGMWSEGNGTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRDGSVVRA
SND1_MOUSE      GMRANNEQNRLSECEEQAKASKKGMWSEGNGTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRDGSVVRA
SND1_HUMAN      GMRANNEQNRLSECEEQAKAAKKGMWSEGNGTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRDGSVVRA
SND1_RAT        GMRANNEQNRLSECEEQAKASKKGMWSEGNGTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRDGSVVRA
SND1_DANRE      EGIRNPEQVRLCDLEDQAKSSKKGLWSEGGGTIRDLKYTIENPRNFVDSLHQKPVNAIIEHVRDGCMVRA
SND1_SCHPO      GTSENSYFVSLEEAQDHAQQYKLGIWGPSDDVVVTEKANPANPAKFLKAHKGKKLNGIVETIRNGDQVRV
TDRD1_HUMAN     ----------------------------------------------------------------------
TDRD1_MOUSE     ----------------------------------------------------------------------
STK31_HUMAN     ----------------------------------------------------------------------
TDRKH_HUMAN     ----------------------------------------------------------------------
TDRD1_DANRE     ----------------------------------------------------------------------
STK31_MOUSE     ----------------------------------------------------------------------
TDRKH_MOUSE     ----------------------------------------------------------------------
TUD_DROME       ----------------------------------------------------------------------
TDRD6_HUMAN     ----------------------------------------------------------------------
TDRD1_ORYLA     ----------------------------------------------------------------------
TDRD5_MOUSE     ----------------------------------------------------------------------
AKAP1_HUMAN     ----------------------------------------------------------------------
SPF30_DANRE     ----------------------------------------------------------------------
TDRD9_MOUSE     ----------------------------------------------------------------------
RNF17_MOUSE     ----------------------------------------------------------------------
TDRD3_BOVIN     ----------------------------------------------------------------------
RNF17_HUMAN     ----------------------------------------------------------------------
TDRD7_RAT       ----------------------------------------------------------------------
TDRD7_MOUSE     ----------------------------------------------------------------------
TDRD9_HUMAN     ----------------------------------------------------------------------
TDRD9_RAT       ----------------------------------------------------------------------
TDRD7_HUMAN     ----------------------------------------------------------------------
TDRD3_HUMAN     ----------------------------------------------------------------------
TDRD7_PONAB     ----------------------------------------------------------------------
SPF30_XENTR     ----------------------------------------------------------------------
RNF17_MACFA     ----------------------------------------------------------------------
TDRD5_HUMAN     ----------------------------------------------------------------------
AKAP1_RAT       ----------------------------------------------------------------------
AKAP1_MOUSE     ----------------------------------------------------------------------
TDRD6_MOUSE     ----------------------------------------------------------------------
TDRD3_MOUSE     ----------------------------------------------------------------------
TDRD3_RAT       ----------------------------------------------------------------------
TDRD3_DANRE     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           FLLPNFEYITLQLSGVRAPSTRNPNAADXXXXXXXXXXXXXXXXXLLQRDVQIILESTSNQNFVGSIVHP
SND1_PONAB      LLLPDYYLVTVMLSGIKCPTFRREADGSETPEPFAAEAKFFTESRLLQRDVQIILESCHNQNILGTILHP
SND1_BOVIN      LLLPDYYLVTVMLSGIKCPTFRREADGSETPEPFAAEAKFFTESRLLQRDVQIILESCHNQNILGTILHP
SND1_MOUSE      LLLPGHHLVTVMLSGIKCPTFRRETDGSETPEPFAAEAKFFTESRLLQRDVQIILESCHNQNLLGTILHP
SND1_HUMAN      LLLPDYYLVTVMLSGIKCPTFRREADGSETPEPFAAEAKFFTESRLLQRDVQIILESCHNQNILGTILHP
SND1_RAT        LLLPDHYLVTVMLSGIKCPTFRRETDGSETPEPFAAEAKFFTESRLLQRDVQIILESCHNQNILGTILHP
SND1_DANRE      LLLPDYYLVTVMLSGIKSPTFKREADGSETPEPFAAEAKFFTESRLLQRDVQIILESCPNQVILGTILHP
SND1_SCHPO      FLSPKHQLVTISLAGVRCPTATSPEQTSSEQEPCGDEAKQFVVTRLLQRNVVILLDLAPNGSFLGNVLHP
TDRD1_HUMAN     ----------------------------------------------------------------------
TDRD1_MOUSE     ----------------------------------------------------------------------
STK31_HUMAN     ----------------------------------------------------------------------
TDRKH_HUMAN     ----------------------------------------------------------------------
TDRD1_DANRE     ----------------------------------------------------------------------
STK31_MOUSE     ----------------------------------------------------------------------
TDRKH_MOUSE     ----------------------------------------------------------------------
TUD_DROME       ----------------------------------------------------------------------
TDRD6_HUMAN     ----------------------------------------------------------------------
TDRD1_ORYLA     ----------------------------------------------------------------------
TDRD5_MOUSE     ----------------------------------------------------------------------
AKAP1_HUMAN     ----------------------------------------------------------------------
SPF30_DANRE     ----------------------------------------------------------------------
TDRD9_MOUSE     ----------------------------------------------------------------------
RNF17_MOUSE     ----------------------------------------------------------------------
TDRD3_BOVIN     ----------------------------------------------------------------------
RNF17_HUMAN     ----------------------------------------------------------------------
TDRD7_RAT       ----------------------------------------------------------------------
TDRD7_MOUSE     ----------------------------------------------------------------------
TDRD9_HUMAN     ----------------------------------------------------------------------
TDRD9_RAT       ----------------------------------------------------------------------
TDRD7_HUMAN     ----------------------------------------------------------------------
TDRD3_HUMAN     ----------------------------------------------------------------------
TDRD7_PONAB     ----------------------------------------------------------------------
SPF30_XENTR     ----------------------------------------------------------------------
RNF17_MACFA     ----------------------------------------------------------------------
TDRD5_HUMAN     ----------------------------------------------------------------------
AKAP1_RAT       ----------------------------------------------------------------------
AKAP1_MOUSE     ----------------------------------------------------------------------
TDRD6_MOUSE     ----------------------------------------------------------------------
TDRD3_MOUSE     ----------------------------------------------------------------------
TDRD3_RAT       ----------------------------------------------------------------------
TDRD3_DANRE     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KGNIAESLLREGYAKCVDWSIGLCTGGAQKLRDAERQAKEKRLRLWKSYQPTSSAYSGDRKAFTGKVVEI
SND1_PONAB      NGNITELLLKEGFARCVDWSIAVYTRGAEKLRAAERFAKERRLRIWRDYVAPTANLDQKDKQFVAKVMQV
SND1_BOVIN      NGNITELLLKEGFARCVDWSIAVYTRGAEKLRAAERFAKERRLRIWRDYVAPTANLDQKDKQFVAKVMQV
SND1_MOUSE      NGNITELLLKEGFARCVDWSIAVYTRGAEKLRAAERFAKERRLRIWRDYVPPTANLDQKDKQFVAKVMQV
SND1_HUMAN      NGNITELLLKEGFARCVDWSIAVYTRGAEKLRAAERFAKERRLRIWRDYVAPTANLDQKDKQFVAKVMQV
SND1_RAT        NGNITELLLKEGFARCVDWSIAVYTRGAEKLRAAERFAKERRLRIWRDYVPPTANLDQKDKQFVAKVMQV
SND1_DANRE      NGNITELLLKEGFARCVDWSMAVYTQGAEKLRAAERSAKERKVRIWKDYAPTANLDQKDRQ-FVAKVMQV
SND1_SCHPO      AGNIATFLLSSGLGRVADNHISLGPETMQSLRTIERKAKISRLGIWKNISVSPDINSLSLKDYSAVVSRV
TDRD1_HUMAN     ----------------------------------------------------------------------
TDRD1_MOUSE     ----------------------------------------------------------------------
STK31_HUMAN     ----------------------------------------------------------------------
TDRKH_HUMAN     ----------------------------------------------------------------------
TDRD1_DANRE     ----------------------------------------------------------------------
STK31_MOUSE     ----------------------------------------------------------------------
TDRKH_MOUSE     ----------------------------------------------------------------------
TUD_DROME       ----------------------------------------------------------------------
TDRD6_HUMAN     ----------------------------------------------------------------------
TDRD1_ORYLA     ----------------------------------------------------------------------
TDRD5_MOUSE     ----------------------------------------------------------------------
AKAP1_HUMAN     ----------------------------------------------------------------------
SPF30_DANRE     ----------------------------------------------------------------------
TDRD9_MOUSE     ----------------------------------------------------------------------
RNF17_MOUSE     ----------------------------------------------------------------------
TDRD3_BOVIN     ----------------------------------------------------------------------
RNF17_HUMAN     ----------------------------------------------------------------------
TDRD7_RAT       ----------------------------------------------------------------------
TDRD7_MOUSE     ----------------------------------------------------------------------
TDRD9_HUMAN     ----------------------------------------------------------------------
TDRD9_RAT       ----------------------------------------------------------------------
TDRD7_HUMAN     ----------------------------------------------------------------------
TDRD3_HUMAN     ----------------------------------------------------------------------
TDRD7_PONAB     ----------------------------------------------------------------------
SPF30_XENTR     ----------------------------------------------------------------------
RNF17_MACFA     ----------------------------------------------------------------------
TDRD5_HUMAN     ----------------------------------------------------------------------
AKAP1_RAT       ----------------------------------------------------------------------
AKAP1_MOUSE     ----------------------------------------------------------------------
TDRD6_MOUSE     ----------------------------------------------------------------------
TDRD3_MOUSE     ----------------------------------------------------------------------
TDRD3_RAT       ----------------------------------------------------------------------
TDRD3_DANRE     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VLSDAVVVQKDDGSEVKLHLSSIRLPRESGDDKATGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQ
SND1_PONAB      LNADAIVVKLNSGDYKTIHLSSIRPPRLEGEN--TQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVT
SND1_BOVIN      LNADAIVVKLNSGDYKTIHLSSIRPPRLEGEN--TQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVT
SND1_MOUSE      LNADAIVVKLNSGDYKTIHLSSIRPPRLEGDN--IQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVT
SND1_HUMAN      LNADAIVVKLNSGDYKTIHLSSIRPPRLEGEN--TQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVT
SND1_RAT        LNADAIVVKLNSGDYKTIHLSSIRPPRLEGDN--IQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVSVT
SND1_DANRE      VNADAIVVKLNSGEYKTIHLSSIRPPRLEGEEK-NKDKDKRFRPLYDIPYMFEAREFLRKKLIGKKVNVT
SND1_SCHPO      ISTDTLEVRKDNGVECRIQLSSIRHPRPSNEKEA--------------PYQLEAREFLRKKIIGKRVQVS
TDRD1_HUMAN     ----------------------------------------------------------------------
TDRD1_MOUSE     ----------------------------------------------------------------------
STK31_HUMAN     ----------------------------------------------------------------------
TDRKH_HUMAN     ----------------------------------------------------------------------
TDRD1_DANRE     ----------------------------------------------------------------------
STK31_MOUSE     ----------------------------------------------------------------------
TDRKH_MOUSE     ----------------------------------------------------------------------
TUD_DROME       ----------------------------------------------------------------------
TDRD6_HUMAN     ----------------------------------------------------------------------
TDRD1_ORYLA     ----------------------------------------------------------------------
TDRD5_MOUSE     ----------------------------------------------------------------------
AKAP1_HUMAN     ----------------------------------------------------------------------
SPF30_DANRE     ----------------------------------------------------------------------
TDRD9_MOUSE     ----------------------------------------------------------------------
RNF17_MOUSE     ----------------------------------------------------------------------
TDRD3_BOVIN     ----------------------------------------------------------------------
RNF17_HUMAN     ----------------------------------------------------------------------
TDRD7_RAT       ----------------------------------------------------------------------
TDRD7_MOUSE     ----------------------------------------------------------------------
TDRD9_HUMAN     ----------------------------------------------------------------------
TDRD9_RAT       ----------------------------------------------------------------------
TDRD7_HUMAN     ----------------------------------------------------------------------
TDRD3_HUMAN     ----------------------------------------------------------------------
TDRD7_PONAB     ----------------------------------------------------------------------
SPF30_XENTR     ----------------------------------------------------------------------
RNF17_MACFA     ----------------------------------------------------------------------
TDRD5_HUMAN     ----------------------------------------------------------------------
AKAP1_RAT       ----------------------------------------------------------------------
AKAP1_MOUSE     ----------------------------------------------------------------------
TDRD6_MOUSE     ----------------------------------------------------------------------
TDRD3_MOUSE     ----------------------------------------------------------------------
TDRD3_RAT       ----------------------------------------------------------------------
TDRD3_DANRE     ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           IDYVQPKSENFPEKTCATIKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTXXXXXXXXXXXXXXXF
SND1_PONAB      VDYIRPASPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLH
SND1_BOVIN      VDYIRPASPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLH
SND1_MOUSE      VDYIRPASPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLH
SND1_HUMAN      VDYIRPASPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLH
SND1_RAT        VDYIRPASPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLH
SND1_DANRE      VDYIRAATNAFPERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLH
SND1_SCHPO      LDFIRPGQNDLPAINNCTVKLSDTNVALMVVKSGYATVIRYRMDSVDRSPIYDFLIEAEKAAQEGRKGMW
TDRD1_HUMAN     ----------------------------------------------------------------------
TDRD1_MOUSE     ----------------------------------------------------------------------
STK31_HUMAN     ----------------------------------------------------------------------
TDRKH_HUMAN     ----------------------------------------------------------------------
TDRD1_DANRE     ----------------------------------------------------------------------
STK31_MOUSE     ----------------------------------------------------------------------
TDRKH_MOUSE     ----------------------------------------------------------------------
TUD_DROME       ----------------------------------------------------------------------
TDRD6_HUMAN     ----------------------------------------------------------------------
TDRD1_ORYLA     ----------------------------------------------------------------------
TDRD5_MOUSE     ----------------------------------------------------------------------
AKAP1_HUMAN     ----------------------------------------------------------------------
SPF30_DANRE     ----------------------------------------------------------------------
TDRD9_MOUSE     ----------------------------------------------------------------------
RNF17_MOUSE     ----------------------------------------------------------------------
TDRD3_BOVIN     ----------------------------------------------------------------------
RNF17_HUMAN     ----------------------------------------------------------------------
TDRD7_RAT       ----------------------------------------------------------------------
TDRD7_MOUSE     ----------------------------------------------------------------------
TDRD9_HUMAN     ----------------------------------------------------------------------
TDRD9_RAT       ----------------------------------------------------------------------
TDRD7_HUMAN     ----------------------------------------------------------------------
TDRD3_HUMAN     ----------------------------------------------------------------------
TDRD7_PONAB     ----------------------------------------------------------------------
SPF30_XENTR     ----------------------------------------------------------------------
RNF17_MACFA     ----------------------------------------------------------------------
TDRD5_HUMAN     ----------------------------------------------------------------------
AKAP1_RAT       ----------------------------------------------------------------------
AKAP1_MOUSE     ----------------------------------------------------------------------
TDRD6_MOUSE     ----------------------------------------------------------------------
TDRD3_MOUSE     ----------------------------------------------------------------------
TDRD3_RAT       ----------------------------------------------------------------------
TDRD3_DANRE     ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           ADKTAEKKDTHRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETVLITFLLGGINCP
SND1_PONAB      SKK---EVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECP
SND1_BOVIN      SKK---EVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECP
SND1_MOUSE      SKK---EVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECP
SND1_HUMAN      SKK---EVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECP
SND1_RAT        SKK---EVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECP
SND1_DANRE      SKK---EVPIHRVADISGETQKAKQFFPFLQRAGRSEAVVEYVFSGSRLKLYMPKETCLITFLLAGIECP
SND1_SCHPO      SGK---KPAYENIVNAXXXXXXXXXXXXXXXXTRKLSVIIENVISGSRFRCFCPKENCYFMFACAGIRTP
TDRD1_HUMAN     ----------------------------------------------------------------------
TDRD1_MOUSE     ----------------------------------------------------------------------
STK31_HUMAN     ----------------------------------------------------------------------
TDRKH_HUMAN     ----------------------------------------------------------------------
TDRD1_DANRE     ----------------------------------------------------------------------
STK31_MOUSE     ----------------------------------------------------------------------
TDRKH_MOUSE     ----------------------------------------------------------------------
TUD_DROME       ----------------------------------------------------------------------
TDRD6_HUMAN     ----------------------------------------------------------------------
TDRD1_ORYLA     ----------------------------------------------------------------------
TDRD5_MOUSE     ----------------------------------------------------------------------
AKAP1_HUMAN     ----------------------------------------------------------------------
SPF30_DANRE     ----------------------------------------------------------------------
TDRD9_MOUSE     ----------------------------------------------------------------------
RNF17_MOUSE     ----------------------------------------------------------------------
TDRD3_BOVIN     ----------------------------------------------------------------------
RNF17_HUMAN     ----------------------------------------------------------------------
TDRD7_RAT       ----------------------------------------------------------------------
TDRD7_MOUSE     ----------------------------------------------------------------------
TDRD9_HUMAN     ----------------------------------------------------------------------
TDRD9_RAT       ----------------------------------------------------------------------
TDRD7_HUMAN     ----------------------------------------------------------------------
TDRD3_HUMAN     ----------------------------------------------------------------------
TDRD7_PONAB     ----------------------------------------------------------------------
SPF30_XENTR     ----------------------------------------------------------------------
RNF17_MACFA     ----------------------------------------------------------------------
TDRD5_HUMAN     ----------------------------------------------------------------------
AKAP1_RAT       ----------------------------------------------------------------------
AKAP1_MOUSE     ----------------------------------------------------------------------
TDRD6_MOUSE     ----------------------------------------------------------------------
TDRD3_MOUSE     ----------------------------------------------------------------------
TDRD3_RAT       ----------------------------------------------------------------------
TDRD3_DANRE     ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           KGARVGPGGVSTGXXXXXXXXXXXXTRKLVLQHEVQLEVESTDKNGNFVGYLYVSPDGNTSRAINLSEAL
SND1_PONAB      RGARNLPGLVQEG--EPFSEEATLFTKELVLQRXXXXXXXSMDKAGNFIGWLHI--DG-----ANLSVLL
SND1_BOVIN      RGARNLPGLVQEG--EPFSEEATLFTKELVLQRXXXXXXXSMDKAGNFIGWLHI--DG-----ANLSVLL
SND1_MOUSE      RGARNLPGLVQEG--EPFSEEATLFTKELVLQRXXXXXXXSMDKAGNFIGWLHM--DG-----ANLSVLL
SND1_HUMAN      RGARNLPGLVQEG--EPFSEEATLFTKELVLQRXXXXXXXSMDKAGNFIGWLHI--DG-----ANLSVLL
SND1_RAT        RGARNLPGLVQEG--EPFSEEATLFTKELVLQRXXXXXXXSMDKAGNFIGWLHM--DG-----ANLSVLL
SND1_DANRE      RGSRNMPGGMQVA--EPYSEEAMLFTKELVLQRXXXXXXXSMDIAGNFIDWLHI--DG-----VNLSVAL
SND1_SCHPO      RTAR------NDQEKGEPFXXXXXXXXXXXXQHDAQVEILSVDNNGCFLGDIYVNHD------TNFALKL
TDRD1_HUMAN     ----------------------------------------------------------------------
TDRD1_MOUSE     ----------------------------------------------------------------------
STK31_HUMAN     ----------------------------------------------------------------------
TDRKH_HUMAN     ----------------------------------------------------------------------
TDRD1_DANRE     ----------------------------------------------------------------------
STK31_MOUSE     ----------------------------------------------------------------------
TDRKH_MOUSE     ----------------------------------------------------------------------
TUD_DROME       ----------------------------------------------------------------------
TDRD6_HUMAN     ----------------------------------------------------------------------
TDRD1_ORYLA     ----------------------------------------------------------------------
TDRD5_MOUSE     ----------------------------------------------------------------------
AKAP1_HUMAN     ----------------------------------------------------------------------
SPF30_DANRE     ----------------------------------------------------------------------
TDRD9_MOUSE     ----------------------------------------------------------------------
RNF17_MOUSE     ----------------------------------------------------------------------
TDRD3_BOVIN     ----------------------------------------------------------------------
RNF17_HUMAN     ----------------------------------------------------------------------
TDRD7_RAT       ----------------------------------------------------------------------
TDRD7_MOUSE     ----------------------------------------------------------------------
TDRD9_HUMAN     ----------------------------------------------------------------------
TDRD9_RAT       ----------------------------------------------------------------------
TDRD7_HUMAN     ----------------------------------------------------------------------
TDRD3_HUMAN     ----------------------------------------------------------------------
TDRD7_PONAB     ----------------------------------------------------------------------
SPF30_XENTR     ----------------------------------------------------------------------
RNF17_MACFA     ----------------------------------------------------------------------
TDRD5_HUMAN     ----------------------------------------------------------------------
AKAP1_RAT       ----------------------------------------------------------------------
AKAP1_MOUSE     ----------------------------------------------------------------------
TDRD6_MOUSE     ----------------------------------------------------------------------
TDRD3_MOUSE     ----------------------------------------------------------------------
TDRD3_RAT       ----------------------------------------------------------------------
TDRD3_DANRE     ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           VENGLASLHFTAERSGHYXXXXXXXXXXXXXXXXXXXXFTXXXXXXXXXXXXADTSERKQNFRQVAVTDI
SND1_PONAB      VEHALSKVHFTAERSSYYKSLLSXXXXXXXXXXXVWAHY--EEQPVEEVMPVLEEKERSASYKPVFVTEI
SND1_BOVIN      VEHALSKVHFTAERSAYYKSLLSXXXXXXXXXXXVWAHY--EEQPVEELMPVLEEKERSASYKPVFVTEI
SND1_MOUSE      VEQALSKVHFTAERSAYYKPLLSAEEAAKQRKEKVWAHY--EERPVEEVMPVLEEKERSASYKPVFVTEI
SND1_HUMAN      VEHALSKVHFTAERSSYYKSLLSXXXXXXXXXXXVWAHY--EEQPVEEVMPVLEEKERSASYKPVFVTEI
SND1_RAT        VEHALSKVHFTAERSAYYKPLLSAEEAAKQRKEKVWAHY--EEQPVEEVMPVLEEKERSASYKPVFVTEI
SND1_DANRE      VENALSKVHFTAERSSYYKTLVSAEESARQRKEKLWANY--EEKPNEEVAQVTEAKERGRNTDPSTSLEI
SND1_SCHPO      LSQGLAWCQGYASQSNQYSQYHDTEAAAKEQKVGMWHDYVPPXXXXXXXXXXXXNTVKEPIYLDIVLSDI
TDRD1_HUMAN     ----------------------------------------------------------------------
TDRD1_MOUSE     ----------------------------------------------------------------------
STK31_HUMAN     ----------------------------------------------------------------------
TDRKH_HUMAN     ----------------------------------------------------------------------
TDRD1_DANRE     ----------------------------------------------------------------------
STK31_MOUSE     ----------------------------------------------------------------------
TDRKH_MOUSE     ----------------------------------------------------------------------
TUD_DROME       ----------------------------------------------------------------------
TDRD6_HUMAN     ----------------------------------------------------------------------
TDRD1_ORYLA     ----------------------------------------------------------------------
TDRD5_MOUSE     ---------------------------------------------------------------------I
AKAP1_HUMAN     ----------------------------------------------------------------------
SPF30_DANRE     ----------------------------------------------------------------------
TDRD9_MOUSE     ----------------------------------------------------------------------
RNF17_MOUSE     ----------------------------------------------------------------------
TDRD3_BOVIN     ----------------------------------------------------------------------
RNF17_HUMAN     ----------------------------------------------------------------------
TDRD7_RAT       ----------------------------------------------------------------------
TDRD7_MOUSE     ----------------------------------------------------------------------
TDRD9_HUMAN     ----------------------------------------------------------------------
TDRD9_RAT       ----------------------------------------------------------------------
TDRD7_HUMAN     ----------------------------------------------------------------------
TDRD3_HUMAN     ----------------------------------------------------------------------
TDRD7_PONAB     ----------------------------------------------------------------------
SPF30_XENTR     ----------------------------------------------------------------------
RNF17_MACFA     ----------------------------------------------------------------------
TDRD5_HUMAN     ---------------------------------------------------------------------I
AKAP1_RAT       ----------------------------------------------------------------------
AKAP1_MOUSE     ----------------------------------------------------------------------
TDRD6_MOUSE     ----------------------------------------------------------------------
TDRD3_MOUSE     ----------------------------------------------------------------------
TDRD3_RAT       ----------------------------------------------------------------------
TDRD3_DANRE     ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           APGALRFSAQNIEDGPKIEKMTTEMRQALAEHPPLAGSYTTKRGDLCVAKFSQDGQWYRCKVESVRAGQA
SND1_PONAB      TDD-LHFYVQDVETGTQLEKLMENMRNDIASHPPVEGSYAPRRGEFCIAKF-VDGEWYRARVEKVESAKI
SND1_BOVIN      TDD-LHFYVQDVETGTQLEKLMENMRNDIASHPPVEGSYAPRRGEFCIAKF-VDGEWYRARVEKVESAKV
SND1_MOUSE      TDD-LHFYVQDVETGTQLEKLMENMRNDISSHPPVEGSYAPRRGEFCIAKF-VDGEWYRARVEKVESAKV
SND1_HUMAN      TDD-LHFYVQDVETGTQLEKLMENMRNDIASHPPVEGSYAPRRGEFCIAKF-VDGEWYRARVEKVESAKI
SND1_RAT        TDD-LHFYVQDVETGTQLEKLMENMRSDISSHPPVEGAYAPRRGEFCIAKF-VDGEWYRARVEKVESAKV
SND1_DANRE      TDG-LHFYAQDVETGTKLENLMESMRGEIAAQPPVEGSFAPRRGEFCIAKFA-DGEWYRARVEKVESAKV
SND1_SCHPO      AEDG-KFSFQII--GTGIQQLETLMSDLGSLKKSFKPSEKINVGMNVAAISALDNAMYRGRVRCDRENQA
TDRD1_HUMAN     ------FFCQQLQSGRKLAELQASLSKYCDQLPPRSDFYPAI-GDICCAQFSEDDQWYRASVLAYASEES
TDRD1_MOUSE     -------------------------------------AYRPRTGDACCAKYTNDDFWYRAIVLETSESDV
STK31_HUMAN     ---AVTFWAQSINRNKDIMKIGCSLSEVCPQASSVLGNLDPNK--IYGGLFSEDQCWYRCKVLKIISVEK
TDRKH_HUMAN     ----------------QLDKLVNEMTQHYENSVP--EDLTVHVGDIVAAPLPTNGSWYRARVGTLENGNL
TDRD1_DANRE     -------------------------------------------GASCCAQFSGDKNWYRAVVLEVTTKHA
STK31_MOUSE     ---AVTFWAQNVSKNKDIMKIGC----SLSEVCPLANSVF---GNLDPKKFSEDKCWYRCKVKTISDDKC
TDRKH_MOUSE     ----------------QLDKLVSEMTQHYENSLP--EDLTVHVGDIVAAPLSTNGSWYRARVGTLENGNL
TUD_DROME       --GPMSFYVQMESDVPALEQMTDKLLDAEQDLPAFSD---LKEGALCVAQFPEDEVFYRAQIRKVDDGKC
TDRD6_HUMAN     ------FYVQLIEDEAEISHLS-ERLNSVKTRPEYYVGPPLQRGDMICAVFPEDNLWYRAVIKEQQPNDL
TDRD1_ORYLA     -------------------------------------------GAACCAQFSVDKIWYRAIILEVGEAEM
TDRD5_MOUSE     SPSQFYIRIYSRDSSELLEDMMIEMRRCLVSDRYIMPEYFIQPGHLCCVKISEDKWWYRVIIHRILGKEV
AKAP1_HUMAN     ---------------------------------------------ICAAP-GADGAWWRAQVVASETNEV
SPF30_DANRE     ----------------------------------VAPSHSWRVGDHCMATWSQDGQVYEAEIEEIENGTA
TDRD9_MOUSE     ---------------------------------------------VCLAPFTDYNKYFRAQILYVSGNSA
RNF17_MOUSE     ----------------------------------------------CLAEYA-DGLWYRAKIISIKEFNV
TDRD3_BOVIN     --------------GPKRRSGPIKPEKVLESSIPMEYAKLWKSGDECLALYWEDNKFYRAEVEALHSSTA
RNF17_HUMAN     ----------------------------------------------CVAKF-EDGIWYRAKVIGLPGHQV
TDRD7_RAT       ------------------ELMEDEMKEYYSRNPRVTPIQTVHVGQLLAVNAEEDA-WLRAQIISTDENKI
TDRD7_MOUSE     ------------------ELMEDEMKEFYSKNPRVTPIQTVHVGQLLAVNAEEDA-WLRAQIISTDENKI
TDRD9_HUMAN     ----------------------------------------------CLAPFADKQRYFRAQVLYVSGNSA
TDRD9_RAT       ---------------------------------------------VCLAPFTDYNKYFRAQILYVSGNSA
TDRD7_HUMAN     ------------------ELMEDEMKEYYSKNPKITPVQAVNVGQLLAVNAEEDA-WLRAQVISTEENKI
TDRD3_HUMAN     --------------GPKRRSGPIKPEKILESSIPMEYAKMWKPGDECFALYWEDNKFYRAEVEALHSSTA
TDRD7_PONAB     ------------------ELMEDEMKEYYSKNPKVTPVQAVNVGQLLAVNAEEDA-WLRAQVISTEENKI
SPF30_XENTR     -----------------------------------SGSQSWKVGEKCMAVWSDDGQWYXXXXXXXXXGTA
RNF17_MACFA     ---------------------------------------------VCVAKF-EDGIWYRAKVIGLPGHQV
TDRD5_HUMAN     SPSQFYIRIYSRDSSELLEDMMIEMRRCLVSDRYVMPECFIQPGHLCCVRISEDKWWYRVIIHRVLEKQV
AKAP1_RAT       ---------------------------------------------ICAAP-GADGAWWRAQVVASETNEV
AKAP1_MOUSE     ---------------------------------------------ICAAP-GADGAWWRAQVVASETNEV
TDRD6_MOUSE     -------------DSEKLQYLETEVQSAGKQLSDRRSTQCPQIGDPCIVRYREDGHYYRALITNICDGEA
TDRD3_MOUSE     --------------GPKRRSGPIKPEKVIESSIPVEYAKVWKPGDECFALYWEDNKFYRAEVEALHSSTA
TDRD3_RAT       --------------GPKRRSGPIKPEKVIESSIPVEYAKMWKPGDECFALYWEDNKFYRAEVEALHSSTA
TDRD3_DANRE     -----------------------------------------KAGDQCLALYWEDNKFYRARIDAVHGSTA


                         .         .         *         .         .         .         .:840
query           EIVYIDYGNRETIEAVKLAQIPAGFANFPAGVREYNLALAKLPNEDYVQLTSDAFAQYLFGHSSVFINSE
SND1_PONAB      HVFYIDYGNREVLPSTRLGTLPPAFSTLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVE
SND1_BOVIN      HVFYIDYGNREILPSTRLGTLPPAFSTLPAQATEYAFAFIQVPQDEDARTDAVDSVVRDIQNTQCLLNVE
SND1_MOUSE      HVFYIDYGNREILPSTRLGTLPPAFSTLPAQATEYAFAFIQVPQDEDARTDAVDSVVRDIQNTQCLLNVE
SND1_HUMAN      HVFYIDYGNREVLPSTRLGTLSPAFSTLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVE
SND1_RAT        HVFYIDYGNREILPSTRLGALPPAFSTLPAQATEYAFAFIQVPQDEDARTDAVDSVVRDIQNTQCLLNVE
SND1_DANRE      HVFYIDYGNREVLSSTRLAALPPAFSTLPPQATEYAFAYIQVPQDEDARADAVDSVVRDIHNTQCLLNVE
SND1_SCHPO      DVLLYDYGSVEQIPFKNISSLPDTYTKLKPQAQLARLSYVQLPSSDYYEDARLVFRE-LAMNKGLVAKVD
TDRD1_HUMAN     VLVYVDYGNFEILSLMRLCPIIPKLLELPMQAIKCVLAGVK-PSLGIWTPEAICLMKKLVQNKIITVKVV
TDRD1_MOUSE     KVLYADYGNIETLPLSRVQPIPASHLELPFQIIRCSLEGPMELNGSCSQLVMELLRNAML-NQSVVLSVK
STK31_HUMAN     CLVYIDYGNTEILNRSDIVEIPLEL-QFSSVAKKYKLWGLHIPSDQEV----TQFDQGTTFLGSLIFEKE
TDRKH_HUMAN     DLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECSLARIAPSGDQWEEEALDEFDRLT--HCADWISSY
TDRD1_DANRE     HVIYSDYGNMETVPLSSILPITKELLQHP-----FQIVRCALTGKEHFPVVWPTEVLELFGSGGVLASFQ
STK31_MOUSE     LVRYIDYGNTEILNRSDIVEIPPEL-QFSSIAKKYRLWGLQIPSGQEV----TQFDQGRTFLGSLIFEKE
TDRKH_MOUSE     DLYFVDFGDNGDCALKDLRALRSDFLSLPFQAIECSLARIAPTGXXXXXXALDEFDR--LTHCADWISSY
TUD_DROME       EVHFIDFGNNAVTQ--QFRQLPEELA--------------------------------------------
TDRD6_HUMAN     SVQFIDYGNVSVVHTNKIGRLDLVNAILPGLCIHCSLQGFEVPDNKFSQRTSEAAIRCEFDRWEVILADE
TDRD1_ORYLA     SVVYADYGNSEKVPVSQILPIPTRLLQLPFKIIRCTLA--------------------------------
TDRD5_MOUSE     EVFYPDFGNIGTVQKSSLRFLKCCYTKLPAQAIPCSLAWVR-PAEEH-----------------------
AKAP1_HUMAN     EIRYVDYGGYKRVKVDVLRQIRSDFVTLPFQGAEVLLSVMPLSDDDQFSPEADAAMSEMTGNTALLAQTS
SPF30_DANRE     AITFAGYGNAEVMPLHMLKKVEEG----------------------------------------------
TDRD9_MOUSE     EVFFVDYGNRSHVDLDLLREIPCQFLELPFQALEFKIAKSLICGEHWSGGAHGRFAA-LVGGCPLLVKVF
RNF17_MOUSE     LVLFVDYGCTEKLTINRLRQIPVQLMQYPAQAIKVLLAGFKPPLSD------------------------
TDRD3_BOVIN     VVKFIDYGNYEEV---------------------------------------------------------
RNF17_HUMAN     EVKYVDFGNTAKITIKDVRKIKDEFLNAPEKAIKCKLA--------------------------------
TDRD7_RAT       KVCYVDYGFCENIEKSKAYRLNPRFCSLSFQATKCKLAGLEILNDD------------------------
TDRD7_MOUSE     KVCYVDYGFCENIEKSKAYRLNPRFCSLSFQATKCKLAGLEVLNDD------------------------
TDRD9_HUMAN     EVFFVDYGNKSHVDLHLLMEIPCQFLELPFQALEFKICKMRPSAKSLVKHWSDGASQWLVSGCTLLVKVF
TDRD9_RAT       EVFFVDYGNRSHVDLDLLREIPCQLLELPFQALEFKIAKSLICGEHWSGGANGRFAALVSG-CPLLVKVF
TDRD7_HUMAN     KVCYVDYGFSENVEKSKAYKLNPKFCSLSFQATKCKLAGLEVLSDD------------------------
TDRD3_HUMAN     VVKFIDYGNYEEV---------------------------------------------------------
TDRD7_PONAB     KVCYVDYGFSENVEKSKAYKLNPKFCSLSFQATKCKLAGLEVLSDD------------------------
SPF30_XENTR     AITFAGYGNAEVTSLLNLRPVEEG----------------------------------------------
RNF17_MACFA     EVKYVDFGNTAKITIKDVRKIKDEFLTAPEKAIKCKLA--------------------------------
TDRD5_HUMAN     EVFYPDFGNIGIVQKSSLRFLKCCYTKLPAQAIPCSLAWVRPVEEHW---TSKAILQF------------
AKAP1_RAT       EIRYVDYGGYKRVKVDVLRQIRSDFVTLPQGAEXXXXXXXXXXXXXHFSPEADAAMSEMTGNTALLAQTS
AKAP1_MOUSE     EIRYVDYGGYKRVKVDVLRQIRSDFVTLPQGAEXXXXXXXXXXXXXHFSPEADAAMSEMTGNTALLAQTS
TDRD6_MOUSE     SVRLVDFGNAECVDAKELWSIPS-----------------------------------------------
TDRD3_MOUSE     VVKFTDYGNYEEV---------------------------------------------------------
TDRD3_RAT       VVKFTDYGNYEEV---------------------------------------------------------
TDRD3_DANRE     VVVFSDYGNCEEV---------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           YKVGTSEYVTVYYDSGNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSRKNIWEYGDFT
SND1_PONAB      HLSAGCPHVTLQF--ADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFR
SND1_BOVIN      HLSAGCPHVTLQF--ADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFR
SND1_MOUSE      HLSASCPHVTLQF--ADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFR
SND1_HUMAN      HLSAGCPHVTLQF--ADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFR
SND1_RAT        HLSASCPHVTLQF--ADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFR
SND1_DANRE      YSGMVCPQVTLQF--ADTKEDVGLGLVKEGMVMVDIRKEKYLQKMVTEYLNAQESAKSARLNIW------
SND1_SCHPO      GHEGNVYSVTLYNPSDGSDFSINAQLVALGMAVIPKKKTSHFEKDTASLNILEEHQQEARLNFWVYGD--
TDRD1_HUMAN     DKLENSSLVELIDKSETPHVSVSKVLLDAGFAVGE-----------------------------------
TDRD1_MOUSE     AISKNVHAVSVEKCSENGMINIAENLVMCGLA--------------------------------------
STK31_HUMAN     IKMATSEDGTVIAQAEYGSVDIGEEVLKKGFA--------------------------------------
TDRKH_HUMAN     VQTGISTWPKIYYDTSNKKLDIGLELVHKGYAI-------------------------------------
TDRD1_DANRE     GFDGTSNLLTLTQQSGQSDRDI-NSIILGALQKGQIKPSSKLPANVNE----------------------
STK31_MOUSE     IKMATYQDGTVIAQAEYGTVDIGEEVAKKGFA--------------------------------------
TDRKH_MOUSE     VQTGISTWPKIYYDSDEKKLDIGLELVRKGYAV-------------------------------------
TUD_DROME       ----------------------------------------------------------------------
TDRD6_HUMAN     HGIIADDMISRYALSEKSQVELSTQVIKSASSKSVNKSDIDTSVFLNWYNPEKKMIR-------------
TDRD1_ORYLA     ----------------------------------------------------------------------
TDRD5_MOUSE     ----------------------------------------------------------------------
AKAP1_HUMAN     YSPTGLPLIQLWSVVGDEVVLINRSLVERGLA--------------------------------------
SPF30_DANRE     ----------------------------------------------------------------------
TDRD9_MOUSE     SIVHSVLHVDVYYSGAQDAVNVRDVLIREGYALAEESYESK-----------------------------
RNF17_MOUSE     ----------------------------------------------------------------------
TDRD3_BOVIN     ----------------------------------------------------------------------
RNF17_HUMAN     ----------------------------------------------------------------------
TDRD7_RAT       ----------------------------------------------------------------------
TDRD7_MOUSE     ----------------------------------------------------------------------
TDRD9_HUMAN     SVVHSVLHVDVYQYSGQDAINIRDVLIQQGYA--------------------------------------
TDRD9_RAT       SIVHSVLHVDVYYSGAQDAVNIRDVLIREGYALAEESYESK-----------------------------
TDRD7_HUMAN     ----------------------------------------------------------------------
TDRD3_HUMAN     ----------------------------------------------------------------------
TDRD7_PONAB     ----------------------------------------------------------------------
SPF30_XENTR     ----------------------------------------------------------------------
RNF17_MACFA     ----------------------------------------------------------------------
TDRD5_HUMAN     ----------------------------------------------------------------------
AKAP1_RAT       YSATGLPLIQLWSVVGDEVVLINRSLVERGLA--------------------------------------
AKAP1_MOUSE     YSATGLPLIQLWSVVGDEVVLINRSLVERGLA--------------------------------------
TDRD6_MOUSE     ----------------------------------------------------------------------
TDRD3_MOUSE     ----------------------------------------------------------------------
TDRD3_RAT       ----------------------------------------------------------------------
TDRD3_DANRE     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           GNDx
SND1_PONAB      ADD-
SND1_BOVIN      ADD-
SND1_MOUSE      ADD-
SND1_HUMAN      ADD-
SND1_RAT        ADD-
SND1_DANRE      ----
SND1_SCHPO      ----
TDRD1_HUMAN     ----
TDRD1_MOUSE     ----
STK31_HUMAN     ----
TDRKH_HUMAN     ----
TDRD1_DANRE     ----
STK31_MOUSE     ----
TDRKH_MOUSE     ----
TUD_DROME       ----
TDRD6_HUMAN     ----
TDRD1_ORYLA     ----
TDRD5_MOUSE     ----
AKAP1_HUMAN     ----
SPF30_DANRE     ----
TDRD9_MOUSE     ----
RNF17_MOUSE     ----
TDRD3_BOVIN     ----
RNF17_HUMAN     ----
TDRD7_RAT       ----
TDRD7_MOUSE     ----
TDRD9_HUMAN     ----
TDRD9_RAT       ----
TDRD7_HUMAN     ----
TDRD3_HUMAN     ----
TDRD7_PONAB     ----
SPF30_XENTR     ----
RNF17_MACFA     ----
TDRD5_HUMAN     ----
AKAP1_RAT       ----
AKAP1_MOUSE     ----
TDRD6_MOUSE     ----
TDRD3_MOUSE     ----
TDRD3_RAT       ----
TDRD3_DANRE     ----