[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cele0:AAC47965.1

[Show Plain Result]


## Summary of Sequence Search
    1::2076
    1::2038      0.0  37% 2070 aa  HTR5B_MOUSE RecName: Full=HEAT repeat-containing protein 5B;
    1::2039      0.0  37% 2071 aa  HTR5B_HUMAN RecName: Full=HEAT repeat-containing protein 5B;
    1::2020      0.0  36% 2052 aa  HTR5B_XENTR RecName: Full=HEAT repeat-containing protein 5B;
    1::2007      0.0  35% 2040 aa  HTR5A_HUMAN RecName: Full=HEAT repeat-containing protein 5A;
    1::1896      0.0  36% 1998 aa  HTR5A_DANRE RecName: Full=HEAT repeat-containing protein 5A;
    1::1879      0.0  35% 2038 aa  HTR5A_MOUSE RecName: Full=HEAT repeat-containing protein 5A;
    3::1988      0.0  33% 2021 aa  HTR5A_XENTR RecName: Full=HEAT repeat-containing protein 5A;
 1306::1662    5e-17  25% 2014 aa  LAA1_YEAST RecName: Full=AP-1 accessory protein LAA1;AltName:
  546::592     3e-10  24% 1919 aa  YBC8_SCHPO RecName: Full=Uncharacterized protein C27B12.08;
    1::2076

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDETHSLLLNEEALEACPEQKRPVFIYEWLRYLDRILPITQREDLKNVQKELQQQLESRLHTVVGPPTRK
HTR5B_MOUSE     MELAHSLLLNEEALAQITEAKRPVFIFEWLRFLDKVLVAANKTDVKEKQKKLVEQLTGLISSSPGPPTRK
HTR5B_HUMAN     MELAHSLLLNEEALAQITEAKRPVFIFEWLRFLDKVLVAANKTDVKEKQKKLVEQLTGLISSSPGPPTRK
HTR5B_XENTR     MELAHSLLLKEDALAQITEAKKSVFIFEWLRFLDKVLIAANKTDIKENQKKLVEQLTGLISSSPGPPTRK
HTR5A_HUMAN     MELAHSLLLNEEAYNQLGEVQKAEFIFEWLRYLEKLLLATSRNDVREKQKTLVEQXXXXXXXXXXXXTRK
HTR5A_DANRE     MEQAHSLLLNEEACSQLPEHQRAEFVFEWLRFLKKLLPATDRADVKQKQKRLVEQLTTVLTSSPGPPTRL
HTR5A_MOUSE     MELAHSLLLNEEASNQLGAVQKAEFIFEWLRYLEKLLLATNREDVREKQKTLVGQXXXXXXXXXXXXTRK
HTR5A_XENTR     LEERGLQLLDVAELE---EPQRGLRVLEWLRHLRRVLPVITRAEIKENQKQLVEQLLLVMMGFPGPPARR
LAA1_YEAST      ----------------------------------------------------------------------
YBC8_SCHPO      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LIARCIGRVYALTGDIVSLNTLLNSCNDTLKVKDESPKAVQSKLAALACLSAVYDSMGRMAGRSIEDTLA
HTR5B_MOUSE     LLAKNLAALYSI-GDTYTVFQTLDKCNDIIRSKDDTAAYLPTKLAAVACVGAFYEKMGRMLGSAFPETVN
HTR5B_HUMAN     LLAKNLAALYSI-GDTFTVFQTLDKCNDIIRNKDDTAAYLPTKLAAVACVGAFYEKMGRMLGSAFPETVN
HTR5B_XENTR     LLAKNLATLYSI-GDTFTVFQTLDKCNEMIKNKDDTPAYLPTKLAAVACVGAFYEKMGRMLGSSFPETVN
HTR5A_HUMAN     LLAKNLAILYSI-GDTFSVHEAIDKCNDLIRSKDDSPSYLPTKLAAVVCLGSLYKKLGRILGNTFTDTVG
HTR5A_DANRE     LLAQCLALVYRV-GDSLTSSLTVDRCNDIIRSKDDSPSFLPTRLAAVACLGALYEQLGRLLINSFKETTT
HTR5A_MOUSE     LLAQDLAILYSV-GDTVSVYETIDKCNDLIRSKDDSPSYLPTKLAAVVCLGSLYKKLGRILANGFTDTVV
HTR5A_XENTR     LLAYNMAFVYS-SGDTFSVYETIDRCNDVIRSKDDSPSYLPSKLAAVACLGALYQKLGRLLGSTFSDTVS
LAA1_YEAST      ----------------------------------------------------------------------
YBC8_SCHPO      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IVKNWMSTAVAHSQAHIMNTLTSMVKALGSGDYVTHKKIHSIAKNSLQDRTLCKTPNVKIASLECLTALV
HTR5B_MOUSE     NLLKSLKSAESQGRSEILMSLQKVLTGLGGAAASSHRDIYKNARSLLTDRSMA----VRCAVAKCLLELQ
HTR5B_HUMAN     NLLKSLKSAESQGRSEILMSLQKVLSGLGGAAASSHRDIYKNARSLLTDRSMA----VRCAVAKCLLELQ
HTR5B_XENTR     NLLKSLKGAESQGRSEILMSLQKVXXXXXXXXXXXHRDIYKNARSVLTDRSMA----VRCATAKCLLELQ
HTR5A_HUMAN     NILKAMKSAESQGRYEIMLSLQNILNGLGAAAAPCHRDVYKAARSCLTDRSM---------AVRCAAAKN
HTR5A_DANRE     NLLKAMRSAESQGRCEIMLCVERILRGLGVSAVSCHRDIYKAARTGLTDRSMA----VRCAAAKCLLELQ
HTR5A_MOUSE     NILKAMKSAESQGRYEIMLSLQSILTGLGAAAAPCHRDVYKAARSCLTDRSMA----VRCAAAKCLLELQ
HTR5A_XENTR     NLLKVLRSAESQGRSEIMLSLERILKGLGSAAIPCHRDIYKAARSCLTDRSM----SVRCSAAQCLLALQ
LAA1_YEAST      ----------------------------------------------------------------------
YBC8_SCHPO      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           QFHTPIYTTELEASCTMCIKILEGSTYELRCAVAKFTAQLLATSMKPPPGAVIKAKSNQTVPVRPASVTD
HTR5B_MOUSE     NEAVFMWTAELENVATLCFKALENSNYGVRVAVSKLLGTVMATALMPKQATVMRQN------VKRATFDE
HTR5B_HUMAN     NEAVFMWTAELENIATLCFKALENSNYGVRVAVSKLLGTVMATALMPKQATVMRQN------VKRATFDE
HTR5B_XENTR     SEAVFMWTAELENVATLCFKALEGSNYGVRVAVSKLLGTVMATALMPKQATVMRQN------VKKATLEE
HTR5A_HUMAN     EAIF-MWSTDLDSVATLCFKSFEGSNYDVRISVSKLLGIILAKAVSKHPGTAASRQS-----IRRVSXXX
HTR5A_DANRE     REAVFLWSTELDNVATLCFRALEGSNYDVRVSISKLLGTLLASALEP----------RQAIAPRPGSXXX
HTR5A_MOUSE     NEAIFMWSTDVDSVATLCFKSFEGSNYDVRISVSKLLGTVLAKAVTAKPGAGSKQSA------RRVSXXX
HTR5A_XENTR     KEASFMWGSDLESLASICFKAFEGSSYEVRLAVARLLGKVLARAMQ---GATSPRQN-----ARKLSLQE
LAA1_YEAST      ----------------------------------------------------------------------
YBC8_SCHPO      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           TLNLLASGFLRGGIGGFLKGSSSTFSTMGRSDIRIGVSICYVEMVREMGSAWLEKHLIAVCCHMVDLASK
HTR5B_MOUSE     VLELMATGFLRGG-SGFLKSGGEMLKVGGNREVRVGVTQAYVVFVTTLGGQWLERSFATFLSHVLDLVS-
HTR5B_HUMAN     VLELMATGFLRGG-SGFLKSGGEMLKVGGNREVRVGVTQAYVVFVTTLGGQWLERSFATFLSHVLDLVS-
HTR5B_XENTR     VLELMATGFLRGG-SGFLKSGGEMLKGGGSREVRVGVTQAYVVFVTALGGKWLERNFATFLSHVLDLVS-
HTR5A_HUMAN     XXXXXGTGFLRGS-SGFLRASGDMLSSVSR-DVRVGVTQAYVVFVSTLGGAWLEKNFAAFFSHILSLASP
HTR5A_DANRE     XXXXXXXGFLRGG-AGFLRASGDMLSSVSR-DVRVGITQTCVVFVSILGGVWLETHFSRLLSLLMEWAS-
HTR5A_MOUSE     XXXXXGAGFLRGS-SGFLRASGDMLSSVSR-DVRVGVTQAYVVFVSTLGGAWLEKNLAAFLSHILSLVSQ
HTR5A_XENTR     VLGLLSTGFLRGNSXXXXXXXXXXXXTVTTRHVRLGATQAYIVFIRTLGGHWLARNVPVLLSHSLELISN
LAA1_YEAST      ----------------------------------------------------------------------
YBC8_SCHPO      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           CGHLAYTQNASHVSEALTIRRCISFILRQTIGSLLGENAQTLACKHLGVLLSQYVDLVSIGTGDNLXXXX
HTR5B_MOUSE     --HPRATQ--THV-DAVYSRRCVSFMLRATVGSLLGEKAQIAAAKEICQAIGKQMKAVEAVVNDTSSENK
HTR5B_HUMAN     --HPRATQ--THV-EAVYSRRCVSFILRATVGSLLGEKAQIAACQAIGKQMKAVEAVVNDTSGEN--KSG
HTR5B_XENTR     --HPRATQ--THV-EAVYSRRCVSFILRATVGSLLGEKAQNAAAKEICQAISKQMKSVEXXXXXXXXXXK
HTR5A_HUMAN     -SHPKATQTQI---DAVCCRRCVSFILRTTIGGLLGEKAQLAAVKDICQALKKVMDAV-MSDGNLETRLG
HTR5A_DANRE     -----HTRATQYPADAVSCRCCVSFILRATLGTLLGEKAQIAAAKEICQVISKQKRVVSLHEGNMETRVS
HTR5A_MOUSE     SNPKA-TQTQI---DAVCCRRCVSFILRATLGGLLGEKAQIAAAKEIAVWRLKKVMDAALSDGNVETRLS
HTR5A_XENTR     ------PKAIQNPTDAACSRCCISYILRATVGELLGEKAQLEAAREICEVIRKLMKTVDAVLSDNLETRF
LAA1_YEAST      ----------------------------------------------------------------------
YBC8_SCHPO      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           XXXXXXXXXAIIVILQEISVLVRQIGTSVMSLFTEATGIMEHIFKCLTHPLASARYAAAWCLRCIATAVP
HTR5B_MOUSE     SGTADIAASQHVMVLQELGSLVQSLNATASPLIQEASGLLEIVTSVLLHPSMXXXXXXXXXXXXXXXXLP
HTR5B_HUMAN     AADIAASQHVMVCALQELGSLVQSLNATASPLIQEASGLLEIVTSVLLHPSMXXXXXXXXXXXXXXXXLP
HTR5B_XENTR     SGTADVSASQHVMVLQELGSLVQSLNSTASPLILEPSGLLDTVTNVLLHPSMXXXXXXXXXXXXXXXXLP
HTR5A_HUMAN     STDVAASQHMLVCALQELGNLIHNLGTTAAPLLQDSTGLLDSILSVILHPSISVRLAAAWCLHCIAVALP
HTR5A_DANRE     PADVAASQHVLVCALLELGSLVQDLSSTAAPLLQDTIGMLDTVISVLLHPSASARLASAWCLRCIAVGMP
HTR5A_MOUSE     STDVAASQHVLVCALQELGNLIHNLGTTAAPLLQDSTGLLDSVISVVLHPSISVRLAAAWCLHCIAVALP
HTR5A_XENTR     CTTDISASQHVLVCLQELGDLFLGLGTILAPLLKDSSGVLDTVLSVSLHPSLSARLAAAWCLRSVIVSLP
LAA1_YEAST      ----------------------------------------------------------------------
YBC8_SCHPO      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           NLMTPLIDRCLPRLDQLSSSSRAISGFSMXXXXXXXXXXXXXXXGIPYAKPLKVLDLAEEMLRTSTQQPK
HTR5B_MOUSE     FQLTPFLDRCAERLNNLKTSPEAVSGYSFAMAALLGGVHQCPL-GIPHAKGKMVVSIAEDLLRTAAQNSR
HTR5B_HUMAN     FQLTPFLDRCAERLNNLKTSPEAVSGYSFAMAALLGGVHQCPL-GIPHAKGKMVVSIAEDLLRTAAQNSR
HTR5B_XENTR     FQLTPLLDRCAERLNNLKNSPEAVSGYSFAMAALLGGVHQCPL-GIPHSKGKMVVGIAEDLLRTAAQNSR
HTR5A_HUMAN     SYLTPLLDRCLERLTGHKSSPEAVTGFSFAVAALLGAVKHCPL-GIPHGKGKIIMTLAEDLLCSAAQNSR
HTR5A_DANRE     AQVAVLLDRCVERLNALKSCPEAVAGYSAAIAALLGAVQLSPL-GISHSKGKMVMTLAEDLLRSAAQNSR
HTR5A_MOUSE     SYLTPLLDRCLERLAILKSSPEAVTGFSSAVAALLGSVTHCPL-GIPHGKGKIIMTIAEDLLCSAAQNSR
HTR5A_XENTR     SLAAPVLDRCVERLTALKSSPEAVSGYSLTAAVLLGSIRLCPL-GVPHGKGKVVMSLAKDLLCTASQNSR
LAA1_YEAST      ----------------------------------------------------------------------
YBC8_SCHPO      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           LTIAKLESGWNLIYALIHLGPSVMKEHLPRVIKLWKAAFARSAKEAESENSRGDAFSWQCAMIAQAGALS
HTR5B_MOUSE     LSLQRTQAGWLLLGALMTLGPSVVRYHLPKMLLLWRNVFPRSLKELEAEKARGDSFTWQVTLEGRAGALC
HTR5B_HUMAN     LSLQRTQAGWLLLGALMTLGPSVVRYHLPKMLLLWRNVFPRSLKELEAEKARGDSFTWQVTLEGRAGALC
HTR5B_XENTR     LSLQRTQAGWLLLGALMTLGPSVVRYHLPKMLLLWRNVFPRSLKELEAEKARGDSFTWQVTLEGRAGALC
HTR5A_HUMAN     LSAQRTQAGWLLISALMTLGPAVVSHHLARVLLLWKCVFPASPKDLETEKSRGDSFTWQVTLEGRAGALC
HTR5A_DANRE     ISIQRTQGGWLLLGALSTLGPTVMEHHLPRLLLLWKCAFPLSVKDVEMELRRGDSFTWQVTLEGRAGALC
HTR5A_MOUSE     LSLQRTQAGWLLVAALMTLGPAVVSHHLTRVLLLWKCVFPASPRDLETEKSRGDSFTWQVTLEGRAGALC
HTR5A_XENTR     FSLQRTQAGWLLIASLMTLGPAVVQSQLGCLLLLWRSVFPVTPKDLDTERRRGDAFTWQVTLEGRAGALG
LAA1_YEAST      ----------------------------------------------------------------------
YBC8_SCHPO      ---AQIKTGWRLLSAYVSFGPSFTRMQLSQLLILWKNALSRVPSKIHSQN--------------------


                         .         +         .         .         .         .         *:700
query           VMEAVASQPELSSTNNALDAMKVPIECSLVMMSQVGNLIKSYGNEMRQANSVVXXXXXXXXXXXPHKSFE
HTR5B_MOUSE     AMRSVAHCPEL-LTEDAIRKLMTPIECAMTMMSHIPSVIKAHGAHLKASAAMVRLRLYDILALLPPKTYE
HTR5B_HUMAN     AMRSVAHCPEL-LTEDVIRKLMTPIECAMTMMSHIPSVMKAHGAHLKASAAMVRLRLYDILALLPPKTYE
HTR5B_XENTR     AMRSVAYCPEL-LTEDVIRKLMTPIECAMTMMSHILSVIKAHGAHLKASAAMVRLRLYDILALLPPKTYE
HTR5A_HUMAN     AIKSFVSHCGDLLTEEVTQRLLPPLPCAVDLLTQLSSILKMYGSPLKTPSVVYRQRLYELLILLPPETYE
HTR5A_DANRE     AIKSLVVHCKELLTDDVICRFVPLLSCAVALLTQLPSIIKSYGNQIKNAATVFKLRLYEILKLLQPKIYE
HTR5A_MOUSE     AVKSFISHCGDLLTEEVIQRLLPPLPCAVDLLTQLSSILKTYGSSLKTPSIVYRQRLYELLILLPPETYK
HTR5A_XENTR     AMRSFVSHCGELMSEEVLQRXXXXXXXXXXXXXXXXSLQKLYGNSLKACSXXXXXXXXXXXXXXXXKTYE
LAA1_YEAST      ----------------------------------------------------------------------
YBC8_SCHPO      ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           GSYAALLRELVADITLSDNSQSTLTTSLPISQFTGVEKILISPVYDATDYSMVEDLLQTPISSVSLGNIE
HTR5B_MOUSE     GSFNALLRELVAEFTLTDNSANT-TTSLLRSLCHYDDSVLLGSWLQETDHKSIEDQLQ-PNSASGSGALE
HTR5B_HUMAN     GSFNALLRELVAEFTLTDNSANT-TTSLLRSLCHYDDSVLLGSWLQETDHKSIEDQLQ-PNSASGSGALE
HTR5B_XENTR     GNFNVLLRELVAEFXXXXXXXXXXXXXXXXXCHYD-DSVLLGSWLQETDHKSIEDQLQ-PNSASGSGALE
HTR5A_HUMAN     GNLCAILRELAADLTAPDIQVAASTFLLPPLCHQD-DLLILSPFLQETDHRFIEEQLLLG-NGVACGSLE
HTR5A_DANRE     ESFGTVLKQLLNDLTITACAERNLLPSLCYSQ----DLALLGPGLQDMDQRYIEE--QLHXXXXXXXTLE
HTR5A_MOUSE     GNLCVILKELAAELTAPDTQAAASTCLLPALCHPD-DLLILSPLLQETDHRFIEEQLLLG-NGVACGSLE
HTR5A_XENTR     ESFCAVMKELVADLTSPDYSPGGAAFLLS-SVCHPDDLVLLGPSFQECD-QRATXXXXXXXXXXXXXXXX
LAA1_YEAST      ----------------------------------------------------------------------
YBC8_SCHPO      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           EDLSNLIRASASQIGDTWPENDSEPLTCLNTALLTYGKVFPLVNNKHKVQITEHFWDTIQKSKNAGRKQA
HTR5B_MOUSE     HDPSSILRIPA---GEAVPGPLPLGVSVIDASVALFGVVFPHVSYKHRLQMLDHFAECVKQAKGV-RQQA
HTR5B_HUMAN     HDPSSILRIPA---GEAVPGPLPLGVSVIDASVALFGVVFPHVSYKHRLQMLDHFAECVKQAKGV-RQQA
HTR5B_XENTR     HDPSSILRIPA---GEAVPGPLPLGVSVIDASVALFGVVFPHVSFKHRLQMLDHFAECVKQAKGV-RQQA
HTR5A_HUMAN     YDPYSIYEKDVE--GDSVPKPLPPALSVISSASKLFGVVCAHVGETQRLLILEQLLDSIKHTKGA-RXXX
HTR5A_DANRE     YDSFTIFEKSQ--------------------------------------EVLEQFCEFVRQLKGA-RQQT
HTR5A_MOUSE     YDPYSIYEKDVE--GDSVPKPLPPALSVISSASKLFGVVCATVDEAQRVLILEQLLNSIKHTKGA-RQQT
HTR5A_XENTR     YDLHAIYELPSE--GESVPKPLPSAFTVIQAASLLFGTLLAHMPESQRPQILQQLVESIKQTKGS-RQQS
LAA1_YEAST      ----------------------------------------------------------------------
YBC8_SCHPO      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           ILVNALTAKLLSYKTLCEQRGHKLDNETLQRAXXXXXXXXXXXXCPMTRLVGAEALARLSQAVNSPPFVA
HTR5B_MOUSE     VQLNIFTAVLSALKGLAENKS-TLGPEEVRKSALTLVMGALDNPNPILRCAAGEALGRMAQVVGEASFIA
HTR5B_HUMAN     VQLNIFTAVLSALKGLAENKS-TLGPEEVRKSALTLVMGPLDNPNPILRCAAGEALGRMAQVVGEATFIA
HTR5B_XENTR     VQLNIFTAVLSALKGLAENKS-SLGPEEVRKSALTLVMGALDNPNPILRCAAGEALGRMAQVVGEASFIA
HTR5A_HUMAN     XXXXXXXXXXXFLKYVAGSKGC-LGPEEMKRFALTLVMGALESPNPLLRCAAAESWARLAQVVDDGAFTA
HTR5A_DANRE     VQIHVTAAFFCTLKSLASSR-RELGPEEVQRPXXXXXXXXXXXXNPLLRCMAAEGLARLVQVLIDPGFTV
HTR5A_MOUSE     VQLHVVSANLLKYVAGSKQ---SLGPE-VRRLVLTLVLGALESPTPLLRCAASEAWARLAQVADDGAFTA
HTR5A_XENTR     VQLCAMSSLCNFLKHLASSRSN-LGPEEMRKPCLSLIQAVLEGNSLWLRCAGVESVARLVQVVDDPTFTA
LAA1_YEAST      ----------------------------------------------------------------------
YBC8_SCHPO      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           SIAQYCFDKLNSCKDEINRSGHVLALGCLHRHVGSLGSGQHLNTGVSVVLALAEESKMPKVQTCALVAMA
HTR5B_MOUSE     RMAQYSFDKLKSARDVVSRTGHSLALGCLHRYVGGIGSGQHLKTSVSILLALAQDGTSPEVQTWSLHSLA
HTR5B_HUMAN     RMAQYSFDKLKSARDVVSRTGHSLALGCLHRYVGGIGSGQHLKTSVSILLALAQDGTSPEVQTWSLHSLA
HTR5B_XENTR     RMAQFSFDKLKSARDVVSRTGHSLALGCLHRYVGGIGSGQHLKTSVSILLALAQDGTSPEVQTWSLHSLA
HTR5A_HUMAN     GLAQVSFDKLKSARDVVTRTGHSLALGSLHRYLGGISSSQHLNSCIGILYTLAQDSTSPDVQTWALHSLS
HTR5A_DANRE     SLTLMSFDKLKTARDAITRTGHALALGTVYRYLGGISSPQYLSACVGVLFTLSQDNTSPEVQMWALHALS
HTR5A_MOUSE     GLAQLSFDKLKSARDVVTRTGHSLALGSLHRYLGGIGP-QHLSSCIGVLYTLSQDSTSPDVQTWALHSLS
HTR5A_XENTR     GLIQASFDKLKTARDVVARTSHSLVLGTLHRYLGGINSSQHLASCVGVLHSLSQDTTSPEVQTWALHSLS
LAA1_YEAST      ----------------------------------------------------------------------
YBC8_SCHPO      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           LIAETGSGMFRVFVETTLSSCLKLLISTPTFVVDVVQGISKCLTALITCVGPELSCPGVIDGVRTSLLAA
HTR5B_MOUSE     LIVDSSGPMYRGYVEXXXXXXXXXXXXXXXXHTEVHQCLGRCLGAIITTVGPELGNAATISTIRSSCLVG
HTR5B_HUMAN     LIVDSSGPMYRGYVEXXXXXXXXXXXXXXXXHTEVHQCLGRCLGAIITTVGPELQGNGATTSIRSSCLVG
HTR5B_XENTR     LIVDSSGPMYRGYVEXXXXXXXXXXXXXXXXHTEVHQCLGRCLGAIITTVGPELQGNGTISTIRSSCLVG
HTR5A_HUMAN     LIIDSAGPLYYVHVEPTLSLIIMLLLNVPPTHAEVHQSLGRCLNALITTLGPELQGNSTISTLRTSCLLG
HTR5A_DANRE     TVVDLAGPLYHSHLEASFTLVLRLLLSTPHTHVEVQQSLGRCLNALITSVGPDLQGEGPVCAVRTSCLVG
HTR5A_MOUSE     LTIDSAGALYHVHVESTLSLIVMLLLNVPPTHAQVHQSLGRCLNALITTLGPELQGSNTVSALRTSCLLG
HTR5A_XENTR     VITDLSGPLFNVHIEXXXXXXXXXXXXXXPSHPEVHRSLGRCLSALVTALGPELQGNGVLSSQRTSCLLA
LAA1_YEAST      ----------------------------------------------------------------------
YBC8_SCHPO      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           CAIQLSHSDPFVQAEAISGLQQMHLFAPRYVHMAQLVVDISSLLSSTHLVIRRQSVSCLRQLVQRESKEV
HTR5B_MOUSE     CAITQDHSDSLVQAAAISCLQQLHMFAPRHVNLSSLVPXXXXXXXXXXXXXXXXXXXXXXXXXXXEAAEV
HTR5B_HUMAN     CAITQDHSDSLVQAAAISCLQQLHMFAPRHVNLSSLVPXXXXXXXXXXXXXXXXXXXXXXXXXXXEAAEV
HTR5B_XENTR     CAIMQDHSDSLVQAAAISCLQQLHMFAPRHVNLSSLVPCLCVHLGSSHXXXXXXXXXXXXXXXXXEAAEV
HTR5A_HUMAN     CAVMQDNPDCLVQAQAISCLQQLHMFAPRHXXXXXXXXXXXXXXXXPYXXXXXXXXXXXXXXXQREAAEV
HTR5A_DANRE     CAVMQDSQDCLVQALAISCLQQLHMFAPRFVNLSSLVPSLCINLCSSYLSLRRAVVACLRQLAQREAVEV
HTR5A_MOUSE     CAVMQDHPGCLVQAQAISCLQQLHMFAPRHXXXXXXXXXXXXXXXXPYXXXXXXXXXXXXXXXQREAAEV
HTR5A_XENTR     CSVMQENPDCLVQAQGISCLQQLHMYAPKHVNLSSLVPTLCVHLYSPHLPLRRAVLACLRQLAQREAAEV
LAA1_YEAST      ----------------------------------------------------------------------
YBC8_SCHPO      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           RNHAQVLVPQGIVDTNKKKFALPESGLEGALFGMLDTEVNKELRCHLQETLISLVQGTSGELLNNWLMLS
HTR5B_MOUSE     CEYAMSLAKNAISGGNVNPFTITDTGLEGLLFGMLDRETDRKLCSDIHDTLGHMLSSLAVEKLSHWLMLC
HTR5B_HUMAN     CEYAMSLADKESSSANVSPFAITETGLEGLLFGMLDRETDRKLCSDIHDTLGHMLSSLAVEKLSHWLMLC
HTR5B_XENTR     CEYAMNLAKNGDKESSGLNINITDTGLEGVLFGMLDRETDRKLCSDIHDTLGHMLSSLAVEKLSHWLQLC
HTR5A_HUMAN     SEHAVMLAKDSREELTPDA-NIREVGLEGALLILLDKETDERLCHDIKETLNYMLTSMAVEKLSLWLKLC
HTR5A_DANRE     SEHAVALVKEPRRDNTQLDVTIKEVGLEGALFSLLDRESDPRLCRDIQETLVHMMSSAAESKLAHWLKLC
HTR5A_MOUSE     SEHAIMLXXXXXXXXXXXN--XXXXXXXXXXXXXXDRETDESLCQDIRETLHHMLTSMAVGKLTLWLKLC
HTR5A_XENTR     SEHAMTVAKEGHEDL-KMEMNMRXXXXXXXXXXXXDRESDQQLLRDVKETLLHMQNCTGLSRLSFWLRML
LAA1_YEAST      ----------------------------------------------------------------------
YBC8_SCHPO      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           KEILATSNDHGLVXXXXXXXXXXXXXXXXXXXXXXXXXTNLAGISSLMEEDKGKVQPRWPTKVFTMEIVN
HTR5B_MOUSE     KDVLAASSDMSAA--------TLLXXXXXXXXXXXXXXXXXAMFTTLGEEDKSKVAPRWATRVFAADCLC
HTR5B_HUMAN     KDVLAASSDMSTATLLSSGXXXXXXXXXXXXXXTM--------FTTLGEEDKSKVAPRWATRVFAADCLC
HTR5B_XENTR     KDVLAASSDVGTTGPVSGGXXXXXXXXXXXXXXTM--------FTTLGDDDKSKVAPRWATRVFAADCLC
HTR5A_HUMAN     KDVLAASADFTAVTCVDTMQEEEGDKGDD------------ASVLTTRRDEKSHTNPRWATRVFAAECVC
HTR5A_DANRE     KDVL-----------XXXXXXXXXXXVETQQEEDGDRYDDSSAFHAKSESSGPFNNLRWSTRVFSMECVC
HTR5A_MOUSE     KDVLAASADFTAV-----------TCVDTMQEEEGDRGDDASVLTRGDDKPHPFSNPRWATRVFAADCVC
HTR5A_XENTR     KDIL----------XXXXXXXXXXXXXTNQEDEGEVACSDSVLTSSKAESLGSSVTPHWKTRIFAMECVC
LAA1_YEAST      -----------------------------------------ANVNQLTDTDAGGLDSQWKSRQI---ILN
YBC8_SCHPO      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:1330
query           RLMSVCDTERAHLDMALAKELQITSAGKNDYLVLHLSDLVRMSFMAATSDNSLLRIAGLKSLEEVIIRFS
HTR5B_MOUSE     RIINLCESDQAHFDLALARSAKLRNP-KNDLLVLHLSDLIRMAFMAATDHSNQLRMAGLQALEDIIKKFA
HTR5B_HUMAN     RIINLCEADQAHFDLALARSAKLRNP-TNDLLVLHLSDLIRMAFMAATDHSNQLRMAGLQALEDIIKKFA
HTR5B_XENTR     RIILLCESDKVHFDLAQARAARLKNP-KNDLLVLHLSDLIRMAFMAATDHSNQLRMAGLQALEDIIKKFA
HTR5A_HUMAN     RIINQCEANSAHFDIALAQEMKKRDS-RNDFLVLHLADLIRMAFMAATDHSDQLRLSGLEMLLVVIRRFA
HTR5A_DANRE     RIIAQCENDSAHFNMALAQEQRLHES--TDFLVLHLADLIRMAFMASTDHSDQLRLAGLQTLLVIIRKFS
HTR5A_MOUSE     RIINQCEANRAHFDIALAQEMKKRDS-RNDFLVLHLADLIRMAFMAATDHSDQLRLSGLDTLLVVIRRFA
HTR5A_XENTR     QLITQCELDGAHFDMAQAQEMK-HKEPERDFLVLHLQDLIRMSFMAATDHSEXXXXXXXXXXXXXIHRFA
LAA1_YEAST      LILMLCLESEKYENLLLALSNKI-------------ADLIKISFRGSTVRNEGMKLTGLHILNFVLKNYS
YBC8_SCHPO      ------------------------------YLISRISDLVRAAFVLSTSDNFYLKQGGFELLDTIITDFS


                         .         +         .         .         .         .         *:1400
query           SCPEPEFPGHMILEQFQAQVGAALRPAFTDDTPSNVTSVACQVCSTWIGSGVARDLSDLKRVHQLLVSSL
HTR5B_MOUSE     SVPEPEFPGHVILEQYQANVGAALRPAFSQDTPSDIIAKACQVCSTWIGSGVVSDLNDLRRVHNLLVSSL
HTR5B_HUMAN     SVPEPEFPGHVILEQYQANVGAALRPAFSQDTPSDIIAKACQVCSTWIGSGVVSDLNDLRRVHNLLVSSL
HTR5B_XENTR     SVPEPEFPGHVILEQYQANVSAALRPAFSQDTPSDITAKACQVCSTWIGSRVVSDLNDLRRVHNLLVSSL
HTR5A_HUMAN     TVPEPEFPGHVILEQYQANVGAALRPAFTSETPPDVTAKACQVCSAWIASGVVSDLNDLRRVHQLLVSSL
HTR5A_DANRE     NVPEPEFPGHVILEQYQANVGAALRPAFHVDAPPNVTAKACQVCSAWIASGVISDLRDLRRVHQLLASSL
HTR5A_MOUSE     DIAEPEFPGHVILEQYQANVGAALRPAFTSETPPDITAKACQVCSAWIASGVVSDLSDLRRVHQLLVSSL
HTR5A_XENTR     AVPEPEFPGHLILEQFQANVLAAVRPAFNTDTPPDVTARACEVCSAWLASGVVKELADLQRVQQLLLTSL
LAA1_YEAST      TMRDPQVPGSSILEQQEAQITSALMPAFSKGSSPTVMSFAITVAAEVLASNIMPP-DKLGRISQLLIDLL
YBC8_SCHPO      NVMDPDFDDVSLLDXXXXXXXXXXXXXXXXXXXPEIVAMSLNIASNFIGTGLLKTESQAAKILNLLKEAL


                         .         .         .         .         +         .         .:1470
query           NKLKHGSINVQLYSESAATLEKLSILKAWAEVYVTAIEQDRMKNENVEARDHYDYNGSGSLLSLVEPEAN
HTR5B_MOUSE     DTVQAGGSSSQLYRESATTMEKLAVLKAWAEVYVVAMKPKRAMNNPXXXXXXYDELPPDSLITLVQPELP
HTR5B_HUMAN     DKVQAGGSSSQLYRESATTMEKLAVLKAWAEVYVVAMNESKPKRAIKNTXXXXXXCGTDSLITLVQPELP
HTR5B_XENTR     DKIQKGGASSQLYRESAMTMEKLSVLKAWAEVYAVAIKKEAENNPKKALKXXXXXXXPDCLITLVEPELP
HTR5A_HUMAN     TKIQAGKEALHLYNESASTMEILAVLKAWAEVYIIAVQRHKNHRQPLKTTTCLERNGSCSLLDLVYADLG
HTR5A_DANRE     AKVQVGDVPSQLYNESTFTMESLAVLKAWAEVYITAVQGSRQRDSPVSXXXXXXXXXXXXLLKLVQTDLA
HTR5A_MOUSE     TKIQAGKEALQLYNESASTMEILAVLRAWAEVYIIAVQRHKNHKQALKTTVNSERNGSSSLLDLVCTDLA
HTR5A_XENTR     RRVQVAKETASVYSESTTAMESLAVLKAWAEVYIAAMEKQVTQSKMAEAQNEV-------LLSLVQXXXX
LAA1_YEAST      GNFKDPNSGIRIVTPKAKRKIELAVLDAWAEVVQRSIT-----------------SSNDALFSFTRKYWS
YBC8_SCHPO      ESSRAGFEENRHFKYDSKYFLRIATLSAWASLLVHSANVSYLK-------------------EFLSSNIR


                         .         .         *         .         .         .         .:1540
query           SLIAYWLAMLNDSALLALPAHYSDQFLNRGGAFFNAHSAEACREYYQICWPPILLACSTWLSKNNFELPS
HTR5B_MOUSE     TLSRLWLAALKDYALLTLPAEFSSQLPPDGGAFYTPETIDTARLHYRNSWAPILHAVALWLNSTGFTTVS
HTR5B_HUMAN     TLSRLWLAALKDYALLTLPAEFSSQLPPDGGAFYTPETIDTARLHYRNSWAPILHAVALWLNSTGFKRST
HTR5B_XENTR     TLSRLWLAALKDYALLTLPPEFASQLPPDGGAFYTPETIDTARLHYRNSWAPILHAVALWLNCTGFSNSD
HTR5A_HUMAN     TLSRLWLAALQDFALLTLPSEFASQLPAEGGAFYTAETSENAKLHYYNSWALILHATALWLTSTGFVVPT
HTR5A_DANRE     TLSRLWLAALQDHALLTLPPHYSSHLPSTGGSFYTAETVEQARPHYYSAWATILHATALWLNSTGFIVPT
HTR5A_MOUSE     TLSKLWLAALQDFALLTLPAEFASQLPTEGGAFYTAETSKSAKLHYHDSXXXXXXXXXXXXTSTGFADPG
HTR5A_XENTR     XXXXXXXXXXQDHALLTLPAACASQLPSQGGGFYTAETSDAARPHYLLSWAPILHASSLWLSSSGFVLPD
LAA1_YEAST      ILVPLWIISLREYMMIKYNDNDSTQVKNDSKENSLIEPRSTKIELYEPVW-------------LNFVEAL
YBC8_SCHPO      RLSSHWIMALRGYSRLQFPSLVKDFVADTSFTRVQSINPKILLNIYEKSWLNIAESLTILLSTDAYGILS


                         +         .         .         .         .         *         .:1610
query           GIELSSETAAVWRDEGNVSRFYLLIGIAVESLSNKTRQIEDETIQMSVKSLTRLLSCEWCQLHLMSDVPA
HTR5B_MOUSE     GVQKRSPAVSLNQVPGNKDRMHLILGVSIQFLCSPRPEEPIEHVTACLQALHTLLGSPYARIHIAEDQLI
HTR5B_HUMAN     SVNLNQASGAVGSPEINKDRMHLILGVSIQFLCSPRPEEPIEHVTACLQALHTLLDSPYARVHIAEDQLI
HTR5B_XENTR     TAEDGAVAGSQKRTEVNKNRMHLILGISIQFFCAPRPEEPIEHVTACLQALHILLESPFARNHIAEDQVI
HTR5A_HUMAN     SMCQGSSSGATIKSPEDVDRFHLILGISVEFLCSLRSDATMESITACLHALQALLDVPWPRSKIGSDQDL
HTR5A_DANRE     SMGQSTSLSNVKSPEDNSDRLHLILGISVEFLCSPHSGDQMENIHSCLQALQALLEVPWPRSKVGNDQAL
HTR5A_MOUSE     GANLSRPVTPTSMCQGSSSRFHLILGISVEFLCSLRSDASLESIMACLRALQALLDVPWPRWRIGSDQDL
HTR5A_XENTR     GQERGSQLPADSPEDLNLERFHLILGISVEFLCCPPVDAPMERITSCLRALKALLSGMWPKAHIGTDQDL
LAA1_YEAST      GCTLDSDVQVILASLNDEELEYFLFILFSQCLEAIVKNIDDHSVKMQVPALHNVLKSNLCIKSIFED-DI
YBC8_SCHPO      GDELSSEEDVFFQDNINYANFFLFSVCFQSLLIPSTLQGFRNPVFRIMRIMTEVLTEELC-TKVLYDHNV


                         .         .         .         +         .         .         .:1680
query           VIEILYVLHRSVLTRDCLSTQLQCIECVGSIIDAAQLAIRICASRDISNGNLESEDTLRKIPNVLFAGEE
HTR5B_MOUSE     GVEXXXXXXXXXXTWNPPSIQLLVTGVVQQIVRAAQDYL-----QEKRNALNEEDMEKESCPTLGEGGDT
HTR5B_HUMAN     GVEXXXXXXXXXXTWNPSSVQLLVTGVVQQIVRAAQDYLQ-------EKRNTLNEDDMEKEACTVLG--E
HTR5B_XENTR     GVEXXXXXXXXXXTWDTSSVQLRVTTVVQQIVRAAQHNIQEQRNAQNKDDTSEKETQVXXXXXXXXXXXI
HTR5A_HUMAN     GIELLNVLHRVILTRESPSIQLASLEVVRQIICAAQEHVKKRRSAEVDDGAAEKE-TLPEF------GE-
HTR5A_DANRE     SVELLSILHRLIVTRESPSIQLAVLELVQQIICAAQEHVREKRSAEVDDGAAEKE----TVPEFGEGRDT
HTR5A_MOUSE     GIELLNVLHRVILTRESPAIQLASLEVVRQIICAAQEHVKKRRSAEVDDGASEKE-TLPEF------GE-
HTR5A_XENTR     AIELISVLHRLLLMRESSEVQLLVLEVGRLIVNAAQDHVRRRRSAEVDDGAEEKE--------TLPVFGE
LAA1_YEAST      ITEVVEIMDRLISTGD------------------------------------------------------
YBC8_SCHPO      FPEVVDLLVRLILTED------------------------------------------------------


                         .         *         .         .         .         .         +:1750
query           GGKDGNINKDGVKTISYAILELAVCAIFKQMPQINSAQLKTNSLAALHLRKVGRLPAEGTHLVIKSMQIL
HTR5B_MOUSE     GGLIPG------KSLVFATMELLMFILVRHMPHLSTKMLDSPS----HTAMKTQLSEESARLVAATVAIL
HTR5B_HUMAN     GGDSGGLIPG--KSLVFATMELLMFILVRHMPHLSTKVSDSPS----HIATKTRLSEESARLVAATVTIL
HTR5B_XENTR     PG----------KSLVFASMELLMFILVRHMPQLSS---KLSDSPSHIVSKSQQLSEESMRLVASTVTIL
HTR5A_HUMAN     -GKDTGGLVPG-KSLVFATLELCVCILVRQLPELNP---KLTGSPGVKATKPQILLEDGSRLVSAALVIL
HTR5A_DANRE     GGLVPG------RSLVFGALELCLCTLVRKLPQLSP---KLTGSPTGRGGQTCSLSATDCRLVTSALAIL
HTR5A_MOUSE     -GKDTGGLVPG-KSLVFATLELCVCILVRQLPELNP---KLAGSPGGKASKPKTLLEEGSRXXXXXXXXX
HTR5A_XENTR     GHDTGGLVPG--HSLVVAALELCLCILIRQLPQL-SPHLSGGSVVG----KTEPLFSEARLLVASSLGIL
LAA1_YEAST      ----------------------------------------------------------------------
YBC8_SCHPO      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1820
query           VQIPSLCSPHSRVTVLPVIMYLLLGFVRESARLDEGSIQTDRAGHLXXXXXXXXXXXXXXXXXXPDDDTA
HTR5B_MOUSE     SDLPSLCSPAGCMTILPTILFLIARILKDTAKSADNQVPPPVSAAL------QGIKSIVTLSMAKTEDTQ
HTR5B_HUMAN     SDLPSLCSPAGCMTILPTILFLIARILKDTAKSADNQVPPPVSAAL-----QGIKSIVTLSMAKTEAGVQ
HTR5B_XENTR     SELPSLCSPAGCMTILPTILFLITKVLKETA------IKTDNHVPLPVSAALQGIKTIVTSSLAKTEKTQ
HTR5A_HUMAN     SELPAVCSPEGSISILPTILYLTIGVLRETAKLPGGQLSSTVAASLQALKGILSSPMARA------EKSR
HTR5A_DANRE     SELPSICSPEGSXXXXXXXXXXXXXXXXXXXK---GSVGTE-SGQLVSGILQALRTLLTSPMSRAEKSRG
HTR5A_MOUSE     XXXXXVCSPEGSISILPTVLYLTIGVLRETAKLPGGQLSCTVTASLQTLKGILTSPMARA------EKSH
HTR5A_XENTR     AELPSLCSPEGSVSVLPTLLYLVVGVLQDTVKFPDGHLTLPVTAALQALKVIVSSPMSQV------EKCR
LAA1_YEAST      ----------------------------------------------------------------------
YBC8_SCHPO      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1890
query           VSWKTIMRNAFYSVLNMSEDNERIQLDKCIIMVTAVVFTTSAPVDVVLGHQESFNKLIVLLKRHLQSDNV
HTR5B_MOUSE     KQWTTLIRSTLACILEYSQPDDCMPAPDEVSTLTAIALFLWSASSEIIGVQSLQNGCMNRFKSALNSCDP
HTR5B_HUMAN     KQWTALIRSTLACILEYSQPEDSVPTPDEVSMLTAIALFLWSASNEIIGVQSLQNGCMNRFKNALNSCDP
HTR5B_XENTR     KKWTDLIRSTLASVLESPPADSKHTVDEVSILTAIVLFLWSASAEII-GVESLQNGCISKFKAALNSSDP
HTR5A_HUMAN     TAWTDLLRSALTTILDVDETHQELDEVSLLTAITVFILSTSPEVTTIPCLQK---RCIDKFKATLEIKDP
HTR5A_DANRE     -AWTQLLQCALHTLLSWSTDKVEPGVDEVTMLTSLTIFLLYASAEVT-SVEPLQTRCIQTFRASLDSKDP
HTR5A_MOUSE     EAWTSLLQSALATVLDCWSPVDGAQEPDEVSLLTAVILSTSPEVTTVPCLQ---NRCIEKFKAALESKDS
HTR5A_XENTR     ASWTRLMQSAVSTLLNSWHLERQLVPDSVSLLTALTIFLLSANPE-VMSDPGLQNACVQRFQNSIDSKNP
LAA1_YEAST      ----------------------------------------------------------------------
YBC8_SCHPO      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1960
query           SVVMKTLQSLASIFGRKGFGGIFVKHLGKEIMPVVKRYLSKVDCENEKITESDLVILQECVKVIEVLAMS
HTR5B_MOUSE     WVQAKCYQLLLSVFSNRALSTPYIHSLA----PLVVGKLKAVE-RHRPASSTELLAVQEGIKVLETLV--
HTR5B_HUMAN     WVQAKCYQLLLSVFSNRALSTPYIHSLA----PIVVEKLKAVE-RNRPASNIELLAVQEGIKVLETLV--
HTR5B_XENTR     WVQAKCYQLLLSVFSNRALSTPYIHSLA----PIMVENLKAVERKKPKI-NTEVLAVQEGIKVIETLVAL
HTR5A_HUMAN     VVQIKTYQLLHSIFPNPAVSYPYIYSLASCIM----EKLQEIDKRKPENT-AELEIFQEGIKVLETLVTV
HTR5A_DANRE     VVLSRSYQLLLSLFGPAPVARPFILALGGRLVSQLE--------EAEKSRPAELQAVQDAIRALEALVFA
HTR5A_MOUSE     VVQMKTCQLLHSIF--------------------------------------------------------
HTR5A_XENTR     TEQLKCYRLLLSIF----------KHPVPEVVPRIMRHLSQAESRKPQSME-ELLVLQEGVNLLKTLVSA
LAA1_YEAST      ----------------------------------------------------------------------
YBC8_SCHPO      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:2030
query           AKDGKXXXXXXXXXXXXXXXXXATSHTEWRKVGPIEKKLHEMAIGRLNAAASMWPAEFKKVIEWNNELKT
HTR5B_MOUSE     ALGEEQNRVQLLALLVPTLISYLLDENSFASASSISKDLHEFALQNLMHIGPLYPHAFKTVMGAAPELKA
HTR5B_HUMAN     ALGEEQNRVQLLALLVPTLISYLLDENSFASASSASKDLHEFALQNLMHIGPLYPHAFKTVMGAAPELKV
HTR5B_XENTR     GEEQNRVQLLALLVPTLISYLLDVN--TFSSASQPSKDLHEFALQDLMRIGPLYPQAFKTVIGAAPELKA
HTR5A_HUMAN     AEE--HHRAQLVACLLPILISFLLDENSLGSATSIMRNLHDFALQNLMQIGPQYSSVFKSLVASSPALKA
HTR5A_DANRE     ADE-------------------------------------------------------------------
HTR5A_MOUSE     ----------------------------------------------------------------------
HTR5A_XENTR     VEE--QNRPSMVCMLLHLLISFLLDENALGSAPHYSRALHDFGLHSLTSFGASYPTQFRKLMGSSPALRS
LAA1_YEAST      ----------------------------------------------------------------------
YBC8_SCHPO      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:2100
query           RLESALxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
HTR5B_MOUSE     RLETAV----------------------------------------
HTR5B_HUMAN     RLETAV----------------------------------------
HTR5B_XENTR     RLETAI----------------------------------------
HTR5A_HUMAN     RLEAAI----------------------------------------
HTR5A_DANRE     ----------------------------------------------
HTR5A_MOUSE     ----------------------------------------------
HTR5A_XENTR     RLEAAL----------------------------------------
LAA1_YEAST      ----------------------------------------------
YBC8_SCHPO      ----------------------------------------------