[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cele0:AAF02170.1

[Show Plain Result]


## Summary of Sequence Search
    1::119
   58::138     9e-21  59%  178 aa  DNLZ_HUMAN RecName: Full=DNL-type zinc finger protein;
   63::151     2e-20  56%  188 aa  DNLZ_XENLA RecName: Full=DNL-type zinc finger protein;
   75::142     2e-20  64%  177 aa  DNLZ_MOUSE RecName: Full=DNL-type zinc finger protein;
   66::150     3e-20  58%  183 aa  DNLZ_DANRE RecName: Full=DNL-type zinc finger protein;
   66::136     2e-11  38%  174 aa  ZIM17_YEAST RecName: Full=Mitochondrial protein import protein
   66::136     2e-11  38%  174 aa  ZIM17_YEAS7 RecName: Full=Mitochondrial protein import protein
   66::136     2e-11  38%  174 aa  ZIM17_YEAS6 RecName: Full=Mitochondrial protein import protein
   66::136     2e-11  38%  174 aa  ZIM17_YEAS1 RecName: Full=Mitochondrial protein import protein
   73::143     3e-11  39%  175 aa  YA72_SCHPO RecName: Full=Uncharacterized protein C24H6.02c;
    1::119

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxRSFSETVPRLSATPLGKQEPQLSLSYTCKVCNSREGPKTFAKSSYEKGVVIVTCSGC
DNLZ_HUMAN      ------------------------AAALGRVEAHYQLVYTCKVCGTRSS-KRISKLAYHQGVVIVTCPGC
DNLZ_XENLA      ------------------TVPRLYCTLPAAPSSHYRLIYTCKVCATRSS-KTISKVAYHKGVVIVRCPGC
DNLZ_MOUSE      ------------------------------------LVYTCKVCGTRSS-KRISKLAYHQGVVIVTCPGC
DNLZ_DANRE      -------------RSFSEAIGQLQST-------HYHLVYTCKVCSTRS-MKKISKLAYHKGVVIVTCPGC
ZIM17_YEAST     -------------------------------KPKMMIAFTCKKCNTRSS-HTMSKQAYEKGTVLISCPHC
ZIM17_YEAS7     -------------------------------KPKMMIAFTCKKCNTRSS-HTMSKQAYEKGTVLISCPHC
ZIM17_YEAS6     -------------------------------KPKMMIAFTCKKCNTRSS-HTMSKQAYEKGTVLISCPHC
ZIM17_YEAS1     -------------------------------KPKMMIAFTCKKCNTRSS-HTMSKQAYEKGTVLISCPHC
YA72_SCHPO      -------------------------------KPTYNVSFTCTVCNTRSN-HNFSKQAYHNGTVLVQCPKC


                         .         .         *         .         .         .         .:140
query           HNHHIIADNIGWFEDFKGKNIEDHLKTRGEAVKRxxxxxxxxxxxxxxx
DNLZ_HUMAN      QNHHIIADNLGWFSDLNGKNIEEILTARGEQVHR---------------
DNLZ_XENLA      ENHHIIADNLGWFSDLEGRNIEEILAAKGEQVQR---------------
DNLZ_MOUSE      QNHHIIADNLSWFSDLKGKNIEEILAARGEEVRR---------------
DNLZ_DANRE      KNHHVIADNLKWFSDLEGKNIEEILAAKGESVRR---------------
ZIM17_YEAST     KVRHLIADHLKIFHDHH-VTVEQLMKANGEQVSQ---------------
ZIM17_YEAS7     KVRHLIADHLKIFHDHH-VTVEQLMKANGEQVSQ---------------
ZIM17_YEAS6     KVRHLIADHLKIFHDHH-VTVEQLMKANGEQVSQ---------------
ZIM17_YEAS1     KVRHLIADHLKIFHDHH-VTVEQLMKANGEQVSQ---------------
YA72_SCHPO      KNRHLMADHLKIFSE-ERVTIEDILAKKGETFKK---------------