[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cele0:AAN63415.1

[Show Plain Result]


## Summary of Sequence Search
    1::400
   17::411     4e-97  47%  415 aa  ALG2_MOUSE RecName: Full=Alpha-1,3-mannosyltransferase ALG2;       
   17::415     1e-94  47%  416 aa  ALG2_HUMAN RecName: Full=Alpha-1,3-mannosyltransferase ALG2;       
    6::420     1e-87  43%  455 aa  ALG2_RHIPU RecName: Full=Alpha-1,3-mannosyltransferase ALG2;       
    8::418     3e-82  42%  420 aa  ALG2_DICDI RecName: Full=Alpha-1,3-mannosyltransferase ALG2;       
   10::432     3e-71  42%  503 aa  ALG2_KLULA RecName: Full=Alpha-1,3-mannosyltransferase ALG2;       
    9::427     3e-70  42%  428 aa  ALG2_CANAL RecName: Full=Alpha-1,3-mannosyltransferase ALG2;       
   17::430     1e-68  40%  511 aa  ALG2_SCHPO RecName: Full=Alpha-1,3-mannosyltransferase alg2;       
   13::435     3e-65  42%  471 aa  ALG2_NEUCR RecName: Full=Alpha-1,3-mannosyltransferase alg-2;      
    9::434     9e-65  39%  503 aa  ALG2_YEAST RecName: Full=Alpha-1,3-mannosyltransferase ALG2;       
   11::438     6e-64  40%  476 aa  ALG2_DEBHA RecName: Full=Alpha-1,3-mannosyltransferase ALG2;       
    1::421     4e-63  43%  460 aa  ALG2_YARLI RecName: Full=Alpha-1,3-mannosyltransferase ALG2;       
    5::436     5e-63  40%  514 aa  ALG2_ASHGO RecName: Full=Alpha-1,3-mannosyltransferase ALG2;       
    7::433     1e-62  39%  458 aa  ALG2_CANGA RecName: Full=Alpha-1,3-mannosyltransferase ALG2;       
  232::465     1e-15  27%  505 aa  ALG11_DICDI RecName: Full=Asparagine-linked glycosylation protein
  228::443     4e-14  29%  486 aa  ALG11_XENLA RecName: Full=Asparagine-linked glycosylation protein
  230::453     1e-13  31%  492 aa  ALG11_MOUSE RecName: Full=Asparagine-linked glycosylation protein
   47::374     2e-12  26%  380 aa  CAPM_STAAU RecName: Full=Capsular polysaccharide biosynthesis
  539::760     3e-12  29%  805 aa  SUS2_SOLTU RecName: Full=Sucrose synthase;       
  232::453     3e-12  29%  492 aa  ALG11_HUMAN RecName: Full=Asparagine-linked glycosylation protein
  232::453     5e-12  29%  492 aa  ALG11_PONAB RecName: Full=Asparagine-linked glycosylation protein
  229::434     1e-11  28%  470 aa  YMP8_CAEEL RecName: Full=Uncharacterized glycosyltransferase
  542::764     1e-11  27%  809 aa  SUS2_PEA RecName: Full=Sucrose synthase 2;       
  225::377     2e-11  32%  407 aa  YTCC_BACSU RecName: Full=Putative glycosyltransferase ytcC;        
  182::444     7e-11  30%  500 aa  ALG11_DANRE RecName: Full=Asparagine-linked glycosylation protein
  538::761     4e-10  27%  820 aa  SUS2_TULGE RecName: Full=Sucrose synthase 2;       
  230::444     6e-10  29%  487 aa  ALG11_XENTR RecName: Full=Asparagine-linked glycosylation protein
  538::760     8e-10  25%  805 aa  SUSY_MEDSA RecName: Full=Sucrose synthase;       
  538::760     2e-09  25%  806 aa  SUSY_VICFA RecName: Full=Sucrose synthase;       
  538::760     3e-09  25%  805 aa  SUSY_SOYBN RecName: Full=Sucrose synthase;       
  515::706     5e-09  27%  766 aa  SUSY_BETVU RecName: Full=Sucrose synthase;       
  535::760     7e-09  25%  805 aa  SUSY_SOLLC RecName: Full=Sucrose synthase;       
  538::760     9e-09  24%  805 aa  SUSY_PHAAU RecName: Full=Sucrose synthase;       
  199::429     9e-09  28%  548 aa  ALG11_YEAST RecName: Full=Alpha-1,2-mannosyltransferase ALG11;     
  535::760     2e-08  25%  805 aa  SUS1_SOLTU RecName: Full=Sucrose synthase;       
  541::762     2e-08  25%  808 aa  SUS1_DAUCA RecName: Full=Sucrose synthase isoform 1;       
  285::369     2e-08  31%  377 aa  YPJH_BACSU RecName: Full=Uncharacterized glycosyltransferase ypjH; 
  536::758     2e-08  26%  805 aa  SUS2_ARATH RecName: Full=Sucrose synthase 2;       
  131::335     3e-08  28%  359 aa  YQGM_BACSU RecName: Full=Uncharacterized glycosyltransferase yqgM; 
  538::759     8e-08  23%  805 aa  SUS1_TULGE RecName: Full=Sucrose synthase 1;       
  496::667     1e-07  27% 1081 aa  SPS2_CRAPL RecName: Full=Sucrose-phosphate synthase 2;       
  267::380     1e-07  32%  942 aa  Y2592_STRCO RecName: Full=Exopolysaccharide phosphotransferase
  540::765     1e-07  24%  816 aa  SUS1_ORYSJ RecName: Full=Sucrose synthase 1;       
  475::646     1e-07  27% 1057 aa  SPS1_CITUN RecName: Full=Sucrose-phosphate synthase 1;       
  502::676     2e-07  26% 1084 aa  SPS_ORYSJ RecName: Full=Probable sucrose-phosphate synthase;       
  502::676     2e-07  26% 1084 aa  SPS_ORYSI RecName: Full=Probable sucrose-phosphate synthase;       
  473::644     2e-07  26% 1053 aa  SPS_SOLTU RecName: Full=Sucrose-phosphate synthase;       
  488::657     2e-07  26% 1068 aa  SPS_MAIZE RecName: Full=Sucrose-phosphate synthase;       
  535::756     3e-07  24%  801 aa  SUS2_DAUCA RecName: Full=Sucrose synthase isoform 2;       
  476::647     3e-07  27% 1059 aa  SPS_VICFA RecName: Full=Sucrose-phosphate synthase;       
  444::645     3e-07  26% 1054 aa  SPS1_CRAPL RecName: Full=Sucrose-phosphate synthase 1;       
  572::762     4e-07  26%  808 aa  SUS1_ARATH RecName: Full=Sucrose synthase 1;       
  481::654     4e-07  25% 1056 aa  SPS_SPIOL RecName: Full=Sucrose-phosphate synthase;       
  536::758     6e-07  25%  803 aa  SUSY_ALNGL RecName: Full=Sucrose synthase;       
  473::644     1e-06  25% 1045 aa  SPS_BETVU RecName: Full=Sucrose-phosphate synthase;       
  310::509     1e-06  26%  635 aa  ALG11_YARLI RecName: Full=Alpha-1,2-mannosyltransferase ALG11;     
   99::331     2e-06  28%  390 aa  Y1607_METJA RecName: Full=Uncharacterized glycosyltransferase
  544::765     2e-06  25%  816 aa  SUS2_MAIZE RecName: Full=Sucrose synthase 2;       
  347::505     2e-06  25%  673 aa  TAGE_BACSU RecName: Full=Probable poly(glycerol-phosphate)
  534::757     2e-06  22%  808 aa  SUS2_ORYSJ RecName: Full=Sucrose synthase 2;       
  544::765     2e-06  22%  816 aa  SUS2_HORVU RecName: Full=Sucrose synthase 2;       
  535::756     2e-06  23%  807 aa  SUS1_HORVU RecName: Full=Sucrose synthase 1;       
  249::338     2e-06  30%  340 aa  LPSE_RHIME RecName: Full=Lipopolysaccharide core biosynthesis
  536::757     5e-06  22%  802 aa  SUS1_MAIZE RecName: Full=Sucrose synthase 1;       
  137::347     5e-06  26%  352 aa  LPCC_RHILV RecName: Full=Lipopolysaccharide core biosynthesis
   95::364     5e-06  26%  456 aa  GPI3_SCHPO RecName: Full=Phosphatidylinositol
  210::350     2e-05  32%  381 aa  EPSD_BACSU RecName: Full=Putative glycosyltransferase epsD;        
  201::373     2e-05  25%  381 aa  WAAK_SALTY RecName: Full=Lipopolysaccharide
  115::299     3e-05  30%  351 aa  Y1178_METJA RecName: Full=Uncharacterized glycosyltransferase
  284::369     3e-05  26%  377 aa  COTSA_BACSU RecName: Full=Spore coat protein SA;       
  119::325     4e-05  24%  358 aa  YC07_KLEPN RecName: Full=Uncharacterized 41.2 kDa protein in cps
  213::332     4e-05  30%  353 aa  Y1698_HAEIN RecName: Full=Uncharacterized glycosyltransferase
  151::286     4e-05  29%  353 aa  RFBU_SALTY RecName: Full=Protein rfbU;         EC=2.4.-.-;
  243::283     4e-05  46%  378 aa  GT378_AFV2 RecName: Full=Putative glycosyltransferase ORF378;      
  242::507     4e-05  26%  570 aa  ALG11_KLULA RecName: Full=Alpha-1,2-mannosyltransferase ALG11;     
  156::439     8e-05  26%  471 aa  ALG11_SCHPO RecName: Full=Alpha-1,2-mannosyltransferase alg11;     
  283::487     8e-05  27%  609 aa  ALG11_CANAL RecName: Full=Alpha-1,2-mannosyltransferase ALG11;     
  678::765     1e-04  24%  816 aa  SUS3_ORYSJ RecName: Full=Sucrose synthase 3;       
  232::326     1e-04  31%  345 aa  GL1D1_XENTR RecName: Full=Glycosyltransferase 1 domain-containing
  217::296     2e-04  38%  351 aa  LPSB_RHIME RecName: Full=Lipopolysaccharide core biosynthesis
  128::307     3e-04  25%  406 aa  Y1059_METJA RecName: Full=Uncharacterized glycosyltransferase
  185::310     4e-04  35%  378 aa  PIMA_MYCTU RecName: Full=Phosphatidylinositol
  199::311     4e-04  37%  374 aa  PIMA_MYCLE RecName: Full=Phosphatidylinositol
  185::310     4e-04  35%  378 aa  PIMA_MYCBO RecName: Full=Phosphatidylinositol
  227::405     7e-04  24%  406 aa  WCAL_SALTY RecName: Full=Putative colanic acid biosynthesis
    1::400

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xVRVTILHPDLGIGGAERLIVDAAVGLQDRGHSVRIFTNQYSRSHCFQETLDLDICTVVPWIPRSIFGKG
ALG2_MOUSE      ---VLFLHPDMGIGGAERLVLDAALALQEYGCDVKIWTAHYDPNHCFIETRELSVQCAGDWLPRSLGGRG
ALG2_HUMAN      ---VLFLHPDLGVGGAERLVLDAALALQARGCSVKIWTAHYDPGHCFAESRELPVAXXXXXXXXXXXXXX
ALG2_RHIPU      -LNVAFIHPDLGIGGAERLVVDAAVGIQKKGHQVIFYTSHHDPNHCFEETRDLKVQVRGDWLPRTIFGRF
ALG2_DICDI      -LNIAILHPDLGIGGAERLIVDLALGLKSVGNNITMYTSRHDPKRCFKETSELDVHVTGGYFPRHIFNRF
ALG2_KLULA      --KVAFIHPDLGIGGAERLVVDAAAGLQNAGYDVTIYTSHCDKSHCFEEVKNGTLKVEVRGLPTHIFGKF
ALG2_CANAL      --KIAFIHPDLGIGGAERLVVDAAVGLQDFGHDIIIYTSHCDLTHCFEEVSSLKVSVHGDSLPTNLFGKL
ALG2_SCHPO      -IKIAFIHPDLGIGGAERLVVDAAVGLQSLGKEVVVFTSHCDKKHCFEEIRDGTIKVKVDWLPSSIFGRL
ALG2_NEUCR      ---IVFLHPDLGIGGAERLVVDAAVGLQNRGHKVVIFTSHCDPRHCFDEARDGTLDVRVRGIPPSLLGRF
ALG2_YEAST      ---IAFIHPDLGIGGAERLVVDAALGLQQQGHSVIIYTSHCDKSHCFEEVKNLKVEVYGDFLPTNFLGRF
ALG2_DEBHA      --KIAFVHPDLGIGGAERLVVDAAVGLQELENEVTIYTSHCDKKHCFEEVSSLDVEVYGDFFPTNVLKRF
ALG2_YARLI      -MRVAFIHPDLGIGGAERWVVDAAVGLQNLGHEVDIYTSYCNKSHCFDEVRDLKVTVLGDTIPHTIKGKF
ALG2_ASHGO      -LNIALIHPDLGIGGAERLVVDAAIGLQDQGHRVTIYTSHCDKNHCFEEIKDLKVVVVGDFLPTNILGKF
ALG2_CANGA      -LKIAFVHPDLGIGGAERLVVDAALGLQEAGHEVIIYTSHCDKTHCFEEVKNLKVEVFGDFLPTDLGKRF
ALG11_DICDI     ----------------------------------------------------------------------
ALG11_XENLA     ----------------------------------------------------------------------
ALG11_MOUSE     ----------------------------------------------------------------------
CAPM_STAAU      ---------------------------------------------------DNEIAHVIP-MKRDI----
SUS2_SOLTU      ----------------------------------------------------------------------
ALG11_HUMAN     ----------------------------------------------------------------------
ALG11_PONAB     ----------------------------------------------------------------------
YMP8_CAEEL      ----------------------------------------------------------------------
SUS2_PEA        ----------------------------------------------------------------------
YTCC_BACSU      ----------------------------------------------------------------------
ALG11_DANRE     ----------------------------------------------------------------------
SUS2_TULGE      ----------------------------------------------------------------------
ALG11_XENTR     ----------------------------------------------------------------------
SUSY_MEDSA      ----------------------------------------------------------------------
SUSY_VICFA      ----------------------------------------------------------------------
SUSY_SOYBN      ----------------------------------------------------------------------
SUSY_BETVU      ----------------------------------------------------------------------
SUSY_SOLLC      ----------------------------------------------------------------------
SUSY_PHAAU      ----------------------------------------------------------------------
ALG11_YEAST     ----------------------------------------------------------------------
SUS1_SOLTU      ----------------------------------------------------------------------
SUS1_DAUCA      ----------------------------------------------------------------------
YPJH_BACSU      ----------------------------------------------------------------------
SUS2_ARATH      ----------------------------------------------------------------------
YQGM_BACSU      ----------------------------------------------------------------------
SUS1_TULGE      ----------------------------------------------------------------------
SPS2_CRAPL      ----------------------------------------------------------------------
Y2592_STRCO     ----------------------------------------------------------------------
SUS1_ORYSJ      ----------------------------------------------------------------------
SPS1_CITUN      ----------------------------------------------------------------------
SPS_ORYSJ       ----------------------------------------------------------------------
SPS_ORYSI       ----------------------------------------------------------------------
SPS_SOLTU       ----------------------------------------------------------------------
SPS_MAIZE       ----------------------------------------------------------------------
SUS2_DAUCA      ----------------------------------------------------------------------
SPS_VICFA       ----------------------------------------------------------------------
SPS1_CRAPL      ----------------------------------------------------------------------
SUS1_ARATH      ----------------------------------------------------------------------
SPS_SPIOL       ----------------------------------------------------------------------
SUSY_ALNGL      ----------------------------------------------------------------------
SPS_BETVU       ----------------------------------------------------------------------
ALG11_YARLI     ----------------------------------------------------------------------
Y1607_METJA     ----------------------------------------------------------------------
SUS2_MAIZE      ----------------------------------------------------------------------
TAGE_BACSU      ----------------------------------------------------------------------
SUS2_ORYSJ      ----------------------------------------------------------------------
SUS2_HORVU      ----------------------------------------------------------------------
SUS1_HORVU      ----------------------------------------------------------------------
LPSE_RHIME      ----------------------------------------------------------------------
SUS1_MAIZE      ----------------------------------------------------------------------
LPCC_RHILV      ----------------------------------------------------------------------
GPI3_SCHPO      ----------------------------------------------------------------------
EPSD_BACSU      ----------------------------------------------------------------------
WAAK_SALTY      ----------------------------------------------------------------------
Y1178_METJA     ----------------------------------------------------------------------
COTSA_BACSU     ----------------------------------------------------------------------
YC07_KLEPN      ----------------------------------------------------------------------
Y1698_HAEIN     ----------------------------------------------------------------------
RFBU_SALTY      ----------------------------------------------------------------------
GT378_AFV2      ----------------------------------------------------------------------
ALG11_KLULA     ----------------------------------------------------------------------
ALG11_SCHPO     ----------------------------------------------------------------------
ALG11_CANAL     ----------------------------------------------------------------------
SUS3_ORYSJ      ----------------------------------------------------------------------
GL1D1_XENTR     ----------------------------------------------------------------------
LPSB_RHIME      ----------------------------------------------------------------------
Y1059_METJA     ----------------------------------------------------------------------
PIMA_MYCTU      ----------------------------------------------------------------------
PIMA_MYCLE      ----------------------------------------------------------------------
PIMA_MYCBO      ----------------------------------------------------------------------
WCAL_SALTY      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           HALCAYLKMIIAALYIVIYHKDTDVILSDSVSASQFVLRHFSKAKLVFYCHFPDRLLTKRDGNLKAFYRN
ALG2_MOUSE      AAICSYVRMVFLALYVLFLSEEFDVVVCDQVSACIPVFKLARRRKRVFYCHFPDLLLTQRNSALKKFYRA
ALG2_HUMAN      AAVCAYVRMVFLALYVLLADEEFDVVVCDQVSACIPVFRLARRRKILFYCHFPDLLLTKRDSFLKRLYRA
ALG2_RHIPU      YILCAILRQFVLVASLILWERHSDIFFVDQLSACVPLLKWFTTAKILFYCHFPDKLLTQRNSTIKKLYRA
ALG2_DICDI      MVICAIIRNLLAALYIIFFSQKYDVIVLDQISASIPLFKLFTNSKVLFYCHFPDKLLTSRTSLIKRLYRI
ALG2_KLULA      SILCANLRQLYLTWNLISTGKEYDVYIVDQLSSCVPLLHNAPDSKVLFYCHFPDQLLARRDGLLKKLYRI
ALG2_CANAL      HIFFAILRQFYLVCWLIFTGKNYDYFIVDQLSFCIPLLKMFSNCQVLFYCHFPDQLLVRRTSFLKKLYRV
ALG2_SCHPO      SIFCSSLRQVYLTMILLTNYMHFDAIIVDQLSTCPFLL--LASQMILFYCHFPDKYLAKRGGILKKLYRI
ALG2_NEUCR      SILCAXXXXXXXXXXXXXXXSELRTLFVDQLSAGLPLLKLLPTSPIFFYCHFPDLLLVQRQTWYKRLYRL
ALG2_YEAST      FIVFATIRQLYLVIQLILQKKVNQLIIIDQLSTCIPLLHIFSSATLMFYCHFPDQLLAQRAGLLKKIYRL
ALG2_DEBHA      HILFAIIRQLVLALIFTGKIKQYDYFIVDQLSFCIPLLCCFSRCKILFYCHFPDQLLALKGGFLKRFYRM
ALG2_YARLI      AIFCATFRQLHLAYELKKPGSKVDVFVVDQLSACVPLLKWFPKARVLFYGHFPDQLLVQNRNQMKKAYRY
ALG2_ASHGO      FILCANLRQLALVFKLVINGSKHDLFIVDQLSTCVPLLHLFSASRVLFYCHFPDQLLAQRKSLVSKLYRV
ALG2_CANGA      FIVFANLRQLYLTAKVVLRSKDKDVFIIDQLSTCVPFFK-LANNKVLFYCHFPDQLLAIRTNWIKSLYRI
ALG11_DICDI     ----------------------------------------------------------------KLIYYN
ALG11_XENLA     ---------------------------------------------------------------LKLIYYY
ALG11_MOUSE     -----------------------------------------SKAKLIYYYLF-------------AFVYG
CAPM_STAAU      -ALFSDLKSLLKM--ILLFHKEKPFIVNSGTPKAGLI-----GTIAAFITQRPIRIYTVRGLRLKGFKYF
SUS2_SOLTU      ----------------------------------------------------------------------
ALG11_HUMAN     ---------------------------------------------------------------VKLIYYY
ALG11_PONAB     ---------------------------------------------------------------VKLIYYY
YMP8_CAEEL      ----------------------------------------------------------------------
SUS2_PEA        ----------------------------------------------------------------------
YTCC_BACSU      ----------------------------------------------------------------------
ALG11_DANRE     ------------------------------------VFRYLGGCQVGSYVHYPDMLSVVRERNIKVIYYC
SUS2_TULGE      ----------------------------------------------------------------------
ALG11_XENTR     ---------------------------------------------------------------LKLIYYY
SUSY_MEDSA      ----------------------------------------------------------------------
SUSY_VICFA      ----------------------------------------------------------------------
SUSY_SOYBN      ----------------------------------------------------------------------
SUSY_BETVU      ----------------------------------------------------------------------
SUSY_SOLLC      ----------------------------------------------------------------------
SUSY_PHAAU      ----------------------------------------------------------------------
ALG11_YEAST     ------------------------------------IARFLRRIPIVTYTHYPNKLFKMPKKGIKV-YGK
SUS1_SOLTU      ----------------------------------------------------------------------
SUS1_DAUCA      ----------------------------------------------------------------------
YPJH_BACSU      ----------------------------------------------------------------------
SUS2_ARATH      ----------------------------------------------------------------------
YQGM_BACSU      ----------------------------------------------------------------------
SUS1_TULGE      ----------------------------------------------------------------------
SPS2_CRAPL      ----------------------------------------------------------------------
Y2592_STRCO     ----------------------------------------------------------------------
SUS1_ORYSJ      ----------------------------------------------------------------------
SPS1_CITUN      ----------------------------------------------------------------------
SPS_ORYSJ       ----------------------------------------------------------------------
SPS_ORYSI       ----------------------------------------------------------------------
SPS_SOLTU       ----------------------------------------------------------------------
SPS_MAIZE       ----------------------------------------------------------------------
SUS2_DAUCA      ----------------------------------------------------------------------
SPS_VICFA       ----------------------------------------------------------------------
SPS1_CRAPL      ----------------------------------------------------------------------
SUS1_ARATH      ----------------------------------------------------------------------
SPS_SPIOL       ----------------------------------------------------------------------
SUSY_ALNGL      ----------------------------------------------------------------------
SPS_BETVU       ----------------------------------------------------------------------
ALG11_YARLI     ----------------------------------------------------------------KLVYWR
Y1607_METJA     -------------------------------------MTHFVGANLKHICRMPHSTEIGRCGGLYSDDSK
SUS2_MAIZE      ----------------------------------------------------------------------
TAGE_BACSU      ----------------------------------------------------------------------
SUS2_ORYSJ      ----------------------------------------------------------------------
SUS2_HORVU      ----------------------------------------------------------------------
SUS1_HORVU      ----------------------------------------------------------------------
LPSE_RHIME      ----------------------------------------------------------------------
SUS1_MAIZE      ----------------------------------------------------------------------
LPCC_RHILV      ----------------------------------------------------------------------
GPI3_SCHPO      ---------------------------------------------LSFLCH--DAILHARTMGLKTCFTD
EPSD_BACSU      ----------------------------------------------------------------------
WAAK_SALTY      ----------------------------------------------------------------------
Y1178_METJA     --------------------------------------------------HGSDALILKNSIKGRYFFKY
COTSA_BACSU     ----------------------------------------------------------------------
YC07_KLEPN      ----------------------------------------------------------------KKWKKK
Y1698_HAEIN     ----------------------------------------------------------------------
RFBU_SALTY      ----------------------------------------------------------------------
GT378_AFV2      ----------------------------------------------------------------------
ALG11_KLULA     ----------------------------------------FARIPIVTYTHYPQKLKTMPGFHTKYVYWK
ALG11_SCHPO     -----------------IYRFAPDIFIDTMGYAFTFVVKSFQNIPVGAYVHYPDMLKSLKQVSLLAKVKM
ALG11_CANAL     ----------------------------------------------------------------KFIYWS
SUS3_ORYSJ      ----------------------------------------------------------------------
GL1D1_XENTR     ----------------------------------------------------------------------
LPSB_RHIME      ----------------------------------------------------------------------
Y1059_METJA     ----------------------------------------------------------------EGLYSK
PIMA_MYCTU      ----------------------------------------------------------------------
PIMA_MYCLE      ----------------------------------------------------------------------
PIMA_MYCBO      ----------------------------------------------------------------------
WCAL_SALTY      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IIDWIEEYTTGLADVICVNSNFTKNVVRETFKSLASQELTVLYPSLNTEFFDSIEASDDFGEEIPRGTKY
ALG2_MOUSE      PIDWIEEYTTGMADRILVNSQYTASVFKETFKTLSHRNPDVLYPSLNIGSFD-LAIPEKIDDLVPKGKQF
ALG2_HUMAN      PIDWIEEYTTGMADCILVNSQFTAAVFKETFKSLSHIDPDVLYPSLNVTSFDSVEKLDDL---VPKGKKF
ALG2_RHIPU      PVDKMEELTTGMSDLIAVNSGFTAGMFKKSFPSV-HQTPQILYPPINFDAYDRPVDRNDPTVKILETDKR
ALG2_DICDI      PIDLFEEFTTGCADQVLVNSNFTSSIYKQSFKHLKNSP-SVLYPIINTNEFDKTKQSHNFSNQIKLDDKK
ALG2_KLULA      PFDILEQFTMGVADTILVNSNFTKQVFAKTFQSLA-VDPKVVYPCVNVEQEEILPLDKDLMKKILKNNEK
ALG2_CANAL      PFDAIEEYTTGSSDQIVVNSNFTKQIFHDTFKKLNHIDPQVVYPCVDTETI--VDTNTSSNSEVSKFFKP
ALG2_SCHPO      PFDTVEAESVRLADRIVVNSKFTASVFKKAFPKI-RKPLRIVHPCVDIE-----AASKPLEFQLPEKILY
ALG2_NEUCR      PFDTWEEWSMGFADSIAVNSSFTKGIVSHTWPSLASKRLEVVHPCIDVRSTSSQNPNDDDKDVLPWTKTG
ALG2_YEAST      PFDLIEQFSVSAADTVVVNSNFTKNTFHQTFKYL-SNDPDVIYPCVDLSTIEIEDIDKKFFKTVFNEGDR
ALG2_DEBHA      PFDLIEEWTTGISDQIVVNSKFTKGIFHKTFKGLKNIEPGVIYPCVDLNSATDTEEDKLMDEEVNKGGKF
ALG2_YARLI      PFDKFEEITTASADRLVVNSHFTKDMFEKTFP--ATKNPLVIYPCVDTDIKEQQQGLD--RDMITAASQY
ALG2_ASHGO      PFDLLEQLTMGCSDSVVVNSYFTRSVFFDTFKILRLNP-RVVYPCVAMDELPIEKIDIGFYDQIIGPNNR
ALG2_CANGA      PFDLLEQFTMYCSDEVVVNSNFTKSMYKKTFKYL-QKNPNVIYPCVDTDTETLINDRDQIGNLLVGKCPN
ALG11_DICDI     IFSKIYQIVGSFSKLVMVNGTWTGNHIRDIWKKQFGYDLFIVYPPVDVKGRKQLKLGWMDGTR-----KN
ALG11_XENLA     LFALFYGWVGSCSDVIMVNSTWTFSHILDLWK--CSDRTSIVYPPCDVQTFLEIDINQHKENE-----EH
ALG11_MOUSE     LVG-------SCSDIVMVNSSWTLNHILSLWK--VGHCTNIVYPPCDVQTFLDIPLHE---KKVTPG--H
CAPM_STAAU      VLYLMEKIAMFCADIIAISESLKHKII--TSNLAKENKITVLFGSSNGIQFEKFQLDNNKLEEKYHNDNF
SUS2_SOLTU      ------------------------------------KRLTTFHPEIEDLLFSDVENEEHLCVLKDRNKPI
ALG11_HUMAN     LFAFIYGLVGSCSDVVMVNSSWTLNHILSLWK--VGNCTNIVYPPCDVQTFLDIPLHE---KKMTPG--H
ALG11_PONAB     LFAFIYGLVGSCSDVVMVNSSWTLNHILSLWK--VGNCTNIVYPPCDVQTFLDIPLHE---KKMTPG--H
YMP8_CAEEL      ------------AHVGMVNGSWTQRHITSIW---SRRDVSIVYPPCDVEAFLNIES---VAESLLEDTKT
SUS2_PEA        ------------------------------------KRLTALHSSIEKLLYGT-EQTDEYIGSLTDRSKP
YTCC_BACSU      ----------------------------------------------------------------------
ALG11_DANRE     VFALLYGLAGSCSDVIMVNSTWTLGHILALWRT--PNRTSVVYPPCDVQAFLDVPIGED-NEEKEQKKCH
SUS2_TULGE      ----------------------------------AEKRLTALHPEIEELLYSSAESTEKFG--LKDKTKP
ALG11_XENTR     LFAVIYGWVGSCSDVIMVNSTWTFAHILDLWK--CSERTSIVYPPCDVQTFLDINLNQHKDIE-----EH
SUSY_MEDSA      -----------------------------------SRRLTSFYPEIEELLYSSVENEEHICVLKDRNKPI
SUSY_VICFA      -----------------------------------SRRLTSFYPEIEELLYSTVENEEHICVLKDRSKPI
SUSY_SOYBN      -----------------------------------SRRLTSFHPEIEELLYSSVENEEHICVLKDRSKPI
SUSY_BETVU      -------------------------------------------------------------------SKP
SUSY_SOLLC      --------------------------------SESEKRLTAFHPEIDELLYSDVE-NDEHLCVLKDRTKP
SUSY_PHAAU      -----------------------------------SRRLTSFHTEIEELLYSSVENEEHICVLKDRSKPI
ALG11_YEAST     ILYWIYQSIGSKIDIVITNSTWTNNHIKQIWQSNTCK---IIYPPCSTEKL--VDWKQKFGTAKGERLNQ
SUS1_SOLTU      --------------------------------SETEKRLTAFHPEIDELLYSDVE-NDEHLCVLKDRTKP
SUS1_DAUCA      ------------------------------------KRLTTLHPEIEELLYSSVENEEHLCIIKDKNKPI
YPJH_BACSU      ----------------------------------------------------------------------
SUS2_ARATH      ------------------------------------RRLTALHESIEELLF-SAEQNDEHVGLLSDQSKP
YQGM_BACSU      ------------ADALIVLSTFMKR----SLDKAAHKKITVI---------PSPASMEEEKGKIPRSMNR
SUS1_TULGE      ------------------------------------KRLTALHAEIEELLYSSVE-NEEHKFVLKDRNKP
SPS2_CRAPL      --------------------------------------------------------------------KP
Y2592_STRCO     ----------------------------------------------------------------------
SUS1_ORYSJ      --------------------------------SESRKRLTSLHPEIEELLYSEVDNNEHKFMLKDRNKPI
SPS1_CITUN      --------------------------------------------------------------------KP
SPS_ORYSJ       --------------------------------------------------------------------KP
SPS_ORYSI       --------------------------------------------------------------------KP
SPS_SOLTU       --------------------------------------------------------------------KP
SPS_MAIZE       --------------------------------------------------------------------KP
SUS2_DAUCA      ------------------------------------RRLTALHPEIEDLLFSSVENKEHICVLKDRYKPI
SPS_VICFA       --------------------------------------------------------------------KP
SPS1_CRAPL      -----------------------------------------------------LDAEPEFNEDSKSPDPH
SUS1_ARATH      --------------------------------------------------------------------KP
SPS_SPIOL       ------------------------------------------------------------------GRKP
SUSY_ALNGL      ------------------------------------KRLTSFHPEIEELLYSPVENEEHLCVLKDRNKPI
SPS_BETVU       --------------------------------------------------------------------KP
ALG11_YARLI     VFALTYTFAGSYCSVVMTNSSWTNNHMQHMWYNHKAEHIKIVYPPCGTQALSEIAMSE---ETSARSPNI
Y1607_METJA     AIHAMEYLSTYESCQVITVSKSLKEEVCSIFNT-PEDKVKVIYNGINPWEFDSWEEKINFRRSIGQDDEK
SUS2_MAIZE      ------------------------------------KRLTSLHPEIEELLYSQTENTEHKFVLNDRNKPI
TAGE_BACSU      --------------------------------------------------------------------KY
SUS2_ORYSJ      ----------------------------------ADKRLTAFHPEIEELLYSEVE-NDEHKFVLKDKNKP
SUS2_HORVU      ------------------------------------KRLTSLHTEIEELLFSDVENAEH-KFVLKDKKKP
SUS1_HORVU      ------------------------------------KRLTAFHSEIEELLYSDVE-NDEHKFVLKDRNKP
LPSE_RHIME      ----------------------------------------------------------------------
SUS1_MAIZE      ------------------------------------KRLTAFHPEIEELIYSDVENSEH-KFVLKDKKKP
LPCC_RHILV      ---------------------------------------TVIQHGVDLALFHPPEAAEDGIAATGLPGRH
GPI3_SCHPO      VTNKLLKFTSDVNHVICVSHTCRENTVLRAV--LNPKRVSVIPNALVAENFDPSKASKDF---------L
EPSD_BACSU      ----------------------------------------------------------------------
WAAK_SALTY      ----------------------------------------------------------------------
Y1178_METJA     A-------TTNSDKIICV-SKYIKNQLDENLKNRA----IVIYNGVNKEILYN-EGDYNFG---------
COTSA_BACSU     ----------------------------------------------------------------------
YC07_KLEPN      VYIYIERILAKQTDCIIANSYYEYKCAVDA--GISKNKIKVVYNAVSLDGQEKLERIKKCNENEVQKEKI
Y1698_HAEIN     ----------------------------------------------------------------------
RFBU_SALTY      -----------------------KDSIAKTY-NVDSEKISVIYNSVNKS--DFIQKKEKENYFLAVGASW
GT378_AFV2      ----------------------------------------------------------------------
ALG11_KLULA     IFMLAYKFSGLFVEIASTNSTWTYNHIKSIWSS--TKNIHIIYPPCSTE---SLIEGCDKSDPVKRLNQA
ALG11_SCHPO     AYRWFAQLYSDAADYVMTNSSWTRNHIASLWGK--DIQLSVVFPPCNTSELEKID--------INRKREP
ALG11_CANAL     ILYYFYVYLGSKVNIALANGSWTFNHLSKVFNTALGNVLDVLYPPCGTEFLIKQANLNQ-----PRSNKL
SUS3_ORYSJ      ----------------------------------------------------------------------
GL1D1_XENTR     ----------------------------------------------------------------------
LPSB_RHIME      ----------------------------------------------------------------------
Y1059_METJA     IIILAYKYFYKYADIIIVQTQENKKIIESHFKSLKNK--TKIVPNV-YEIDKLQQLSNEPLEKQYRNDSF
PIMA_MYCTU      ----------------------------------------------------------------PRQGKT
PIMA_MYCLE      ----------------------------------------------------------------------
PIMA_MYCBO      ----------------------------------------------------------------PRQGKT
WCAL_SALTY      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VFTSLNRFERKKNIVLALDAFEKLKSNLPADEFSQCHLVIAGGYDLKNPENIEHYDELVEHMKKLELPAD
ALG2_MOUSE      LFLSINRYERKKNLPLALRSLVQLRNRLPSQEWDKVHLFMAGGYDDRIPENVEHYKELKKMVQESDLER-
ALG2_HUMAN      LLLSINRYERKKNLTLALEALVQLRGRLTSQDWERVHLIVAGGYDERVLENVEHYQELKKMVQQSDL-GQ
ALG2_RHIPU      VLLSINRFERKKNVELALRAFAKIKNMVPKDVFANYRLVLAGGYDKRVRENVEYLEELDQATEEFGLQTF
ALG2_DICDI      FFLSINRYERKKDLKLALDAFSVFXXXXXXXXXDEIYLVFAGGYDTGLKENVEHLQELKDKAKEYGLE-N
ALG2_KLULA      YYLSINRYERKKNIELAITAFAQSKQR------TSHKLFISGGYDLNNSENIDYYSKSPDKCPSSNFADA
ALG2_CANAL      FFLSINRFERSKNIELAIKSFARMNKLMVTNK--KPRLVIAGGYDSRVAENVEYLAELSTLCDELNLPSV
ALG2_SCHPO      LLISVNRFERKKDIRLAIDAFSALR-DLSANRFPEYLLLVAGGYDIRVSENRRYLKELQEFCEQKDLPST
ALG2_NEUCR      IILSINRFERKKDIALAIKAF----ASLSPEQRGKAKLIIAGGYDNRVHENVSYHMDLVDHLKTATAPDV
ALG2_YEAST      FYLSINRFEKKKDVALAIKAFA-----LSEDQINNVKLVICGGYDERVAENVEYLKELVSDLESFKTNNS
ALG2_DEBHA      -FLSVNRFERKKNIGLAIQSFAKFKAQLPEDNRIKPRLVVAGGFDPRVLENVEYLQELNGLSESLNLPAT
ALG2_YARLI      TFLSINRFERKKNILLAIEAFQKKSSNL--------KLAVAGGYDFRVNENVEYLQELILACEKLKLPAN
ALG2_ASHGO      YYLSINRFERKKDIALALNAFKASKEGHSSDT----KLIICGGYDSRVAENVEYLSELQLICEKANIAHV
ALG2_CANGA      FYLSINRYERKKNIELAIQAFAKA-------SVENTNLVVCGGYDPRIHENVQYLQELTCLCKELDLSGA
ALG11_DICDI     MILSIAQFRPEKNHQLQLRTLAHLLEKYPSEQPLNTKLVLVGG--VRDQADRDRVEQLRNLSKELNIE-D
ALG11_XENLA     SVVSIGQFRPEKDHPLQIRAFAALLEKKTAEQRAKLKLILIGG--CRNDEDELRVSELKKLSSELGIPVE
ALG11_MOUSE     LLVSIGQFRPEKNHALQIKAFAKLLNEKAAELGHSLKLVLIGGCRNKDDERVNQLRSLSENLGVQE----
CAPM_STAAU      VIGYVGRIVKDKGIHELIQSFKIIVS-----KGYNVKLLVIGSLETENSIDESDYLFLTQN--------P
SUS2_SOLTU      IFT-MARLDRVKNLTGLVEWYAK---NPRLREL--VNLVVVGGDRRKESKDLEEQAE----MKKMY----
ALG11_HUMAN     LLVSVGQFRPEKNHPLQIRAFAKLLNKKMVESPPSLKLVLIGGCRNKDDERVNQLRRLSEDLGVQEYVEF
ALG11_PONAB     LLVSVGQFRPEKNHPLQIRAFAKLLNKKMVESPPSLKLVFIGGCRNKDDERVNQLRRLSEDLGVQEYVEF
YMP8_CAEEL      VLLSVGQIRPEKNHKLQLEVLHDVKEPLEKMGYN-VELCIAGG--CRNEEDQERVKMLKNEAEKLDISEQ
SUS2_PEA        IIFSMARLDRVKNITGLVESYAK---NSKLRELVNL-VVVAGYIDVKKSEEIEEIEKMHDLMKQYNLNGE
YTCC_BACSU      -------------------------------------LVIAGGKWFSDDSE----NQYVTYLRTLALPRD
ALG11_DANRE     SLVSVGQFRPEKDHQLQIRAFKKLLDRKEAEPAGRVKLVLIGG--CRNQEDEDRVLMLRGLCQELGI-AD
SUS2_TULGE      IIFSMARLDRVKNMTGLVELYAK------NDRLKELNLVVVCGDHAKASKDLEEQAEL---KKMYSLIEE
ALG11_XENTR     SIVSIGQFRPEKDHPLQICAFAAXXXXXXXXXXXXXXXXXGG---CRNNEDELRVSELKKLSSELGIPVE
SUSY_MEDSA      IFT-MARLDRVKNITGLVEWYGK---NAKLREL--VNLVVVAGDRRKESKDLEEIAEMKKMYGLIETYKL
SUSY_VICFA      IFT-MARLDRVKNITGLVEWYGK---NAKLREL--VNLVVVAGDRRKESKDLEEKAEMKKMYELIETYKL
SUSY_SOYBN      IFT-MARLDRVKNITGLVEWYGK---NAKLREL--VNLVVVAGDRRKESKDLEEKAEMKKMYGLIETYKL
SUSY_BETVU      IIFSMARLDRVKNITGLVECYGK---NAKLRELANL-VVVAGYNDVKKSNDREEIAEIEKMHRLIQEYNL
SUSY_SOLLC      ILFTMARLDRVKNLTGLVEWYAK-----NPXXXXXXXXXXXXXXXXKESKDLEEQAE----MKKMY----
SUSY_PHAAU      IFT-MARLDRVKNITGLVEWYGK---NAKLREL--VNLVVVAGDRRKESKDLEEKAEMKKMYSLIETYKL
ALG11_YEAST     AIV-LAQFRPEKRHKLIIESFATFLKNLP-DSVSPIKLIMAGSTRSKQDENVKSLQDWSENV--LKIPKH
SUS1_SOLTU      ILFTMARLDRVKNLTGLVEWYAK-----NPXXXXXXXXXXXXXXXXKESKDLEEQAE----MKKMY----
SUS1_DAUCA      LFT-MARLDNVKNLTGFVEWYAKSPKLREL-----VNLVVVGGDRRKESKDLE---EQAQMKKMYELIDT
YPJH_BACSU      ----------------------------------------------------------------------
SUS2_ARATH      IIFSMARLDRVKNLTGLVECYAK---NSKLRELA--NLVIVGGYIDENQSRDR--EEMAEIQKMHSLIEQ
YQGM_BACSU      RFLSYGRFVPEKGLSQLLKVFAILKQRQP-----DLYLVLAG-----EGPSLSCYEKLAAAYNL----KD
SUS1_TULGE      IIFSMARLDRVKNMTGLVELYGK------NDRLKELNLVVVAGDHGKESKDLEEQAELKKMYKLIE---E
SPS2_CRAPL      MILALSRPDPKKNITTLVKAFGECR---PLRELANLTLIMGNRDDIDEMSNASVLTTVLKLIDRYDLYG-
Y2592_STRCO     ----------------------------------------------------------------------
SUS1_ORYSJ      IF-SMARLDRVKNLTGLVELYGR---NPRLQEL--VNLVVVCG-DHGNPSKDK--EEQAEFKKMFDLIEQ
SPS1_CITUN      VILALARPDPKKNITTLVKAFGECR---PLRELANLTLIMGNGIDEMXXXXXXXXXXXXXXIDKYDLYG-
SPS_ORYSJ       MILALSRPDPKKNITTLVKAFGECR---PLRELANLILIMGNRDDIDEMSNASVLTTVLKLIDKYDLYGS
SPS_ORYSI       MILALSRPDPKKNITTLVKAFGECR---PLRELANLILIMGNRDDIDEMSNASVLTTVLKLIDKYDLYGS
SPS_SOLTU       MILALARPDPKKNLTTLVKAFGECR---PLRDLANLTLIMGNNIDEMSSTNSALLLSILKMIDKYDLYG-
SPS_MAIZE       MILALSRPDPKKNITTLVKAFGECR---PLRELANLTLIMGNRDDIDDMSNASVLTTVLKLIDKYDLYGS
SUS2_DAUCA      LFT-MARLDNVKNLTGIVEWYAK---NPKLREL--VNLVVVGGDRRKESKDLEEQAQMKKMYGLIDTYKL
SPS_VICFA       VILALARPDPKKNITTLVKAFGECR---PLRELANLTLIMGNGIDEMXXXXXXXXXXXXXXIDKYDLYG-
SPS1_CRAPL      IWTEIMRFDPKKNLTTLVKAFGECK---PLRELANLTLIMGNNIDEMSGTNASVLLSILKMIDKYDLYG-
SUS1_ARATH      ILFTMARLDRVKNLSGLVEWYGK---NTRLRELA--NLVVVGGDRRKESKDNE---EKAEMKKMYDLIEE
SPS_SPIOL       MILALARPDPKKNLTTLVKAFGECR---PLRELANLTLIIGNRDDIDEXXXXXXXXXXXXXXDKYDLYG-
SUSY_ALNGL      IFT-MARLDRVKNITGLVEWYGK---NTRLRELVNL-VVVAGNLEKESKDNEEKAEMTKMHIETYKLNG-
SPS_BETVU       MILALARPDPKKNITTLVKAFGECR---PLRELANLTLIMGNGIDEMXXXXXXXXXXXXXXIDQYDLYG-
ALG11_YARLI     VYIAQFRPEKRHDIVLRYKEYTEKYPNQPAP-----HLTFVG--TVRNDDDKSRVYLLRLQARDLVNPDS
Y1607_METJA     MILFVGRLTYQKGIEYLIRAMPKIL------ERHNAKLVIAGSGDMRDYLEDLCYQLGVRH---------
SUS2_MAIZE      IF-SMARLDRVKNLTGLVELYGR---NKRLQEL--VNLVVVCG-DHGNPSKDK--EEQAEFKKMFDLIEQ
TAGE_BACSU      KAVIISRLASMKNLIHAVKAFSLVVKEIPEAKLD----IFGSGEDFXXXXXXXXDTKLQNN---------
SUS2_ORYSJ      IIFSMARLDRVKNMTGLVEMYGK---NAHLRDLANL-VIVCGDHGNQSKDR----EEQAEFKKMYGLIDQ
SUS2_HORVU      IIFSMARLDRVKNMTGLVEMYGR---NPRLQELVNL-VVVCGDHGKVSKDK----EEQVEFKKMFDLIEK
SUS1_HORVU      IIFSMARLDRVKNMTGLVEMYGK-----NAHLKDLANLVIVAGDHGKESKDRE---EQAEFKRMYSLIEE
LPSE_RHIME      ----------------------------------------------------------------------
SUS1_MAIZE      IIFSMARLDRVKNMTGLVEMYGK---NARLRELANL-VIVAGDHGKESKDR----EEQAEFKKMYSLIDE
LPCC_RHILV      LVGCFGRVRHQKGTDLFVRAMIEL---LP--QHTEWTAVVSGRV---TAEHVAFADKLKADVVAAGL-SD
GPI3_SCHPO      TIVVISRLYYNKGIDLLIAVIPRICAQHPKVRF-----VIAGD----GPKSID-----LEQMREKYMLQD
EPSD_BACSU      -----------KNQKQLIEAAALLKEKIPS-----LRLVFAGEGAMEHT-----YQTLAE---KLGASA-
WAAK_SALTY      ------RISPDKGILLLLQAFKQLRTLR-----SNIKLVVVGDYASRKGEKAEYQKKVLDAAKEI---GT
Y1178_METJA     --LFVGAFVPQKGVDILIDAIKDIDFNFK---------LIGDGKLYKKIENFVVKNNL-----------S
COTSA_BACSU     ----------------------------------------------------------------------
YC07_KLEPN      NILFVGRFDKQKG-------YDYLLNVIKVADVSKYTFNIIG-------------DSVHDVFEKIE---K
Y1698_HAEIN     -------------------------------------------WNLKIVGSGEEEENLKNLAKALDIE-D
RFBU_SALTY      PHKNIHSFIKNKKVW--------------SDSYN---LIIVCG-------RTDYAMSLQQMVVDLELK-D
GT378_AFV2      ----------------------------------------------------------------------
ALG11_KLULA     VVIAQFRPEKRHELILSIDATTK-KDLIPK-------IIFIGS--TRNVEDREYVETLKKYFEALKIPTH
ALG11_SCHPO     TLLYLAQYRPEKNHENVLRSFALYFEQHPD---SPAKLLLVGS--VRGEEDMCFVNHLKTLATELNLQSK
ALG11_CANAL     LYLAQFRPE-KRHALLLKEYSNFLSNNFPTNKFPT--LVFAGS--CRTADDTATLKFLQEQVAKLDL-SR
SUS3_ORYSJ      ----------------------------------------------------------------------
GL1D1_XENTR     ----------------------------------------------------------------------
LPSB_RHIME      --------------------------------------------------------ELKERVAKAGL-AD
Y1059_METJA     VFINIGRLTEQKGQWFLIRSFKRV-----TEKYPNAKLIILGDGELKN--------KLQELINKLNL-QN
PIMA_MYCTU      VLFLGRYDEPRKGMAVLLDALPKVVQRFP-----DVQLLIVGHGDA---------DQLRGQAGRL---AA
PIMA_MYCLE      --------EPRKGMSVLLDALPGVM-----ECFDDVQLLIVGRGDEEQLRS--QAGGLVEHIR-------
PIMA_MYCBO      VLFLGRYDEPRKGMAVLLDALPKVVQRFP-----DVQLLIVGHGDA---------DQLRGQAGRL---AA
WCAL_SALTY      ---SVARLTEKKGLHVAIEACRQLKAQGVAFRY---RILGIGPWERRLRTLIEQYQEDVIEMPGFK-PSH


                         .         *         .         .         .         .         +:350
query           QIVFLHSPSDTQKVNLIRRSRAVLYTPDREHFGIVPVEAMYLGTPVIAVNTGGPCESVRNNETGFLVDQT
ALG2_MOUSE      HVTFLRSFSDRQKISLLHGCLCVLYTPSNEHFGIVPLEAMYMQCPVIAVNNGGPLESIVHKVTGFLCEPD
ALG2_HUMAN      YVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQCPVIAVNSGGPLESIDHSVTGFLCEPD
ALG2_RHIPU      TIVFLCSFNDAQRTFLLDQAKLLLYTPSNEHFGITPVEGMYASVPVIAVNTGGPVETVKNKETGLLLPSD
ALG2_DICDI      RVIFLITINEEQKQWLLLNCCCLIYTPSFEHFGITPLEGMYAGKPVIAVNNGGPLETVVDGKTGYLCNPT
ALG2_KLULA      QILFLTSVSSSLKELLLQSTEMLLYTPSNEHFGIVPLEAMKYGVPVLAVDTGGPLETVVDDATGWLRPSD
ALG2_CANAL      DVLFLPSISTQLKNSLIQQTELLLYTPPREHFGIVPLEAMLAKTPVLAINFGGPLETVVNYNGNNLDEAT
ALG2_SCHPO      NVLFLLSVPSKVRDALISSSRILLYTPENEHFGIVPLEAMLRKVPVLAQTNGGPLETVIDGKNGWLRPRD
ALG2_NEUCR      EVLFLLSVPNTLKEILLRSAKLLVYTPSNEHFGIVPLEAMLRGVPVLAANNGGPTETVVEGETGWLRDPN
ALG2_YEAST      KIIFXXXXXXXXXXXXXERTEMLLYTPAYEHFGIVPLEAMKLGKPVLAVNNGGPLETIKSSATGWLKPQW
ALG2_DEBHA      DXXXXXXXXXXXXXXXXXNAELLLYTPSFEHFGIVPVESMLFKTPVLSANNGGPLESIVHTATGYSQEPN
ALG2_YARLI      DVIFFPSASNSFKNTLLHISKLLLYTPQNEHFGIVPLEGMLWKTPVLATNSGGPLETVKDN-VGWTVEGK
ALG2_ASHGO      TIFFSRTPEHYTFPTGVREKKVIFYTPSREHFGIVPLEAMKHGTPVLAVDNGGPLETVQDTATGWLAGIW
ALG2_CANGA      KVIFLTSISSSLKEFLIQNMQLLLYTPSYEHFGIVPLEAMKYGKPVLAVNNGGPVETVEDNETGWLRSAD
ALG11_DICDI     HVEFQIGISSDQLNQLLSEASVGIHTMYNEHFGIGVVELMAAGVIPVANNSAGPKEDVRHEDTGFLA-ST
ALG11_XENLA     FKV--NVPFEELKKHLSEATIG-LHTMWNEHFGIGIVECMAAGTIILAHNSGGPKLDIEEQQTGFLAD-S
ALG11_MOUSE     NVEFKINISFDELKNYLSEATIGLHTMWNEHFGIGVVECMAAGTVILAHNSGGPKLDIEGQITGFLA-ES
CAPM_STAAU      NVVLIKHVSDP--ISFYNNMNVFVFPTHREGFGNVSIEAQALEVPVITTNVTGAIDTVVNGETGFIVEKD
SUS2_SOLTU      ELIKTHNLNGSSQMNRVRNGELYRYIADTEAFGLTVVEAMSCGLPTFATNQGGPAEIIVHGKSGFQIDQA
ALG11_HUMAN     KI---NIPFDELK-NYLSEATIGLHTMWNEHFGIGVVECMAAGTIILAHNSGGPKLDIEGDITGFLA-ES
ALG11_PONAB     KI---NIPFDELK-NYLSEATIGLHTMWNEHFGIGVVECMAAGTIILAHNSGGPKLDIEGDITGFLA-ES
YMP8_CAEEL      LIWQLNVPYEDLVVEL-SKALISIHTMHNEHFGISVVEAMAASTIILSNDSGGPRMDIVKDYEGHCVGYT
SUS2_PEA        FRWI------TAQTNRARNGELYRYIADTEAFGLTVVEAMTCGLPTFATNHGGPAEIIEHGVSGFHIDQA
YTCC_BACSU      HIIFTKFPADDIPNLFLMADVFVCSSQWNEPLARVNYEAMAAGTPLITTNRGGNGEVVKHEVTGLVIDNK
ALG11_DANRE     RVEFLNIPFQELKKDLTDATIG-LHTMWNEHFGIGIVECMAAGTIILAHKSGGPKLDIDGGPTGFLAD--
SUS2_TULGE      YKLDGHIRWISAQMNRVRNGELYRYIADSEAFGLTVVESMTCGLPTFATCHGGPAEIIVHGVSGYHIDYH
ALG11_XENTR     FKVNI--PFAELKKHLSEATIG-LHTMWNEHFGIGIVECMAAGTIILAHNSGGPKLDIEEHETGFLAD-S
SUSY_MEDSA      NGQFRWISSQMNRVRNGELYRVICDTKGAEAFGLTVVEAMATGLPTFATLNGGPAEIIVHGKSGFHIDRA
SUSY_VICFA      NGQFRWISSQMNRVRNGELYRVICDTKGAEAFGLTVVEAMATGLPTFATLNGGPAEIIVHGKSGFHIDRA
SUSY_SOYBN      NGQFRWISSQMNRVRVICDTRGAFVQPAYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDYH
SUSY_BETVU      RGQFRWIASQT---NRVRNGELYRYICDKEAFGLTVVEAMTCGLPTFATCHGGPAEIIEDGVSGFHIDDQ
SUSY_SOLLC      ELIETHNLNGSSQMNRVRNGELYRYIADTEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDQA
SUSY_PHAAU      NGQFRWISSQMNRVRNGELYRVIADTKGAEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSGFHIDRA
ALG11_YEAST     LISFEKNPFDKIEI-LLNKSTFGVNAMWNEHFGIAVVEYMASGLIPIVHASAGP----------------
SUS1_SOLTU      ELIETHNLNGSSQMNRVRNGELYRYIADTEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSGFHIDQA
SUS1_DAUCA      YKLNGQFRWISSQMNRVRNGELYRYIADTEAFGLTVVEAMTCGLPTFATLHGGPAEIIVHGKSGFHIDQV
YPJH_BACSU      -------------------------------FGLVLLEAMACGVPCIGTNIGGIPEVIKNNVSGFLVDGD
SUS2_ARATH      YDLHGEFRWIAAQMNRARNGELYRYIADTEAFGLTVVESMTCALPTFATCHGGPAEIIENGVSGFHIDQV
YQGM_BACSU      RVMFLPFLNRKDIRTLLSHCEMAVFPSSYEPFGLAAQESMEQGVLTVVSQSGGFCDYAVHDKTAIIADFT
SUS1_TULGE      YKLQGHIRWISAQMNRVRNGELYRYIADTEAFGLTVVESMTCGLPTFATCHGGPAEIIVHGVSGFHIDKA
SPS2_CRAPL      QVAFPHKQSDVPEIRLASKTKGVFINPAFEPFGLTLIEAAAHGLPMVATKNGGPVDIHRALNNGLLVDHD
Y2592_STRCO     --VELLGPSQHMTEEWARASLTILPSQDGEAFPLVLLEAFAAGVPAVAYDVTGPAEIIRHGEDGLLVPND
SUS1_ORYSJ      YNLNGHIRWISAQMNRVRNGELYRYICDTEAFGLTVVESMTCGLPTFATAYGGPAEIIVNGVSGFHIDKA
SPS1_CITUN      QVAYPHKQSDVPEIRLAAKTKGVFINPAFEPFGLTLIEAAAHGLPIVATKNGGPVDIHRVLDNGLLVDHD
SPS_ORYSJ       -VAFPHKQSDVPEIRLTGKMKGVFINPALEPFGLTLIEAAAHGLPIVATKNGGPVDIKNALNNGLLVDHD
SPS_ORYSI       -VAFPHKQSDVPEIRLTGKMKGVFINPALEPFGLTLIEAAAHGLPIVATKNGGPVDIKNALNNGLLVDHD
SPS_SOLTU       QVAYPHKQSDVPDIRLAAKTKGVFINPAFEPFGLTLIEAAAYGLPMVATKNGGPVDIHRVLDNGLLVDHD
SPS_MAIZE       -VAFPHNQADVPEIRLAAKMKGVFINPALEPFGLTLIEAAAHGLPIVATKNGGPVDITNALNNGLLVDHD
SUS2_DAUCA      NGQFRWISAQKNRVRNGELYRCIADTKGAEAFGLTVIEAMTCGLPTFATIHGGPAEIIVHGTSGFHIDYH
SPS_VICFA       QVAYPHKQSDVPDIRLAAKTKGVFINPAFEPFGLTLIEAAAYGLPMVATKNGGPVDIHRVLDNGLLIDPH
SPS1_CRAPL      -LVAYHKQSDVPDIRLAAKTKGVFINPAFEPFGLTLIEAAAHGLPIVATKNGGPVDIHRVLDNGILVDHN
SUS1_ARATH      YKLNGQFRWISSQMDRVRNGELYRYICDTEAFGLTVVEAMTCGLPTFATCKGGPAEIIVHGKSGFHIDQA
SPS_SPIOL       QVAYPHKQSDVPDIRLAAKTKGVFINPAFEPFGLTLIEAAAYGLPIVATKNGGPVDIIGVLDNGLLIDHD
SUSY_ALNGL      QFRWISS-----QMNRVRNGELYRYIADTEAFGLTVVESMTCGLPTFATCKGGPAEIIVHGKSGFHIDYH
SPS_BETVU       QVAYPHKQADVPEIRLAAKTKGVFINPAFEPFGLTLIEAAAHGLPMVATKNGGPVDIQRVLDNGLLVDHE
ALG11_YARLI     VSFVLDAPFDKVR-DILRTASMGVNAMWNEHFGIVVVEYMSAGLIPVVHNSGGPCDIV------------
Y1607_METJA     KVVFLGFVNGDTLKKLYKSADVVVIPSVYEPFGIVALEAMAAGTPVVVSSVGGLMEIIKHEVNGIWV---
SUS2_MAIZE      YNLNGHIRWISAQMNRVRNGELYRYICDTEAFGLTVVEAMTCGLPTFATAYGGPAEIIVHGVSGYHIDDK
TAGE_BACSU      --VFLKGYTDNPDSEF-QKAWLTISTSHFEGFGLSNMEALSNGCPVVTYDYDGARSLVTDGANGYVIEQN
SUS2_ORYSJ      YKLKGHIRWISAQMNRVRNGELYRYICDTEAFGLTVIEAMTCGLPTIATCHGGPAEIIVDGVSGLHIDKA
SUS2_HORVU      YNLSGHIRWISAQMNRVRNGELYRYICDMEAFGLTVIEAMTCGLPTFATAYGGPAEIIVNGVSGYHIDPY
SUS1_HORVU      YKLKGHIRWISAQMNRVRNGELYRYICDTEAFGLTVIEAMTCGLPTIATCHGGPAEIIVDGVSGLHIDYH
LPSE_RHIME      -----------------------------EPLGNVILESWAQGTPVVSTRSEGPQWFMRDGENGLMVDGD
SUS1_MAIZE      YKLKGHIRWISAQMNRVRNGELYRYICDTEAFGLTVIESMTCGLPTIATCHGGPAEIIVDGVSGLHIDKA
LPCC_RHILV      RILFLGEVPD---IKIWYRRLTLYVAPSREGFGLTPLEAMASRTAVVASDAGAYAELIVTGETGSVVAAS
GPI3_SCHPO      RVEMLGSVRHDQVRDVMVRGHIYLHPSLTEAFGTVLVEAASCGLYVISTKVGGVPEVLPSHMTRFARPE-
EPSD_BACSU      HVCFYGFCSDIHE--LIQLADVSVASSIREGLGMNVLEGMAAEQPAIATDNRGHREIIRDGENGFLIKGD
WAAK_SALTY      DCIMAGGQSPDQMHNFYHIADLVIVPSQEEAFCMVAVEAMAAGKAVLASKKGGISEFVLDGITGYHLAES
Y1178_METJA     HIELLGRKSFDEVASFMRKCSFLVVPSRSEGFGMVAVEGMACSKPVIATRVGGLGEIVIDGYNGLLAEK-
COTSA_BACSU     ----------------------------QEPLARVHYEAMAAGLPIITSNRGGNPEVIEEGKNGYIIHEN
YC07_KLEPN      ENVVYYGWVDNKELPAYFCENDVLLMPSRESFGLVAVEAQLYGVPVIANNVASLPEVISDGLTGMLVNFE
Y1698_HAEIN     SVNFIPRTND---VSFYYESSSIYCLPSQEGLPLVVIEAMAFGLPIVAFNSPGVKQLVEHKENGFLCEQN
RFBU_SALTY      KVTFLHEVSFNELKILYSKAYALVYPSIDEGFGIPPIEAMASNTPVI-----------------------
GT378_AFV2      ------SLTDDEKYELLSQSRLFAWLSESEGFGIPPVEAMSVGTPVV-----------------------
ALG11_KLULA     LVDFKTDCKYDDMKSILYSSWFGINAMWNEHFGIAVVEYMASGLIPLCHASAGPLYDIKANETGFFIDET
ALG11_SCHPO     VKFVVDAPWPKVVEYLGTCSIGVNYMWN-EHFGIGVVEYMAAGLIPVVNNSGGPKFDIIGKPTGFTISEY
ALG11_CANAL     FVEFRIDISYDEVVELLSSCKFGLNAMWNEHFGIGVVEYMARGIPIVHASAGPLLDMIGRND--------
SUS3_ORYSJ      -----------------------------EAFGLTVIEAMTCGLPTFATAYGGPAEIIVHGVSGYHIDKA
GL1D1_XENTR     --------SDLQAV--IKRSFALVNSSLSEGMSAAILEAMDLEVPVLARDIPGNSAIIKHEDTGLLF-ST
LPSB_RHIME      RILFV---GEHTNIPDWYRALDLFVAPQREGFGLTPLEAMATGVPVVATDVGAFSELVTSEETGLII---
Y1059_METJA     NVYLLGMQKNPFK--FLKHSNCFVFSSLWEGLPNTVIEALSLNLPVISTD--------------------
PIMA_MYCTU      HLRFLGQVDDAGKASAMR-SADVYCAPNTESFGIVLVEAMAAGTAVVASDLDAFRRVLRDGEVGHL----
PIMA_MYCLE      ---FLGQVDDAGKAAAMR-SADVYCAPNGESFGIVLVEAMAAGTPVVASDLDAFRRVLRDGEVGHLV---
PIMA_MYCBO      HLRFLGQVDDAGKASAMR-SADVYCAPNTESFGIVLVEAMAAGTAVVASDLDAFRRVLRDGEVGHL----
WCAL_SALTY      EVKAMLDDADVFLLPSITGTDG-----DMEGIPVALMEAMAVGIPVVSTVHSGIPELVEAGKSGWLVEND


                         .         .         .         .         *         .         .:420
query           AEAFAEKMIDLMKDEEMYRRMSEEGPKWVQKVFAFEAFARKLDEIIQSTL
ALG2_MOUSE      PVHFSEAMEKFIHKPSLKATMGLAGKARVAEKFSADAFADQLYQYV----
ALG2_HUMAN      PVHFSEAIEKFIREPSLKATMGLAGRARVKEKFSPEAFTEQLYRYVTKLL
ALG2_RHIPU      PDVWAEGIRDFIIEKYNGKQMGQHGRQHVQSKFSLPAFADRLEAMM----
ALG2_DICDI      VKDFANAFNKIINDPINSKKMGINGKQRVNDKFSFKPFAQNLNTIVK---
ALG2_KLULA      ADEWS-KVLDQSVDEKNHSLFEVNGPKRIKYYFSREAMSKNFDNTI----
ALG2_CANAL      GYTFTKWSKIIMKDESTKIKLGENGRNRVINKFSRKKLAQSLDNIL----
ALG2_SCHPO      AKIWGNVIYEATTSTTYTAAMGEAGSEWVKNEFSTDAMARKFESEIMS--
ALG2_NEUCR      DVGEWAKVMDKVLNEEELKRMGKKGVERVKGRFADTQMAERLEEIIE---
ALG2_YEAST      ATAIDESRKILQNGSVNFER---NGPLRVKKYFSREAMTQSFEENVEKVI
ALG2_DEBHA      DELWSKTMHTFYTDEATKLKLGENGLTRVHELFSSEAFMQNL--------
ALG2_YARLI      SELWADKVVHMNASD--YAVLQTECVNWVNR-FSQDTMASELEEAME---
ALG2_ASHGO      AEAIDEQAEYVKKNPGIF---ATNGPKWVKDKFSRDAFLHNIDNIFMT--
ALG2_CANGA      ADEWASALIELNQNPELFK---NNGPKRVIELFSRKAMTQEFETNIKLAL
ALG11_DICDI     IQEYAEYIHEILAYREKYVEMQKK--------------------------
ALG11_XENLA     VDSYAAAM------------------------------------------
ALG11_MOUSE     EEGYADSMAHIL--------------------------------------
CAPM_STAAU      FKAIAEKIEKLINDESLRETIGHNGRKRVENKFSSQIIWEELESMYNTFL
SUS2_SOLTU      ADLLADFFEKCKVDPSHWEAISEGGLKRIQEKYTWQIYSDRL--------
ALG11_HUMAN     EEDYAETIAHIL--------------------------------------
ALG11_PONAB     EEDYAETIAHIL--------------------------------------
YMP8_CAEEL      KEEYVETILKIVEE------------------------------------
SUS2_PEA        SELLVDFFQRCKEDPNHWNKVSDGGLQRIYERYTWKIYSERL--------
YTCC_BACSU      PSSFAKAIDRAFTDQELMNKMTKNARKHVEALFTFTHAAKRLNTVYQSVL
ALG11_DANRE     --------------------------------------------------
SUS2_TULGE      GDKAAELLVDFFKDQTHWDAISNGGLKRIYEKYTWKIYSERL--------
ALG11_XENTR     VESYAAAM------------------------------------------
SUSY_MEDSA      ADLLVEFFEKVKADPSHWDKISQGGLQRIEEKYTWTIYSQRL--------
SUSY_VICFA      ADLLVEFFEKVKADPSHWDKISLGGLQRIEEKYTWQIYSQRL--------
SUSY_SOYBN      GDRAADLLVDFFEDPTHWDKISKAGLQRIEEKYTWQIYSQRL--------
SUSY_BETVU      AEKMTEFFVKCREDPNYWTKISAGGLLRIKERYTWQKYSERL--------
SUSY_SOLLC      ADLLADFFEKCKKEPSHWETISTGGLKRIQEKYTWQIYSERL--------
SUSY_PHAAU      ADLLVEFFEKVKVDPSHWDKISQAGLQRIEEKYTWQIYSQRL--------
ALG11_YEAST     --------------------------------------------------
SUS1_SOLTU      ADLLADFFEKCKKDPSHWETISMGGLKRIEEKYTWQIYSESL--------
SUS1_DAUCA      AELLVNFFEKCKTDPSQWDAISAGGLKRIQEKYTWQIYSERL--------
YPJH_BACSU      VTAATARAMSILEDEQLSNRFTKAAIEMLENEFSSKKIVSQYEQI-----
SUS2_ARATH      AATLVSFFETCNTNPNHWVKISEGGLKRIYERYTWKKYSERL--------
YQGM_BACSU      LVQEAADLLDFLKDREKARRIKEAGRQQVFKL------------------
SUS1_TULGE      SEQLVSFFEKCKEDPAHWEKISQGGLQRIYEKYTWKLYSERL--------
SPS2_CRAPL      QDAIANALLKLVSEKNLWNECRKNGLK-----------------------
Y2592_STRCO     VESLAEAISRLMGDEALLRSYGEKAHEGSTR-FAADVIVKQWEEL-----
SUS1_ORYSJ      SALLVEFFEKCQEDPSHWTKISQGGLQRIEEKYTWKLYSERL--------
SPS1_CITUN      QQSIADALLKLVAGKQLWARCRQNGLK-----------------------
SPS_ORYSJ       QHAIADALLKLVADKNLWQECRKNGLRNIQ--------------------
SPS_ORYSI       QHAIADALLKLVADKNLWQECRKNGLRNIQ--------------------
SPS_SOLTU       QQAIADALLKLVADKQLWAKCRANGLK-----------------------
SPS_MAIZE       QNAIADALLKLVADKNLWQECRRNG-------------------------
SUS2_DAUCA      GEKAAELIVNFFEEPSHWETISAGGLKRIQEKYTWQIYSERL--------
SPS_VICFA       DESIADALLKLVSNKQLWAKCRQNGLK-----------------------
SPS1_CRAPL      QESIADALLKLVAEKHLWAKCRANGLK-----------------------
SUS1_ARATH      ADTLADFFTKCKEDPSHWDEISKGGLQRIEEKYTWQIYSQRL--------
SPS_SPIOL       QKSIADALLKLVADKHLWTKCRQNGLK-----------------------
SUSY_ALNGL      GEQAAQLLVDFFEDPSHWAKISLGGLQRIHEKYTWKIYSERL--------
SPS_BETVU       QQSIATALLKLVADKQLWTKCQQNGLK-----------------------
ALG11_YARLI     --------------------------------------------------
Y1607_METJA     --------------------------------------------------
SUS2_MAIZE      ASALLVDFFDKCQAESHWSKISQGGLQRIEEKYTWKLYSERL--------
TAGE_BACSU      IEKLGQAIISLMKDESTHQKFSEQAFKMAEK-------------------
SUS2_ORYSJ      ADILVNFFEKCKQDSTYWDNISQGGLQRIYEKYTWKLYSERL--------
SUS2_HORVU      QNDKASALLKCQEDPSHWNKISQGGLQRIEEKYTWKLYSERL--------
SUS1_HORVU      SDKAADILVNFFEDPSYWDKISQGGLKRIYEKYTWKLYSERL--------
LPSE_RHIME      AEGFARAIEQIVADNSLRTRLAERGHETLVGQFSREAITDAYLQLLAS--
SUS1_MAIZE      ADILVNFFDKCKADPSYWDEISQGGLQRIYEKYTWKLYSERL--------
LPCC_RHILV      GEALTRAIAPYIADPALAVAHGENALRHVRANFALEREASAIGAVYNSLL
GPI3_SCHPO      EDDLADTLSSVITDYLDHKIKTETFHEEVKQMYSWIDVAERTEKVYDS--
EPSD_BACSU      SAAFARRIEQLYHKPELCRKLGQEGRK-----------------------
WAAK_SALTY      SDSIINDINRALADKERH-QIAEKAKSLVFSKYSWENVAQRFEE------
Y1178_METJA     --------------------------------------------------
COTSA_BACSU     PKQYAERINDLLSSSEKRERLGKYSRREAESNFGWQRVAENL--------
YC07_KLEPN      D---ANKVVEIMDSHTIH--------------------------------
Y1698_HAEIN     NIEEMVKGLDLLNNPELYLQMSDK--------------------------
RFBU_SALTY      --------------------------------------------------
GT378_AFV2      --------------------------------------------------
ALG11_KLULA     DPDFLAK-------------------------------------------
ALG11_SCHPO     AEAY-HKALTLSPQEQLEMRIN----------------------------
ALG11_CANAL     --------------------------------------------------
SUS3_ORYSJ      SALLVEFFEKCQEDPNHWIKISQGGLQRIEEKYTWKLYSERL--------
GL1D1_XENTR     PQEFVQLSKRLMTEPELKRRIVSNAKRYVNSNHSWE--------------
LPSB_RHIME      --------------------------------------------------
Y1059_METJA     --------------------------------------------------
PIMA_MYCTU      --------------------------------------------------
PIMA_MYCLE      --------------------------------------------------
PIMA_MYCBO      --------------------------------------------------
WCAL_SALTY      AQALAARLAEFSRDHDTLESVITRAREKVAQDFNQQAINRQLASLLQT--