[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cele0:CAA21529.1

[Show Plain Result]


## Summary of Sequence Search
    1::180
    1::180     e-105 100%  180 aa  SPCS2_CAEEL RecName: Full=Probable signal peptidase complex subunit
    1::180     4e-94  87%  180 aa  SPCS2_CAEBR RecName: Full=Probable signal peptidase complex subunit
   18::194     3e-33  42%  201 aa  SPCS2_DANRE RecName: Full=Probable signal peptidase complex subunit
   18::194     4e-31  41%  201 aa  SPCS2_XENTR RecName: Full=Probable signal peptidase complex subunit
   43::219     4e-30  42%  226 aa  SPCS2_PONAB RecName: Full=Signal peptidase complex subunit 2;      
   43::219     4e-30  42%  226 aa  SPCS2_MOUSE RecName: Full=Signal peptidase complex subunit 2;      
   43::219     4e-30  42%  226 aa  SPCS2_MACFA RecName: Full=Signal peptidase complex subunit 2;      
   43::219     4e-30  42%  226 aa  SPCS2_HUMAN RecName: Full=Signal peptidase complex subunit 2;      
   43::219     4e-30  42%  226 aa  SPCS2_CANFA RecName: Full=Signal peptidase complex subunit 2;      
   12::186     7e-28  38%  199 aa  SPCS2_DROME RecName: Full=Signal peptidase complex subunit 2;      
    9::187     8e-13  29%  192 aa  SPCS2_ARATH RecName: Full=Probable signal peptidase complex subunit
   11::160     2e-12  29%  183 aa  SPCS2_DICDI RecName: Full=Signal peptidase complex subunit 2;      
  613::676     9e-04  38%  923 aa  SPXS1_DICDI RecName: Full=SPX and EXS domain-containing protein 1;
    1::180

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTDEPVKVVNKWDGPTVKNALDEVVKKILNDKVGWTESHNLMNLRLLISFIGVAFSAFACGYDYYEPFPK
SPCS2_CAEEL     MTDEPVKVVNKWDGPTVKNALDEVVKKILNDKVGWTESHNLMNLRLLISFIGVAFSAFACGYDYYEPFPK
SPCS2_CAEBR     MSDERITVVNKWDGPTVKNGLDEVVKKILNDKVGWTEQHNLMNLRLLISFIGVAFSAFACGYDFYAPFPK
SPCS2_DANRE     --EKPVKI-DKWDGAAVKNSLDDAAKKVLIEKYGYLESFNLVDGRLFICTVSCLFTIVALIWDYLHPFPE
SPCS2_XENTR     --DKPVKI-DKWDGSAVKNSLDDAAKKVLLEKYRYVENFCLIDGRLIICTISCVFAIVALVWDYLHPFPE
SPCS2_PONAB     --DKPVKI-DKWDGSAVKNSLDDSAKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPE
SPCS2_MOUSE     --DKPVKI-DKWDGSAVKNSLDDSAKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPE
SPCS2_MACFA     --DKPVKI-DKWDGSAVKNSLDDSAKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPE
SPCS2_HUMAN     --DKPVKI-DKWDGSAVKNSLDDSAKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPE
SPCS2_CANFA     --DKPVKI-DKWDGSAVKNSLDDSAKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPE
SPCS2_DROME     ---EELVKVNKWDGSAVKHALDDAVKTLLGDRPQLKEQFGLVNTRLALCALAVSVAIMAHAWDFTHPFPE
SPCS2_ARATH     -TNKNVKKANLLDHHSIKHILDESVSDIVTSR-GYKEDVRLSNLKLILGTIIIVVALVAQFYN--KKFPE
SPCS2_DICDI     --EKPIQVT-LYDSNTIKQTLDDSIVKYVTSALSYTQNQKLNYTKVLFGLIGCTLAAIAQFYPI--PFPK
SPXS1_DICDI     ----------------------------------YRETNNKIHLKYAVGFSVVLFSALNGNYQAYEPWSA


                         .         .         *         .         .         .         .:140
query           SKIVLAVCSVSYFICMGILQMYQWYVEKDCIYEATEVDGKQSRKWAWSSEIKAHDDKYTLSAEFKKEGRS
SPCS2_CAEEL     SKIVLAVCSVSYFICMGILQMYQWYVEKDCIYEATEVDGKQSRKWAWSSEIKAHDDKYTLSAEFKKEGRS
SPCS2_CAEBR     SKIVLLVCSVSYFICMGVLQLFQWYVEKDCFYEANEVDGKQTRKWAWSSEIKAHDDKYVLSAEFKKEGRS
SPCS2_DANRE     SKPVLACCVVSYFIMMGILTLYTSYKEKNIFLVAMQKDPDPDHSWCLSSSLKRFDDQYTLRMSFTKTKQS
SPCS2_XENTR     SKPVLAICVISYFLMMGILTIYTSYKEKSIFLVAHRKDPDPDDIWHLSSSLKRFDDKYTLKVTYGKTKAQ
SPCS2_PONAB     SKPVLALCVISYFVMMGILTIYTSYKEKSIFLVAHRKDPDPDDIWQLSSSLKRFDDKYTLKLTF-ISGRT
SPCS2_MOUSE     SKPVLALCVISYFVMMGILTIYTSYKEKSIFLVAHRKDPDPDDIWQLSSSLKRFDDKYTLKLTF-ISGRT
SPCS2_MACFA     SKPVLALCVISYFVMMGILTIYTSYKEKSIFLVAHRKDPDPDDIWQLSSSLKRFDDKYTLKLTF-ISGRT
SPCS2_HUMAN     SKPVLALCVISYFVMMGILTIYTSYKEKSIFLVAHRKDPDPDDIWQLSSSLKRFDDKYTLKLTF-ISGRT
SPCS2_CANFA     SKPVLALCVISYFVMMGILTIYTSYKEKSIFLVAHRKDPDPDDIWQLSSSLKRFDDKYTLKLTF-ISGRT
SPCS2_DROME     SRPVLLFSVLAYFALLGILTLHSSFREKGTFAVALQKDKERERLWEASSDMRKYDDKYTLSVRDTKNGKR
SPCS2_ARATH     NRDFLIGCIALYVVLNAVLQLILYTKEKNAILFTYPPEGSTSTGLVVSSKLPRFSDQYTLSADPKSISAG
SPCS2_DICDI     NKPVLILCVALYVVISLILYYINIFIQKDYILQAS----KSNDEIKVATVLQKYDPNYQVKIENAKNS-S
SPXS1_DICDI     SRILWCVCFV-----LSTLYMYCWDVVVD-----------------------------------------


                         +         .         .         .         .         *         .:210
query           GQGKITKSIGAYIDNDGEIIVPLVKKEVDDLYNRLIRSEQ
SPCS2_CAEEL     GQGKITKSIGAYIDNDGEIIVPLVKKEVDDLYNRLIRSEQ
SPCS2_CAEBR     GQGKIIKSIGAYIDNDGEIMIPLVQREVDDLWARLIRSEQ
SPCS2_DANRE     RETEFTKSVSVFFDENGTLVMDQYEKYVSKLHDTL-----
SPCS2_XENTR     RDAEFTKSIARFFDDNGTLVMDLFEPEVSKLHDSL-----
SPCS2_PONAB     KQAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSL-----
SPCS2_MOUSE     KQAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSL-----
SPCS2_MACFA     KQAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSL-----
SPCS2_HUMAN     KQAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSL-----
SPCS2_CANFA     KQAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSL-----
SPCS2_DROME     REQSSNKSCAAFIDQNGIVLDNLVANEVNRLFNAL-----
SPCS2_ARATH     KSVQLTKSVTQWFTKDGVLVEGLFWKDVEALIKNYAEEE-
SPCS2_DICDI     INVPFSKSIDLYFDTKGTFL--------------------
SPXS1_DICDI     ----------------------------------------