[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cele0:CAA21685.2

[Show Plain Result]


## Summary of Sequence Search
    1::411
   21::303     4e-41  37%  402 aa  TBC20_MOUSE RecName: Full=TBC1 domain family member 20;
   18::304     6e-40  36%  403 aa  TBC20_HUMAN RecName: Full=TBC1 domain family member 20;
   18::304     2e-39  36%  403 aa  TBC20_BOVIN RecName: Full=TBC1 domain family member 20;
   69::280     4e-20  29%  373 aa  GYP10_SCHPO RecName: Full=GTPase-activating protein gyp10;
  102::162     4e-04  38%  497 aa  GYP8_YEAST RecName: Full=GTPase-activating protein GYP8;
    1::411

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGPLARAKFNALRNKREAIDRFLKKHRKEDLSLYID
TBC20_MOUSE     ---------------------------------------KADFNAKRKKKVAEIHQALNSDPIDLAA---
TBC20_HUMAN     -----------------------------------GGAEKADFNAKRKKKVAIHQALNSDPTD-----VA
TBC20_BOVIN     -----------------------------------GGAEKGDFNAKRKKKVAEIYQALNSEPTDVAA---
GYP10_SCHPO     ----------------------------------------------------------------------
GYP8_YEAST      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ELRDFAISPGGLVDDEFRAVIWPVLSANLVQNXXXXXXXXXXXXXXXXXXXDFDEEPAYEESEELTLEDL
TBC20_MOUSE     -LRRMAISEGGLLTDEIRCQVWPKL-----------------------LNVNTSEPPPVSRKD---LRDM
TBC20_HUMAN     ALRRMAISEGGLLTDEIRRKVWPKL-LNVNAN-----------------------DPPPISGKNLR----
TBC20_BOVIN     -LRRMAISEGGLLTDEIRRKVWPKL-LNVNTN-----------------------DPPPISGKNLR----
GYP10_SCHPO     ----------------------------------------------------------------------
GYP8_YEAST      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KGHKEWNQVELDVHRTLSRFPPNISDTHRDVLQTELIPLIVRVLSINPRFNYYQGFHDICLTVLLVCGEV
TBC20_MOUSE     S--KDYQQVLLDVRRSLRRFPPGMPDEQRXXXXXXXXXXXXXXXDRNPQLHYYQGYHDIVVTFLLVVGER
TBC20_HUMAN     QMSKDYQQVLLDVRRSLRRFPPGMPEEQRXXXXXXXXXXXXXXXXRNPQLHYYQGYHDIVVTFLLVVGER
TBC20_BOVIN     QMSKDYQQVLLDVRRSLRRFPPGMPEEQRXXXXXXXXXXXXXXXXRNPQLHYYQGYHDIVVTFLLVLGER
GYP10_SCHPO     --YADQNQVHLDSERSFFQYKPFLLRKHR----SQLTKLLSVVFKHYPELCYYQGLHDIAQILLLTLPFS
GYP8_YEAST      --HKDEGQVILDAERS---FGGIVDXXXXXXXXXXXXXXITRVLRKYPTLNYYQGYHDI-VSVFIMC---


                         .         .         .         +         .         .         .:280
query           DALPVCSNLAKNGSFNNYLLKTLEKSVVRELDLLYVILSRVDPSLEQVMRSVELGTMFGLSWPLTWFSHT
TBC20_MOUSE     LATSLVEKLSTH-HLRDFMDPTMDNTK-HILNYLMPIIDQVSPELHDFMQSAEVGTIFALSWLITWFGHV
TBC20_HUMAN     LATSLVEKLSTH-HLRDFMDPTMDNTK-HILNYLMPIIDQVNPELHDFMQSAEVGTIFALSWLITWFGHV
TBC20_BOVIN     LATSLVEKLSTH-HLRDFMDPTMDNTK-HILNYLMPIIDQVNPELHDFMQSAEVGTIFALSWLITWFGHV
GYP10_SCHPO     HALPLMEHLVFY-RLRDFMLPTLD-GTVKQLQLILAVIKARDPTLYEYLIKADIQCYFALSWLITWFAHD
GYP8_YEAST      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LKQYQQIVRFFDVFLASSPLLPIYXXXXXXXXXXXXILACEREMPFLHRLLTEMPHELPIDTIIKDSVYL
TBC20_MOUSE     LMDFRHVVRLYDFFLACHPLMPIYFAAVIVLYREQEVLDCDCDMASVHHLLSQIPQDLPYETLISRAGDL
TBC20_HUMAN     LSDFRHVVRLYDFFLACHPLMPIYFAAVIVLYREQEVLDCDCDMASVHHLLSQIPQDLPYETLISRAGDL
TBC20_BOVIN     LSDFRHVVRLYDFFLACHPLMPIYFAAVIVLYREQEVLDCDCDMASVHHLLSQIPQDLPYETLISRAGDL
GYP10_SCHPO     VSDISVVCRLFDFFISSHPLTVVYTCAQVVLDNRTSIIELNSGADLLHSYLCKLPASINVNQLIKNTCAT
GYP8_YEAST      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SKLMPPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TBC20_MOUSE     FVQFPP-------------------------------------------------------
TBC20_HUMAN     FVQFPP-------------------------------------------------------
TBC20_BOVIN     FVQFPP-------------------------------------------------------
GYP10_SCHPO     ISAVP--------------------------------------------------------
GYP8_YEAST      -------------------------------------------------------------