[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cele0:CAA86661.1

[Show Plain Result]


## Summary of Sequence Search
    1::799
    1::786       0.0 100%  799 aa  ZYG11_CAEEL RecName: Full=Early embryogenesis protein zyg-11;
  160::725     2e-63  35%  744 aa  ZY11B_HUMAN RecName: Full=Protein zyg-11 homolog B;
  151::668     3e-63  37%  732 aa  ZYG11_XENLA RecName: Full=Protein zyg-11 homolog;
  160::677     1e-61  35%  744 aa  ZY11B_MOUSE RecName: Full=Protein zyg-11 homolog B;
  101::677     1e-59  33%  746 aa  ZYG11_DANRE RecName: Full=Protein zyg-11 homolog;
  102::625     2e-50  34%  627 aa  ZY11A_MOUSE RecName: Full=Protein zyg-11 homolog A;
   70::616     1e-47  33%  678 aa  ZY11A_HUMAN RecName: Full=Protein zyg-11 homolog A;
  198::733     4e-32  28%  766 aa  ZER1_HUMAN RecName: Full=Protein zer-1 homolog;AltName: Full=Zyg-11
   67::746     6e-31  27%  779 aa  ZER1_MOUSE RecName: Full=Protein zer-1 homolog;AltName: Full=Zyg-11
  198::733     3e-30  28%  766 aa  ZER1_PONAB RecName: Full=Protein zer-1 homolog;AltName: Full=Zyg-11
  238::823     3e-26  28%  895 aa  ZER1_CAEEL RecName: Full=Zyg eleven-related protein 1;AltName:
  185::739     2e-25  25%  793 aa  ZER1_DROME RecName: Full=Protein zer-1 homolog;AltName: Full=Zyg-11
   30::591     7e-24  24%  633 aa  YR45_CAEEL RecName: Full=Uncharacterized protein F47D12.5;
  101::256     1e-06  31%  800 aa  INLA_LISMF RecName: Full=Internalin-A;Flags: Precursor;
  260::421     1e-06  33% 1173 aa  FLS2_ARATH RecName: Full=LRR receptor-like serine/threonine-protein
  349::560     2e-06  34%  843 aa  TLR4_HORSE RecName: Full=Toll-like receptor 4;AltName:
  401::552     6e-06  37%  841 aa  TLR4_BOVIN RecName: Full=Toll-like receptor 4;AltName:
   70::223     8e-06  34%  346 aa  PP1R7_XENTR RecName: Full=Protein phosphatase 1 regulatory subunit
  401::552     1e-05  33%  841 aa  TLR4_BOSTR RecName: Full=Toll-like receptor 4;AltName:
  155::256     2e-05  37%  800 aa  INLA_LISMO RecName: Full=Internalin-A;Flags: Precursor;
   59::258     7e-05  24%  713 aa  LRC4B_HUMAN RecName: Full=Leucine-rich repeat-containing protein
  398::459     7e-05  41% 1207 aa  BRI1_SOLLC RecName: Full=Brassinosteroid LRR receptor kinase;      
   23::187     2e-04  27%  395 aa  PCID2_DROME RecName: Full=PCI domain-containing protein 2 homolog; 
  892::984     2e-04  32% 1453 aa  LRRC9_HUMAN RecName: Full=Leucine-rich repeat-containing protein 9;
  400::504     3e-04  36%  833 aa  TLR4_FELCA RecName: Full=Toll-like receptor 4;AltName:
  398::459     3e-04  41% 1207 aa  BRI1_SOLPE RecName: Full=Systemin receptor SR160;       
  881::1025    6e-04  28% 1045 aa  CDC11_SCHPO RecName: Full=Septation initiation network scaffold
  468::550     8e-04  36%  835 aa  TLR4_MOUSE RecName: Full=Toll-like receptor 4;AltName:
   76::180     8e-04  32% 1456 aa  LRRC9_MOUSE RecName: Full=Leucine-rich repeat-containing protein 9;
  101::260     8e-04  24%  709 aa  LRC4B_MOUSE RecName: Full=Leucine-rich repeat-containing protein
    1::799

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDHNAALTTCSTSAIPRLARLATERIAELIENDALPEFDHKVIASCSNDIFEVLRQKKKLNHQTLQTMCS
ZYG11_CAEEL     MDHNAALTTCSTSAIPRLARLATERIAELIENDALPEFDHKVIASCSNDIFEVLRQKKKLNHQTLQTMCS
ZY11B_HUMAN     ----------------------------------------------------------------------
ZYG11_XENLA     ----------------------------------------------------------------------
ZY11B_MOUSE     ----------------------------------------------------------------------
ZYG11_DANRE     ----------------------------------------------------------------------
ZY11A_MOUSE     ----------------------------------------------------------------------
ZY11A_HUMAN     ----------------------------------------------------------------------
ZER1_HUMAN      ----------------------------------------------------------------------
ZER1_MOUSE      -------------------------------------------------------------HETFFSLFS
ZER1_PONAB      ----------------------------------------------------------------------
ZER1_CAEEL      ----------------------------------------------------------------------
ZER1_DROME      ----------------------------------------------------------------------
YR45_CAEEL      ----------------------------------------------------------------------
INLA_LISMF      ------------------------------------------------------------------TQIN
FLS2_ARATH      ----------------------------------------------------------------------
TLR4_HORSE      ----------------------------------------------------------------------
TLR4_BOVIN      ----------------------------------------------------------------------
PP1R7_XENTR     ----------------------------------------------------------------------
TLR4_BOSTR      ----------------------------------------------------------------------
INLA_LISMO      ----------------------------------------------------------------------
LRC4B_HUMAN     -----------------------------------------VACSCSNQASRVICTRRDLAEVPASIPVN
BRI1_SOLLC      ----------------------------------------------------------------------
PCID2_DROME     ----------------------------------------------------------------------
LRRC9_HUMAN     ----------------------------------------------------------------------
TLR4_FELCA      ----------------------------------------------------------------------
BRI1_SOLPE      ----------------------------------------------------------------------
CDC11_SCHPO     ----------------------------------------------------------------------
TLR4_MOUSE      ----------------------------------------------------------------------
LRRC9_MOUSE     ----------------------------------------------------------------------
LRC4B_MOUSE     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TSRFQINKIDLMGNKVELQDLELCSNQNLVSFRLGDIDYFPNTNKIQVADVLDTALNRTSRQQLRHLDLS
ZYG11_CAEEL     TSRFQINKIDLMGNKVELQDLELCSNQNLVSFRLGDIDYFPNTNKIQVADVLDTALNRTSRQQLRHLDLS
ZY11B_HUMAN     ----------------------------------------------------------------------
ZYG11_XENLA     ----------------------------------------------------------------------
ZY11B_MOUSE     ----------------------------------------------------------------------
ZYG11_DANRE     ----------------------------LCPHRLVELDASRVNADLTIADILGLSSNKSLQESLQRLVLN
ZY11A_MOUSE     ----------------------------------------------------------------------
ZY11A_HUMAN     --------------------------------------------------------NRWIQQNLQCLLLD
ZER1_HUMAN      ----------------------------------------------------------------------
ZER1_MOUSE      DPRSRLTRIHLREDLVQDQDLEAIRKQDLVEL------YLTNCEKLS-AKSLQTL--RSFRHSLVSLSLS
ZER1_PONAB      ----------------------------------------------------------------------
ZER1_CAEEL      ----------------------------------------------------------------------
ZER1_DROME      ----------------------------------------------------------------------
YR45_CAEEL      -------------------------------------------NTIDIFELLKAILNNETRRNLHYLDIK
INLA_LISMF      FSNNQLTDITPLKDLTKLVDILMNNNQ------IADITPLANLSNLTGLTLFNNQI--TDIDPLKNLTNL
FLS2_ARATH      -----------IGNCSSLVQLELYDNQGKIPAELGNLVQLQALRKNKLTSSIPSSLFRLT--QLTHLGLS
TLR4_HORSE      --------------------LELTSLKRLVFTSNKDMKSF-NEVKLPSLEFLDLSRNRLSFKRLKHLDLS
TLR4_BOVIN      ---------------------------------------------------------------LKHLDLS
PP1R7_XENTR     -NHFKIGKIQ--GFEVLKKVKTLCLRQNLIKL----IENLEQLVTLTELDLYDNQINLETLRDLQILDLS
TLR4_BOSTR      ---------------------------------------------------------------LKHLDLS
INLA_LISMO      ----------------------------------------------------------TDIDPLKNLTNL
LRC4B_HUMAN     TNGIQVIRTDTFKHLRHLEILQL--SKNLVKIEVGAFNGLPSLNTLELFDNRLTTVPTQAFEYLSKLELW
BRI1_SOLLC      ----------------------------------------------------------------------
PCID2_DROME     ----------------------------------------------------------------------
LRRC9_HUMAN     ------------------------------------------------------------------LNLD
TLR4_FELCA      --------------------------------------------------------------RLKHLDLS
BRI1_SOLPE      ----------------------------------------------------------------------
CDC11_SCHPO     ----------------------------------------------------------------------
TLR4_MOUSE      ----------------------------------------------------------------------
LRRC9_MOUSE     ----------------------------------------------------------------------
LRC4B_MOUSE     ----QVIRTDTFKHLRHLEILQL--SKNLVKIEVGAFNGLPSLNTLELFDNRLTTVPTQAFEYLSKLELW


                         +         .         .         .         .         *         .:210
query           GRHRITSNWPTYVARKLPRLESLAFANRSTANETLSQIGASLLNLRFLDISSTCVTDISCISSLRNLEVL
ZYG11_CAEEL     GRHRITSNWPTYVARKLPRLESLAFANRSTANETLSQIGASLLNLRFLDISSTCVTDISCISSLRNLEVL
ZY11B_HUMAN     ---------------RLSGLRALSITNVLFYNEDLAEV-ASLPRLESLDISNTSITDITALLACKDLKSL
ZYG11_XENLA     ---------------QLSGLRVLSITNVLFYNEDLADV-ASLPRLESLDISNTSVTDITALVACKDLKSL
ZY11B_MOUSE     ---------------RLSGLRALSITNVLFYNEDLAEV-ASLPRLESLDISNTSITDITALLACKDLKSL
ZYG11_DANRE     GLTMSSLEEPSRRCSAMQGLRALSVSNVDFYDWGLADV-CLLPRLESLDISNTSVSNLTPLLGLRSLRYL
ZY11A_MOUSE     -------------------LHTLSVANVSFCNEDLVSV-SQLPNLGSLDISNTLVTNISALLSCKNLRSL
ZY11A_HUMAN     STS-IPQNSRLLFFSQLTGLRILSVFNVCFHTEDLANV-SQLPRLESLDISNTLVTDISCKDRLKSLTMH
ZER1_HUMAN      -----------------------------------------LNSLAALDLSGIQTSDAAFLTQWKDLVSL
ZER1_MOUSE      GCANILVNPTCQVLVKDFTFEGLRFLNRMIDGIPVESLLRPLNSLAALDLSGIQTSDATFLTQWKDLMSL
ZER1_PONAB      -----------------------------------------LNSLAALDLSGIQTSDAAFLTQWKDLVSL
ZER1_CAEEL      ----ITARAPNVKRLFLPRCP----AKRTTIDEELTKILSPLQQLEVLDLSYWSKTDMRCLQPLSNLTCL
ZER1_DROME      ---------------------------------------AHLHDLGHLDLTSCVLANFSALGSLPNLHTL
YR45_CAEEL      GSHAFSKKWTKNIGTILPVLRSLIICGRHLQSDDFQQLCESIPNLTYLDISETNVPNISGISSLKNLESL
INLA_LISMF      NRLELSSNTISDISALLTSLQQLSFGNQVTDLKPL----ANLTTLERLDISSNKVSDISVLAKLTNLESL
FLS2_ARATH      ENHLVGP-----ISEEIGFLESLEVLTLHSNNFT-GEFPQSITNLRFNNISGELPADLGLLTNLRNLSA-
TLR4_HORSE      FNDVISSNF-----MGLEQLEHLDFQHSTLKQASDFPVFLSLKNLRYLDISNTRVVFHGIFDGLVSLQVL
TLR4_BOVIN      FNDVITSNF-----MGLEQLEHLDFQH-----STLKQINASLRNLRYLDISYTNIRIVGIFTGLVSLQTL
PP1R7_XENTR     FN----------LLRRIEGLESLSHLQRLLVNNKISRIEGTLTQLRLLELGSNRLRVIENLDSLRELDSL
TLR4_BOSTR      FNDVITSNF-----MGLEKLEHLDFQHSTLKQINAFSVFLSLRNLRYLDISYTNVRIVGIFTGLVSLKTL
INLA_LISMO      NRLELSSNTISDISALLTSLQQLSFGNQVTDLKPL----ANLTTLERLDISSNKVSDISVLAKLTNLESL
LRC4B_HUMAN     LRNNPIESIPSYAFNRVPSLRRLDLGELKRLEYISEAAFEGLVNLRYLNLGMCNLKDIPNLTALVRLEEL
BRI1_SOLLC      ---------------------------------------SNLLKLETLDMSSNNLTGVICKDPMNNLKVL
PCID2_DROME     ----------------------------------------------------------------------
LRRC9_HUMAN     GQH-------LFEITNLEKLENLKWASFSNNNLTKMEGLESCINLEELTLDGNCISKIEGISKMTKLTRL
TLR4_FELCA      FNNIITSNF-----LGLEQLEYLDFQHSSLKQVSDFSVFLPLKNLRYLDISHTQVAFHGIFNGLISLQIL
BRI1_SOLPE      ---------------------------------------SNLPKLETLDMSSNNLTGIICKDPMNNLKVL
CDC11_SCHPO     --------------------------------EVPKYIATSMPNLRVLDLSHNYISDIESLKPLQMIHRL
TLR4_MOUSE      ----------------LTSLNTLKMAGNSFKDNTLSNVFANTTNLTFLDLSKCQLEQISVFDTLHRLQLL
LRRC9_MOUSE     ------------------------------------------LQLKELWIAECCIEKIEGLQGCRNLEKL
LRC4B_MOUSE     LRNNPIESIPSYAFNRVPSLRRLDLGELKRLEYISEAAFEGLVNLRYLNLGMCNLKDIPNLTALVRLEEL


                         .         .         .         +         .         .         .:280
query           IMYNLNILKGDVTETLSNLTKLRVLDISRKVNTDYLQETSQDAHLDLALGIYNRSVEAIESGTATPWAEL
ZYG11_CAEEL     IMYNLNILKGDVTETLSNLTKLRVLDISRKVNTDYLQETSQDAHLDLALGIYNRSVEAIESGTATPWAEL
ZY11B_HUMAN     TMHHLKCLKMTTTQILDELKHLNHLDIS-----DDKQFTS-----DIALRL-------LEQKDILP--NL
ZYG11_XENLA     TMHHLKCLKMTTTEVIRELKKLNHLDMS-----DDKQFTS-----DIACRLLEQNDILLH---------L
ZY11B_MOUSE     TMHHLKCLKMTTTQILDELKHLNHLDIS-----DDKQFTS-----DIALRL-------LEQKDILP--NL
ZYG11_DANRE     TMHQLKRLEMTTAQLLAVLSQLEVLDIS-----DDKQFTSDVAR------------QLLETPGILP--QL
ZY11A_MOUSE     TMHYLKCLAMNSPQVLAVIRQLKCLDIS----------DHQQLRSDLAFYL-------LQQKDILP--NL
ZY11A_HUMAN     YLKCLAMTKSQILAVIRELKCLLHLDIS-----DHRQLKS-----DLAFHL-------LQQKDILP--NV
ZER1_HUMAN      VLYNMD-LSDDHIRVIVQLHKLRHLDISREVLSLFVQKLGNLMSLDISMILENCSISKMEEE-----AGQ
ZER1_MOUSE      VLYNMD-LSDDHIRVIVQLHKLR-----SKILTPHLISSHLDISRDRLSSYYKKLTRKVLSLLVQKLGNL
ZER1_PONAB      VLYNMD-LSDDHIRVIVQLHKLRHLDISREVLSLFVQKLGNLMSLDISMILENCSISKMEEE-----AGQ
ZER1_CAEEL      ILYDVPDLYHAVPN-ICHMTELRILDVSQS-NRDLIVSLKYLTHLDISST--NLATQPSSHDNPARYRES
ZER1_DROME      ILFNVWPIANQL-HAICCLRRLCTLDISIS--------SSGNGH-----GTYDLPDQTLEM-LMDNLRHL
YR45_CAEEL      IMRSVELECFEQFVDLFNLTGLRILDVSRSM---YKHDTK----------IINQYVQSNK-----VLKEL
INLA_LISMF      IATNNQISDITPLGILTNLDEL------------------------------------------------
FLS2_ARATH      ---HDNLLTGPIPSSISNCTGLKLLDLSHNQMT-------------------------------------
TLR4_HORSE      KMAGNSFKDNFLPNIFREMTNLTTLDLS-KCN---LEQVSQEAFCLLVLNMSHNNLLFLDMLPYKPLHSL
TLR4_BOVIN      KMAGNSFQNNLLPDIFTELTNLTVLDLSK----CQLEQVAQTAFHSLSLNMSHNKLLSLDTFLYEPLHSL
PP1R7_XENTR     FLGKNKITKLQNLETLTNLTVLSV----------------------------------------------
TLR4_BOSTR      KMAGNTFQDNLLPDIFTELTNLTVLDLSK----CQLEQVAQTAFHSLSLNMSHNKLLSLDTFLYEPLHLL
INLA_LISMO      IATNNQISDITPLGILTNLDEL------------------------------------------------
LRC4B_HUMAN     ELNRLDLIRPGSFQGLTSLRKL------------------------------------------------
BRI1_SOLLC      YLQN-NLFKGPIPDSLSNCSQLVSLDLS------------------------------------------
PCID2_DROME     ----------------------------------------------------------------------
LRRC9_HUMAN     SINN-NLLTGWEEHTFDNMLHLHSLSL-------------------------------------------
TLR4_FELCA      KMAGNSFQDNFLPNIFMELTNLTILDLS------------------------------------------
BRI1_SOLPE      YLQN-NLFKGPIPDSLSNCSQLVSLDLS------------------------------------------
CDC11_SCHPO     YLVGNRIKKRNLCDILANLKQLNVLDLRMNPLNFNIYPVIDDSIYELAASKYQQSINQRKEDPQKQWQEK
TLR4_MOUSE      NMSHNNLLFLD-SSHYNQLYSLSTLDCS------------------------------------------
LRRC9_MOUSE     YLYYNKISK---IENLEKLIKLEVLWLNHNMNIEGLQTLKNLKDLNLAGNLVSSIGRCLD-----PNEQL
LRC4B_MOUSE     ELNRLDLIRPGSFQGLTSLRKL------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RAIDMSGLSIVQFGTDRALAFVEKIIEAHPKLEQISLLATPLDSSLIEIPNRNLQVINTVSRRSIIFALS
ZYG11_CAEEL     RAIDMSGLSIVQFGTDRALAFVEKIIEAHPKLEQISLLATPLDSSLIEIPNRNLQVINTVSRRSIIFALS
ZY11B_HUMAN     VSLDVSGRKHV---TDKA---VEAFIQQRPSMQFVGLLATDAGYSEFLTGEGHLKVSGEANETQIAEALK
ZYG11_XENLA     VSLDISGRKHV---TDKA---VEAFIRHRPQMQFVGLLATEAGYSEFLSGEGCVKVSGEANQTQIAEALR
ZY11B_MOUSE     VSLDVSGRKHV---TDKA---VEAFIQQRPSMQFVGLLATDAGYSEFLMGKGHLKVSGEANETQIAEALR
ZYG11_DANRE     VSLDVSGRKQV---TDAA---VKAFVEARPGMTFVGLLATDAGFSEFLSGEGSLKVTGEANETQICEALR
ZY11A_MOUSE     TSLDISG------GTDVTDQAVESFLQHRPAMRFVGLLYTDAGYSDFFTAKQGLKVAGGANMSQISEALS
ZY11A_HUMAN     VSLDISGGNCI---TDEA---VELFIRLRPAMQFVGLLATDAGSSDFFTTKQGLRVAGGASMSQISEALS
ZER1_HUMAN      TSIEPSKSSIIPF---RALK---------RPLQFLGLFENSL-CRLTHIPA--YKVSGDKNEEQVLNAIE
ZER1_MOUSE      MSLDISGHMILQTSTEPSKSSIMPFRALKRPLQFLGLFETSL-CRLTHIPA--YKVSGDKNEEQVLNAIE
ZER1_PONAB      TSIEPSKSSIIPF---RALK---------RPLQFLGLFENSL-CRLTHIPA--YKVSGDKNEEQVLNAIE
ZER1_CAEEL      VRTDICGLSLVR------------------PLKYLGLFNCESASHVREIPAE--VVSGDANEDQVITSLQ
ZER1_DROME      THLDISGTNLAGNGVATKESTTTSGMQQSPKMEQFALTDIPGLASRTQRPLQALEVAGDANEQQILTAAR
YR45_CAEEL      RFLECS-------GTDINKNLLEQILNSHDNLQQVAAINCHIRSLSL---HHEVFXXXXXXXXXXXXXXX
INLA_LISMF      ----------------------------------------------------------------------
FLS2_ARATH      ----------------------------------------------------------------------
TLR4_HORSE      QILDCSFNRIVAF---------------------------------------------------------
TLR4_BOVIN      RILDCS----------------------------------------------------------------
PP1R7_XENTR     ----------------------------------------------------------------------
TLR4_BOSTR      RILDCS----------------------------------------------------------------
INLA_LISMO      ----------------------------------------------------------------------
LRC4B_HUMAN     ----------------------------------------------------------------------
BRI1_SOLLC      ----------------------------------------------------------------------
PCID2_DROME     ----------------------------------------------------------------------
LRRC9_HUMAN     ----------------------------------------------------------------------
TLR4_FELCA      ----------------------------------------------------------------------
BRI1_SOLPE      ----------------------------------------------------------------------
CDC11_SCHPO     ELAFSSTLS--EAWRTRRKMYAEAILLACPHLE-------------------------------------
TLR4_MOUSE      ----------------------------------------------------------------------
LRRC9_MOUSE     EKLNLSGNQITSF---------------------------------------------------------
LRC4B_MOUSE     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           HYANLDRPAFITHALHSVYYQLQSGYDKFSQEELKECLRLVCISMQQGLNTLPVQIAGSACLYHLCKMKR
ZYG11_CAEEL     HYANLDRPAFITHALHSVYYQLQSGYDKFSQEELKECLRLVCISMQQGLNTLPVQIAGSACLYHLCKMKR
ZY11B_HUMAN     RYS--ERAFFVREALFHLF-----SLTHVMEKTKPEILKLVVTGMRNHPMNLPVQLAASACVFNLTKQDL
ZYG11_XENLA     RYS--ERSFFVREALFHLF-SLTHVMDKANPEMLK----LVVIGMRNHPTNLPVQLAASACVFNLTKQDL
ZY11B_MOUSE     RYS--ERAFFVREALFHLF-----SLTHVMEKTKPDILKLVVTGMRNHPMNLPVQLAASACVFNLTKQDL
ZYG11_DANRE     RYS--EREGFVREALFHLFSLTHA-----IEKPRPDILKLVALGMKNHPTTLNVQLAASACVFNLTKQEL
ZY11A_MOUSE     RYRN--RSCFVKEALFRLFTETLS-----LRAVLPVMLKLVAIGMRNHPLDLPVQFTASACALNLTRQEL
ZY11A_HUMAN     RYRN--RSCFVKEALHRLFTET------FSMETMPAILKLVAIGMRNHPLDLRVQFTASACALNLTRQGL
ZER1_HUMAN      AYTE-HRPEITSRAINLLFDIAR--IERCNQ--LLRALKLVITALKCHKYDRNIQVTGSAALFYLTNSEY
ZER1_MOUSE      AYTE-HRPEITSRAINLLFDIAR--IERCNQ--LLRALKLVITALKCHKYDKNIQVTGSAALFYLTNSEY
ZER1_PONAB      AYTE-HRPEITSRAINLLFDIAR--IERCNQ--LLRALKLVITALKCHKYDRNIQVTGSAALFYLTNSEY
ZER1_CAEEL      MYK--DRAGLLQNVLNESYQLYRFGNSNPLTRHT-EALHLVLEAMHRHLADSTLQIAGSASLFYIIRKVD
ZER1_DROME      YYH--DRPVLLTRVLNDLYHLFRFENCK----DIHTALDVVLSAMDRHLKFKHMQISGSATLFYIVKGRD
YR45_CAEEL      XXXGVHRISSVERVLENMLHLFKYDPDLDNRFDFSECVKIIINSALKIESSLGIQGYGTLCLWHIAR-NQ
INLA_LISMF      ----------------------------------------------------------------------
FLS2_ARATH      ----------------------------------------------------------------------
TLR4_HORSE      ----------------------------------------------------------------------
TLR4_BOVIN      ----------------------------------------------------------------------
PP1R7_XENTR     ----------------------------------------------------------------------
TLR4_BOSTR      ----------------------------------------------------------------------
INLA_LISMO      ----------------------------------------------------------------------
LRC4B_HUMAN     ----------------------------------------------------------------------
BRI1_SOLLC      ----------------------------------------------------------------------
PCID2_DROME     ----------------------------------------------------------------------
LRRC9_HUMAN     ----------------------------------------------------------------------
TLR4_FELCA      ----------------------------------------------------------------------
BRI1_SOLPE      ----------------------------------------------------------------------
CDC11_SCHPO     ----------------------------------------------------------------------
TLR4_MOUSE      ----------------------------------------------------------------------
LRRC9_MOUSE     ----------------------------------------------------------------------
LRC4B_MOUSE     ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           IKRLSVKEVNNCIERSLDAAEQYRSMTQLQKNVWLTICNDYLLHLDEIDFYRTCKVALDTMLLNRDASVE
ZYG11_CAEEL     IKRLSVKEVNNCIERSLDAAEQYRSMTQLQKNVWLTICNDYLLHLDEIDFYRTCKVALDTMLLNRDASVE
ZY11B_HUMAN     AAGMPVRLLADVTHLLLKAMEHFPNHQQLQKNCLLSLCSDRILQDVPFNRFEAAKLVMQWLCNHEDQNMQ
ZYG11_XENLA     AAGMPVKLLADVTHLLLEAMKHFPNHQQLQKNCLLSLCSDRILQDVPFNRFDAAKLVMQWLCNHEDQNMQ
ZY11B_MOUSE     ALGMPVRLLADVTHLLLKAMEHFPNHQQLQKNCLLSLCSDRILQDVPFNRFEAAKLVMQWLCNHEDQNMQ
ZYG11_DANRE     AFGIPVRLLGNVTQQLLEAMKTFPNHQQLQKNCLLSLCSDRILQEVPFNRFEAAKLVMQWLCNHEDQNMQ
ZY11A_MOUSE     ARGMPVRLLAEITDLLFKATKNFPYYQQLQKNCLLSLTSSRILMDVPFDRFDAAKLALRWVCRRESPKLR
ZY11A_HUMAN     AKGMPVRLLSEVTCLLFKALKNFPHYQQLQKNCLLSLTNSRILVDVPFDRFDAAKFVMRWLCKHENPKMQ
ZER1_HUMAN      RSEQSVKLRRQVIQVVLNGMESYQEVT-VQRNCCLTLCNFSIPEELEFQYRRVNELLLSILNPTRDESIQ
ZER1_MOUSE      RSEQSVKLRRQVIQVVLNGMESYQEVT-VQRNCCLTLCNFSIPEELEFQYRRVNELLLGILSPTRDESIQ
ZER1_PONAB      RSEQSVKLRRQVIQVVLNGMESYQEVT-VQRNCCLTLCNFGIPEELEFQYRRVNELLLSILNPTRDESIQ
ZER1_CAEEL      MNRDTKRRVVSAL---LSGMEVHMEEQVMVRNCCLSLCQ-FEIPQDILFDYSRLAVLLVSVLQHHNA--D
ZER1_DROME      RSKFGALLRNHIIRTLLNGMEMHITDDTMLRNGYLTLTQFHMPVDVLFEYERLIKILLHGVSTEQEGFVQ
YR45_CAEEL      DARFQPFDLYQLVCKLLDGGRLFIATKDFNISLWRTIXXXXXXXXXPMSYERVCRIA--GLCISRNEVDD
INLA_LISMF      ----------------------------------------------------------------------
FLS2_ARATH      ----------------------------------------------------------------------
TLR4_HORSE      ----------------------------------------------------------------------
TLR4_BOVIN      ----------------------------------------------------------------------
PP1R7_XENTR     ----------------------------------------------------------------------
TLR4_BOSTR      ----------------------------------------------------------------------
INLA_LISMO      ----------------------------------------------------------------------
LRC4B_HUMAN     ----------------------------------------------------------------------
BRI1_SOLLC      ----------------------------------------------------------------------
PCID2_DROME     --------------------------------------------------------SLATYLSLRDVHVQ
LRRC9_HUMAN     ----------------------------------------------------------------------
TLR4_FELCA      ----------------------------------------------------------------------
BRI1_SOLPE      ----------------------------------------------------------------------
CDC11_SCHPO     ----------------------------------------------------------------------
TLR4_MOUSE      ----------------------------------------------------------------------
LRRC9_MOUSE     ----------------------------------------------------------------------
LRC4B_MOUSE     ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           RMTIAIVSIVTPKMRPSEAKILTTETKYVYHLVKIMNDYLEAYTREHRVGHERDNENALYTLKFTLSALW
ZYG11_CAEEL     RMTIAIVSIVTPKMRPSEAKILTTETKYVYHLVKIMNDYLEAYTREHRVGHERDNENALYTLKFTLSALW
ZY11B_HUMAN     RMAVAIISILAAKLSTEQTAQLGTELFIVRQLLQIVK--------------QKTNQNSVTTLKFTLSALW
ZYG11_XENLA     RMAVAIISILAAKLSTEQTAQLGAELFIVRQLLQIVR--------------QKTSQNMVTTLKFTLSALW
ZY11B_MOUSE     RMAVAIISILAAKLSTEQTAQLGAELFIVRQLLQIVK--------------QKTNQNSVTTLKFTLSALW
ZYG11_DANRE     RMAVAIISILAAKLSTEQTAQLGAELFIVKQLL-------------HIVRQKTCQSTVDATLKFTLSALW
ZY11A_MOUSE     TMAVSITSILALKLSPEEMGQLQEE------LIMAIKELLTII--RQKLAENLDD----VTFLFTLKALW
ZY11A_HUMAN     TMAVSVTSILALQLSPEQ----TAQLEELFMAVKELLAIVKQKTTENLDD---------VTFLFTLKALW
ZER1_HUMAN      RIAVHLCNALVCQV-DNDHKEAVGKMGFVVTMLKLIQKKLLDKTCDQ-------------VMEFSWSALW
ZER1_MOUSE      RIAVHLCNALVCQV-DNDHKEAVGKMGFVVTMLKLIQKKLLDKTCDQ-------------VMEFSWSALW
ZER1_PONAB      RIAVHLCNAL---------------------VCQVDNDHKEAVTMXXXXXXXXXXXXCDQVMEFSWSALW
ZER1_CAEEL      NLTQRIVVFLLNSM----ACHVEGDQKVQVGSYGAIEMILDQIARKHTANVCDD------VMEVGWSFLW
ZER1_DROME      RIAIYLLNTLACQV-DGRQKLFLGELGVVSTMFTLIKDRLTRSVFDD-------------VMEVAWSTMW
YR45_CAEEL      EMKTRAIPIFATYIK----RISSQSVYYIDFNHKLMPKIILHLKKSIEL-------RKTYWITFCLDILT
INLA_LISMF      ----------------------------------------------------------------------
FLS2_ARATH      ----------------------------------------------------------------------
TLR4_HORSE      ----------------------------------------------------------------------
TLR4_BOVIN      ----------------------------------------------------------------------
PP1R7_XENTR     ----------------------------------------------------------------------
TLR4_BOSTR      ----------------------------------------------------------------------
INLA_LISMO      ----------------------------------------------------------------------
LRC4B_HUMAN     ----------------------------------------------------------------------
BRI1_SOLLC      ----------------------------------------------------------------------
PCID2_DROME     NHNLYIAQLVDRFLKPPLDEVVSAHLKVLYHLAQEPPGYMEAYTQQSRLLQQLKDENWCLPLMYRVCLLR
LRRC9_HUMAN     ----------------------------------------------------------------------
TLR4_FELCA      ----------------------------------------------------------------------
BRI1_SOLPE      ----------------------------------------------------------------------
CDC11_SCHPO     ----------------------------------------------------------------------
TLR4_MOUSE      ----------------------------------------------------------------------
LRRC9_MOUSE     ----------------------------------------------------------------------
LRC4B_MOUSE     ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           NLTDECPATCKAFLDAGGVQIAFRILKAFDYHGNVQTKVLGILNNLAEVEELHLGQLCKNEYISVLISCL
ZYG11_CAEEL     NLTDECPATCKAFLDAGGVQIAFRILKAFDYHGNVQTKVLGILNNLAEVEELHLGQLCKNEYISVLISCL
ZY11B_HUMAN     NLTDESPTTCRHFIENQGLELFMRVLESFPTESSIQQKVLGLLNNIAEVQELH-SELMWKDFI-------
ZYG11_XENLA     NLTDESPTTCRHFIENQGLELFMKVLETFPSESSIQQKVLGLLNNIAEVKELHTELMCKDDQISKLLHSV
ZY11B_MOUSE     NLTDESPTTCRHFIENQGLELFMRVLESFPTESSIQQKVLGLLNNIAEVQELH-SELMWKDFI-------
ZYG11_DANRE     NLTDESPTTCRHFIENQGLELFIKVLESFPSESSIQQKVLGLLNNIAEVSELH-GELMVQSFLDHIRTLL
ZY11A_MOUSE     NLTDECPLACKYFMENEGLATVIRVLETFSI-SVIQSKVLGLLNNVAEVRELS-SKLVTEDVIERIISLL
ZY11A_HUMAN     NLTDGSPAACKHFIENQGLQIFIQVLETFS-ESAIQSKVLGLLNNIAEVRELS----------SKLVT--
ZER1_HUMAN      NITDETPDNCEMFLNFNGMKLFLDCLKEFPEKQELHRNMLGLLGNVAEVKELR-PQLMTSQFISVFSNLL
ZER1_MOUSE      NITDETPDNCEMFLNFNGMKLFLDCLKEFPEKQELHRNMLGLLGNVAEVKELR-PQLMTSQFISVFSNLL
ZER1_PONAB      NITDETPDNCEMFLNFNGMKLFLDCLKEFPEKQELHRNMLGLLGNVAEVKELR-PQLMTSQFISVFSNLL
ZER1_CAEEL      NITDETPVNCELFLNANGLDLFQKCYEAFKTERELVRNMMGLIGNIAEVDELR-SQLMKDDYVKIFCALL
ZER1_DROME      NVTDETAINCKRFLDGRGMEYFLKCLHTFPDRDELLRNMMGLLGNVAEVKWLR-PKLMTQEFIEVFARLL
YR45_CAEEL      QITQNSADACEKLAECEEMNVLLNLTKASD-HXXXXXXXXXXXXXXTDKNVKHVA-------IDARISVL
INLA_LISMF      ----------------------------------------------------------------------
FLS2_ARATH      ----------------------------------------------------------------------
TLR4_HORSE      ----------------------------------------------------------------------
TLR4_BOVIN      ----------------------------------------------------------------------
PP1R7_XENTR     ----------------------------------------------------------------------
TLR4_BOSTR      ----------------------------------------------------------------------
INLA_LISMO      ----------------------------------------------------------------------
LRC4B_HUMAN     ----------------------------------------------------------------------
BRI1_SOLLC      ----------------------------------------------------------------------
PCID2_DROME     YLAQACEKHCQGFTPADCIMACFRVCAADGRASEEDTKRLGMMNLVNQLFKIYFRHLCK-----------
LRRC9_HUMAN     ----------------------------------------------------------------------
TLR4_FELCA      ----------------------------------------------------------------------
BRI1_SOLPE      ----------------------------------------------------------------------
CDC11_SCHPO     ----------------------------------------------------------------------
TLR4_MOUSE      ----------------------------------------------------------------------
LRRC9_MOUSE     ----------------------------------------------------------------------
LRC4B_MOUSE     ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           DGSFNEVDSKGRYREVERSYFAAGILANLLTNTDGWESENQRDEACEKLLELIEQYPTLPSAMVSYKSFI
ZYG11_CAEEL     DGSFNEVDSKGRYREVERSYFAAGILANLLTNTDGWESENQRDEACEKLLELIEQYPTLPSAMVSYKSFI
ZY11B_HUMAN     ----DHIXXXXXXXXXXXXYFAAGIIAHLISRGEAWTSRSQRNSLLDDLHSAILKWPTPECEMVAYRSFN
ZYG11_XENLA     --------------EVEVSYFAAGIIAHLVSGEETWTSSSMRETLLEQLHSAILSWPTPECEMVAYRSFN
ZY11B_MOUSE     ----DHIXXXXXXXXXXXXYFAAGIIAHLISRGEAWTSRSQRNSLLDDLHSAILKWPTPECEMVAYRSFN
ZYG11_DANRE     HSP-----------EVEVSYFAAGILAHLTSRGEKWTLETLRNTLLQQLHSAILKWPTPECEMVAYRSFN
ZY11A_MOUSE     HSS-----------NLEVSFLAAGVLAHLTCDRQHWLSRDQRTDLLRYLHLAIQNWPSSMSVLVTYRSFK
ZY11A_HUMAN     EDVLKHINSLLCSREMEVSYFAAGIIAHLTSDRQLWISRDQRRTLLQDLHATIQNWPSSSTALVTYRSFK
ZER1_HUMAN      ESKAD---------GIEVSYNACGVLSHIMDGPEAWVCEPQREEVEERMWAAIQSWDINSRRNINYRSFE
ZER1_MOUSE      ESKAD---------GIEVSYNACGVLSHIMDGPEAWVCEPQRAEVEDRMWAAIQSWDINSRRNINYRSFE
ZER1_PONAB      ESKAD---------GIEVSYNACGVLSHIMDGPEAWVCEPQREEVEERMWAAIQSWDINSRRNINYRSFE
ZER1_CAEEL      ---------XXXXXXXXXXYNSAGVLAHMV--SDGEEVWKQRNEVMQRIVEATSSWKLATRRFINYRSFR
ZER1_DROME      DSXXXXXXXNHAYLRFQVSYNAAGVLAHIASDADAWTIKTSREHVLERMVAAIQRWNIKSERNINYRSFE
YR45_CAEEL      QERLDEWDD-------ERAYYVFTVLALIISNFPNREPANSLIRECFPEISNVIKIPVSDSKIYVKNGIL
INLA_LISMF      ----------------------------------------------------------------------
FLS2_ARATH      ----------------------------------------------------------------------
TLR4_HORSE      ----------------------------------------------------------------------
TLR4_BOVIN      ----------------------------------------------------------------------
PP1R7_XENTR     ----------------------------------------------------------------------
TLR4_BOSTR      ----------------------------------------------------------------------
INLA_LISMO      ----------------------------------------------------------------------
LRC4B_HUMAN     ----------------------------------------------------------------------
BRI1_SOLLC      ----------------------------------------------------------------------
PCID2_DROME     ----------------------------------------------------------------------
LRRC9_HUMAN     ----------------------------------------------------------------------
TLR4_FELCA      ----------------------------------------------------------------------
BRI1_SOLPE      ----------------------------------------------------------------------
CDC11_SCHPO     ----------------------------------------------------------------------
TLR4_MOUSE      ----------------------------------------------------------------------
LRRC9_MOUSE     ----------------------------------------------------------------------
LRC4B_MOUSE     ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           PFSRIVRESNSNGAIMWCLWGVHHVLQHREKNKAPTYEKGYIEMFMDSGLSPIVEDMSHGHSKHIHNLDI
ZYG11_CAEEL     PFSRIVRESNSNGAIMWCLWGVHHVLQHREKNKAPTYEKGYIEMFMDSGLSPIVEDMSHGHSKHIHNLDI
ZY11B_HUMAN     PFFPLLGCFTTPGVQLWAVWAMQHVC-----SKNPS---RYCSMLIEGGLQHLYNIKDHEHT------DP
ZYG11_XENLA     PFFPLLACFRTPGVQLWAVWAMQHV---------------------------------------------
ZY11B_MOUSE     PFFPLLGCFTTPGVQLWAVWAMQHV---------------------------------------------
ZYG11_DANRE     PFFPLLECFQTPGVQLWAAWAMQHV---------------------------------------------
ZY11A_MOUSE     AFSPLLVNFSQPEVQRWALWAIHHVCSKNPRPK-------------------------------------
ZY11A_HUMAN     TFFPLLGNFSQPEVQLWALWAMYHV---------------------------------------------
ZER1_HUMAN      PILRLLPQGISPVSQHWATWALY--------NLVSVYPDKYCPLLIKEGGMPLLRDI-------------
ZER1_MOUSE      PILRLLPQGISPVSQHWATWALY--------NLVSVYPDKYCPLLIKEGGMPLLRDL-------------
ZER1_PONAB      PILRLLPQGISPVSQHWATWALY--------NLVSVYPDKYCPLLIKEGGMPLLRDI-------------
ZER1_CAEEL      PILRLLPLYHAYASQHWAVWAL--------ANLTTTDGEKYCAYVRDEGGVPLLEELV---SNAITTTDI
ZER1_DROME      PILSLVRCYETPQCQHWAVWALANLTQ-------------------------------------------
YR45_CAEEL      --KKILKDSREDGSLLWAL---------------------------------------------------
INLA_LISMF      ----------------------------------------------------------------------
FLS2_ARATH      ----------------------------------------------------------------------
TLR4_HORSE      ----------------------------------------------------------------------
TLR4_BOVIN      ----------------------------------------------------------------------
PP1R7_XENTR     ----------------------------------------------------------------------
TLR4_BOSTR      ----------------------------------------------------------------------
INLA_LISMO      ----------------------------------------------------------------------
LRC4B_HUMAN     ----------------------------------------------------------------------
BRI1_SOLLC      ----------------------------------------------------------------------
PCID2_DROME     ----------------------------------------------------------------------
LRRC9_HUMAN     ----------------------------------------------------------------------
TLR4_FELCA      ----------------------------------------------------------------------
BRI1_SOLPE      ----------------------------------------------------------------------
CDC11_SCHPO     ----------------------------------------------------------------------
TLR4_MOUSE      ----------------------------------------------------------------------
LRRC9_MOUSE     ----------------------------------------------------------------------
LRC4B_MOUSE     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           RVVHLAREIIDIVSCHxxxxxxxxxxxxx
ZYG11_CAEEL     RVVHLAREIIDIVSCH-------------
ZY11B_HUMAN     HVQQIAVAILDSLEKH-------------
ZYG11_XENLA     -----------------------------
ZY11B_MOUSE     -----------------------------
ZYG11_DANRE     -----------------------------
ZY11A_MOUSE     -----------------------------
ZY11A_HUMAN     -----------------------------
ZER1_HUMAN      -----------------------------
ZER1_MOUSE      -----------------------------
ZER1_PONAB      -----------------------------
ZER1_CAEEL      RTL--------------------------
ZER1_DROME      -----------------------------
YR45_CAEEL      -----------------------------
INLA_LISMF      -----------------------------
FLS2_ARATH      -----------------------------
TLR4_HORSE      -----------------------------
TLR4_BOVIN      -----------------------------
PP1R7_XENTR     -----------------------------
TLR4_BOSTR      -----------------------------
INLA_LISMO      -----------------------------
LRC4B_HUMAN     -----------------------------
BRI1_SOLLC      -----------------------------
PCID2_DROME     -----------------------------
LRRC9_HUMAN     -----------------------------
TLR4_FELCA      -----------------------------
BRI1_SOLPE      -----------------------------
CDC11_SCHPO     -----------------------------
TLR4_MOUSE      -----------------------------
LRRC9_MOUSE     -----------------------------
LRC4B_MOUSE     -----------------------------