[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cele0:CAA87773.1

[Show Plain Result]


## Summary of Sequence Search
    1::294
    1::294     e-169 100%  294 aa  EIF3F_CAEEL RecName: Full=Eukaryotic translation initiation factor
   96::360     2e-46  39%  361 aa  EIF3F_MOUSE RecName: Full=Eukaryotic translation initiation factor
   96::360     4e-46  38%  361 aa  EIF3F_PANTR RecName: Full=Eukaryotic translation initiation factor
   96::360     4e-46  38%  361 aa  EIF3F_MACFA RecName: Full=Eukaryotic translation initiation factor
   92::356     4e-46  38%  357 aa  EIF3F_HUMAN RecName: Full=Eukaryotic translation initiation factor
    9::281     2e-41  36%  287 aa  EIF3F_AEDAE RecName: Full=Eukaryotic translation initiation factor
    9::281     7e-40  35%  287 aa  EIF3F_CULQU RecName: Full=Eukaryotic translation initiation factor
    3::274     9e-40  37%  280 aa  EI3F1_DROVI RecName: Full=Eukaryotic translation initiation factor
    3::274     2e-39  37%  280 aa  EI3F1_DROGR RecName: Full=Eukaryotic translation initiation factor
    3::274     3e-39  37%  280 aa  EI3F1_DROWI RecName: Full=Eukaryotic translation initiation factor
    3::274     3e-39  37%  280 aa  EI3F1_DROPS RecName: Full=Eukaryotic translation initiation factor
    3::274     3e-39  37%  280 aa  EI3F1_DROPE RecName: Full=Eukaryotic translation initiation factor
    3::274     5e-39  37%  280 aa  EI3F1_DROYA RecName: Full=Eukaryotic translation initiation factor
    3::274     5e-39  37%  280 aa  EI3F1_DROSI RecName: Full=Eukaryotic translation initiation factor
    3::274     5e-39  37%  280 aa  EI3F1_DROSE RecName: Full=Eukaryotic translation initiation factor
    3::274     5e-39  37%  280 aa  EI3F1_DROME RecName: Full=Eukaryotic translation initiation factor
    3::274     5e-39  37%  280 aa  EI3F1_DROER RecName: Full=Eukaryotic translation initiation factor
    5::274     8e-39  36%  280 aa  EI3F1_DROMO RecName: Full=Eukaryotic translation initiation factor
    3::274     3e-38  36%  280 aa  EI3F1_DROAN RecName: Full=Eukaryotic translation initiation factor
    9::281     2e-37  35%  287 aa  EIF3F_ANOGA RecName: Full=Eukaryotic translation initiation factor
   32::297     5e-33  34%  301 aa  EIF3F_USTMA RecName: Full=Eukaryotic translation initiation factor
   11::279     9e-30  31%  285 aa  EI3F2_DROME RecName: Full=Eukaryotic translation initiation factor
   28::303     2e-29  28%  342 aa  EIF3F_PHANO RecName: Full=Eukaryotic translation initiation factor
   11::279     2e-29  33%  285 aa  EI3F2_DROER RecName: Full=Eukaryotic translation initiation factor
   28::303     3e-29  28%  375 aa  EIF3F_ASPNC RecName: Full=Eukaryotic translation initiation factor
   28::303     4e-29  28%  345 aa  EIF3F_ASPOR RecName: Full=Eukaryotic translation initiation factor
   28::303     7e-29  28%  348 aa  EIF3F_COCIM RecName: Full=Eukaryotic translation initiation factor
   28::303     1e-28  27%  345 aa  EIF3F_ASPCL RecName: Full=Eukaryotic translation initiation factor
   28::303     1e-28  27%  345 aa  EIF3F_NEOFI RecName: Full=Eukaryotic translation initiation factor
   28::303     1e-28  27%  345 aa  EIF3F_ASPFU RecName: Full=Eukaryotic translation initiation factor
   28::303     1e-28  27%  345 aa  EIF3F_ASPFC RecName: Full=Eukaryotic translation initiation factor
    1::279     2e-28  30%  285 aa  EI3F2_DROSE RecName: Full=Eukaryotic translation initiation factor
   20::292     6e-28  31%  294 aa  EIF3F_YARLI RecName: Full=Eukaryotic translation initiation factor
   11::279     1e-27  32%  285 aa  EI3F2_DROYA RecName: Full=Eukaryotic translation initiation factor
    9::278     3e-27  29%  284 aa  EIF3F_DICDI RecName: Full=Eukaryotic translation initiation factor
    1::279     7e-27  30%  285 aa  EI3F2_DROSI RecName: Full=Eukaryotic translation initiation factor
   18::298     9e-27  27%  302 aa  EIF3F_SCHPO RecName: Full=Eukaryotic translation initiation factor
   11::279     5e-26  30%  285 aa  EI3F2_DROAN RecName: Full=Eukaryotic translation initiation factor
    1::271     1e-25  27%  289 aa  EIF3F_BOMMO RecName: Full=Eukaryotic translation initiation factor
   33::297     4e-25  30%  300 aa  EIF3F_MALGO RecName: Full=Eukaryotic translation initiation factor
   12::282     4e-25  29%  288 aa  EI3F2_DROPS RecName: Full=Eukaryotic translation initiation factor
   28::303     7e-25  26%  345 aa  EIF3F_ASPTN RecName: Full=Eukaryotic translation initiation factor
   12::282     1e-24  30%  288 aa  EI3F2_DROPE RecName: Full=Eukaryotic translation initiation factor
   29::308     2e-23  27%  370 aa  EIF3F_MAGGR RecName: Full=Eukaryotic translation initiation factor
   13::282     6e-23  29%  286 aa  EI3F2_DROWI RecName: Full=Eukaryotic translation initiation factor
   30::289     7e-21  28%  293 aa  EIF3F_ARATH RecName: Full=Eukaryotic translation initiation factor
   28::306     1e-20  26%  357 aa  EIF3F_CHAGB RecName: Full=Eukaryotic translation initiation factor
   29::307     3e-20  25%  369 aa  EIF3F_NEUCR RecName: Full=Eukaryotic translation initiation factor
   27::293     5e-20  27%  303 aa  EIF3F_CRYNE RecName: Full=Eukaryotic translation initiation factor
   12::284     2e-16  26%  290 aa  EI3F2_DROVI RecName: Full=Eukaryotic translation initiation factor
   12::284     6e-16  25%  290 aa  EI3F2_DROMO RecName: Full=Eukaryotic translation initiation factor
   10::276     2e-15  27%  325 aa  PSD7_DICDI RecName: Full=26S proteasome non-ATPase regulatory
   12::284     1e-14  24%  290 aa  EI3F2_DROGR RecName: Full=Eukaryotic translation initiation factor
   17::181     1e-12  28%  308 aa  PSD7_ARATH RecName: Full=Probable 26S proteasome non-ATPase
   11::276     6e-12  27%  338 aa  PSD7_DROME RecName: Full=26S proteasome non-ATPase regulatory
   23::292     1e-11  25%  309 aa  CSN6_DICDI RecName: Full=COP9 signalosome complex subunit 6;       
   17::145     1e-09  33%  324 aa  RPN8_SCHPO RecName: Full=26S proteasome regulatory subunit rpn8;
    8::104     2e-09  34%  326 aa  RPN8_ASHGO RecName: Full=26S proteasome regulatory subunit RPN8;
   32::273     5e-09  25%  321 aa  PSD7_MOUSE RecName: Full=26S proteasome non-ATPase regulatory
   32::273     9e-09  25%  324 aa  PSD7_HUMAN RecName: Full=26S proteasome non-ATPase regulatory
    8::110     1e-08  28%  329 aa  RPN8_CANGA RecName: Full=26S proteasome regulatory subunit RPN8;
   32::273     1e-08  25%  322 aa  PSD7_BOVIN RecName: Full=26S proteasome non-ATPase regulatory
    8::110     2e-08  28%  338 aa  RPN8_YEAST RecName: Full=26S proteasome regulatory subunit RPN8;
   29::122     2e-07  27%  352 aa  RPN8_NEUCR RecName: Full=26S proteasome regulatory subunit rpn-8;
   44::103     1e-06  38%  332 aa  EIF3H_NEMVE RecName: Full=Eukaryotic translation initiation factor
    6::158     1e-06  32%  317 aa  CSN6B_ARATH RecName: Full=COP9 signalosome complex subunit 6b;     
   26::289     4e-06  23%  318 aa  CSN6_XENLA RecName: Full=COP9 signalosome complex subunit 6;       
   49::317     4e-06  20%  341 aa  CSN6_DROME RecName: Full=COP9 signalosome complex subunit 6;       
   49::108     2e-05  29%  337 aa  EIF3H_ARATH RecName: Full=Eukaryotic translation initiation factor
   38::127     3e-05  26%  337 aa  EIF3H_DROGR RecName: Full=Eukaryotic translation initiation factor
   41::127     3e-05  25%  337 aa  EIF3H_BOMMO RecName: Full=Eukaryotic translation initiation factor
   39::128     4e-05  25%  338 aa  EIF3H_DROYA RecName: Full=Eukaryotic translation initiation factor
   38::127     4e-05  25%  337 aa  EIF3H_DROVI RecName: Full=Eukaryotic translation initiation factor
   39::128     4e-05  25%  338 aa  EIF3H_DROSE RecName: Full=Eukaryotic translation initiation factor
   38::127     4e-05  25%  337 aa  EIF3H_DROPS RecName: Full=Eukaryotic translation initiation factor
   38::127     4e-05  25%  337 aa  EIF3H_DROMO RecName: Full=Eukaryotic translation initiation factor
   39::128     4e-05  25%  338 aa  EIF3H_DROME RecName: Full=Eukaryotic translation initiation factor
   38::127     4e-05  25%  337 aa  EIF3H_DROAN RecName: Full=Eukaryotic translation initiation factor
   27::290     4e-05  21%  319 aa  CSN6_XENTR RecName: Full=COP9 signalosome complex subunit 6;       
   38::127     6e-05  25%  337 aa  EIF3H_DROWI RecName: Full=Eukaryotic translation initiation factor
   41::128     6e-05  26%  336 aa  EIF3H_CULQU RecName: Full=Eukaryotic translation initiation factor
   43::126     6e-05  27%  334 aa  EIF3H_ANOGA RecName: Full=Eukaryotic translation initiation factor
   41::128     6e-05  26%  336 aa  EIF3H_AEDAE RecName: Full=Eukaryotic translation initiation factor
   39::128     8e-05  25%  338 aa  EIF3H_DROER RecName: Full=Eukaryotic translation initiation factor
   50::108     1e-04  32%  306 aa  RPN11_CANGA RecName: Full=26S proteasome regulatory subunit RPN11;
   55::113     1e-04  32%  311 aa  RPN11_ASHGO RecName: Full=26S proteasome regulatory subunit RPN11;
   59::106     1e-04  34%  335 aa  EI3HA_DANRE RecName: Full=Eukaryotic translation initiation factor
   65::133     1e-04  29%  335 aa  CSN5_EMENI RecName: Full=COP9 signalosome complex subunit 5;       
   30::140     2e-04  30%  347 aa  EIF3H_YARLI RecName: Full=Eukaryotic translation initiation factor
   50::108     2e-04  32%  306 aa  RPN11_YEAST RecName: Full=26S proteasome regulatory subunit
   59::106     3e-04  32%  335 aa  EIF3H_XENTR RecName: Full=Eukaryotic translation initiation factor
   58::105     3e-04  32%  334 aa  EIF3H_XENLA RecName: Full=Eukaryotic translation initiation factor
   72::143     3e-04  31%  348 aa  EIF3H_TAEGU RecName: Full=Eukaryotic translation initiation factor
   76::147     3e-04  31%  352 aa  EIF3H_RAT RecName: Full=Eukaryotic translation initiation factor 3
   76::147     3e-04  31%  352 aa  EIF3H_MOUSE RecName: Full=Eukaryotic translation initiation factor
   76::147     3e-04  31%  352 aa  EIF3H_HUMAN RecName: Full=Eukaryotic translation initiation factor
   72::143     3e-04  31%  348 aa  EIF3H_CHICK RecName: Full=Eukaryotic translation initiation factor
   76::147     3e-04  31%  352 aa  EIF3H_BOVIN RecName: Full=Eukaryotic translation initiation factor
   36::147     3e-04  21%  328 aa  CSN6_PONAB RecName: Full=COP9 signalosome complex subunit 6;       
   31::142     3e-04  24%  323 aa  CSN6_PIG RecName: Full=COP9 signalosome complex subunit 6;       
   32::143     3e-04  24%  324 aa  CSN6_MOUSE RecName: Full=COP9 signalosome complex subunit 6;       
   35::146     3e-04  21%  327 aa  CSN6_HUMAN RecName: Full=COP9 signalosome complex subunit 6;       
   52::110     5e-04  33%  308 aa  PSDE_DROME RecName: Full=26S proteasome non-ATPase regulatory
   68::115     5e-04  32%  344 aa  EIF3H_SALSA RecName: Full=Eukaryotic translation initiation factor
   32::143     5e-04  24%  324 aa  CSN6_BOVIN RecName: Full=COP9 signalosome complex subunit 6;       
   53::111     6e-04  32%  308 aa  PSDE_ARATH RecName: Full=26S proteasome non-ATPase regulatory
    1::294

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MASNLTVNVHPGVYMNVVDTHMRRTKSSAKNTGQEKCMGTLMGYYEKGSIQVTNCFAIPFNESNDDLEID
EIF3F_CAEEL     MASNLTVNVHPGVYMNVVDTHMRRTKSSAKNTGQEKCMGTLMGYYEKGSIQVTNCFAIPFNESNDDLEID
EIF3F_MOUSE     ------VRLHPVILASIVDSYERR------NEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVD
EIF3F_PANTR     ------VRLHPVILASIVDSYERR------NEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVD
EIF3F_MACFA     ------VRLHPVILASIVDSYERR------NEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVD
EIF3F_HUMAN     ------VRLHPVILASIVDSYERR------NEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVD
EIF3F_AEDAE     ---NLTVRVHPVVLFQIVDAYERR------NADSERVIGTLLGSVDKGVVEVTNCFCVPHKEHADQVEAE
EIF3F_CULQU     ---NLTVRVHPVVLFQIVDAYERR------NADSERVIGTLLGSVEKGIVEVTNCFCVPHKEHADQVEAE
EI3F1_DROVI     -ALNLTVRVHPVVLFQVVDAFERR------NADSHRVIGTLLGSVDKGVVEVTNCFCVPHKEHDDQVEAE
EI3F1_DROGR     -ALNLTVRVHPVVLFQVVDAFERR------NADSHRVIGTLLGSVDKGVVEVTNCFCVPHKEHDDQVEAE
EI3F1_DROWI     -ALNLTVRVHPVVLFQVVDAFERR------NADSHRVIGTLLGSVDKGVVEVTNCFCVPHKEHDDQVEAE
EI3F1_DROPS     -ALNLTVRVHPVVLFQVVDAFERR------NAESHRVIGTLLGSVEKGVVEVTNCFCVPHKEHDDQVEAE
EI3F1_DROPE     -ALNLTVRVHPVVLFQVVDAFERR------NAESHRVIGTLLGSVEKGVVEVTNCFCVPHKEHDDQVEAE
EI3F1_DROYA     -ALNLTVRVHPVVLFQVVDAFERR------NADSHRVIGTLLGSVDKGVVEVTNCFCVPHKEHDDQVEAE
EI3F1_DROSI     -ALNLTVRVHPVVLFQVVDAFERR------NADSHRVIGTLLGSVDKGVVEVTNCFCVPHKEHDDQVEAE
EI3F1_DROSE     -ALNLTVRVHPVVLFQVVDAFERR------NADSHRVIGTLLGSVDKGVVEVTNCFCVPHKEHDDQVEAE
EI3F1_DROME     -ALNLTVRVHPVVLFQVVDAFERR------NADSHRVIGTLLGSVDKGVVEVTNCFCVPHKEHDDQVEAE
EI3F1_DROER     -ALNLTVRVHPVVLFQVVDAFERR------NADSHRVIGTLLGSVDKGVVEVTNCFCVPHKEHDDQVEAE
EI3F1_DROMO     ---NLTVRVHPVVLFQVVDAFERR------NADSHRVIGTLLGSVDKGVVEVTNCFCVPHKEHDDQVEAE
EI3F1_DROAN     -ALNLTVRVHPVVLFQVVDAYERR------NADSHRVIGTLLGSVDKGVVEVTNCFCVPHKEHDDQVEAE
EIF3F_ANOGA     ---NLTVRVHPVVLFQIVDAYERR------NADSERVIGTLLGSVDKGVVEVTNCFCLPHKEHTDQVEAE
EIF3F_USTMA     ------VHVHPVALFSILDHYLRR------NDGQHRVIGTLLGTRTESEIEIKNCFAVPHLEDAEEVQVD
EI3F2_DROME     ------VYLKPLVFFQIIDAYDRRPK------GDNQVMGTLLGRNKEGHIEITNCFTVPHKEENKRIDLD
EIF3F_PHANO     ----LNVAIQPQAVFSILDHSLRRPAD------QERVIGTLLGTRSEDGIEIRNCYAVPHTETAEQVEVD
EI3F2_DROER     ------VLIKPLVLFQIIDSYERRPK------GDNQVIGTLLGRNKEGHFEITNCFTVPHKEHPERIDLD
EIF3F_ASPNC     ----LNVVIQPQALFSILDHSLRR------NADQERVIGTLLGTRSEDGVEIRSTFAVGHTETTDQVEVD
EIF3F_ASPOR     ----LNVVIHPQALFSILDHSLRR------NADQERVIGTLLGTRSEDGVEIRTTFAVGHTETTDQVEVD
EIF3F_COCIM     ----LNVVIQPQAIFSILDHSLRR------NADQERVIGTLLGTRSEDGVEIRTCFAVGHTETTDQVEVD
EIF3F_ASPCL     ----LNVVIQPQAIFSILDHSLRR------NADQERVIGTLLGTRSEDGVEIRSTFAVGHTETTDQVEVD
EIF3F_NEOFI     ----LNVVIQPQAIFSILDHSLRR------NADQERVIGTLLGTRSEDGVEIRSTFAVGHTETTDQVEVD
EIF3F_ASPFU     ----LNVVIQPQAIFSILDHSLRR------NADQERVIGTLLGTRSEDGVEIRSTFAVGHTETTDQVEVD
EIF3F_ASPFC     ----LNVVIQPQAIFSILDHSLRR------NADQERVIGTLLGTRSEDGVEIRSTFAVGHTETTDQVEVD
EI3F2_DROSE     MSRNLSIRLKPLVLFQIIDAYDRRPK------GDNQVMGTLLGRTKEDHIEITNCFTVPHKEHSENIDLD
EIF3F_YARLI     ------VTVTAQALFQILDHALRREEE------QSKVIGTLVGIREDGSVEVRNAYAVPHSESEQEMTID
EI3F2_DROYA     ------VFIKPLVLFQIIDAYERRPK------GDNQVMGTLLGRNKEGHFEITNCFPVPHKEHPERIDLD
EIF3F_DICDI     LPSQVTVKVHPVVIFNILDHYIRR------NVGQDRVIGTLLGFNNDGVLEIRNCFPVVHSET-EQIAVE
EI3F2_DROSI     MSRNLSMRLKPLVLFQIIDAYDRRPK------GDNQVMGTLLGRNKEDHIEITNCFTVPHKEHSENIDLD
EIF3F_SCHPO     -SSPLNIVIEPAVLFSILD------HSTRKSENNQRVIGTLLGTRSEDGIEIKSCFAVPHNESSEQVEVE
EI3F2_DROAN     ------VVLQPLVLFQIIDSYERRPKDATQ------IIGTLLGRSNGKEITITNCFTVLHKEHPDSIDLD
EIF3F_BOMMO     MALNISVKVHPVVLFQIVDAYERR------NADSHRVIGTLWGTSDKGVVEVTNCFCVPHKEHADQVEAE
EIF3F_MALGO     ------VKVHPVALFSILDHYLRRDVS------QPRVIGTLLGTRSESEVEVRNAFAVPHGESQDQIHLD
EI3F2_DROPS     ------VLLHPLVLFQIIDAYERRAKDVPEVLGT--LLGTVAG--KTGRIEITNCFSVVHRDNNCHIDLD
EIF3F_ASPTN     ----LNVVIQPQALFSILDHSLRR------NADQERVIGTLLGTRSEDGVEIRSTFAVGHTETTDQVEVD
EI3F2_DROPE     ------VLLHPLVLFQIIDAYERRAKDVPE------VLGTLLGIVKTGRIEITNCFSVVHRDNNCHIDLD
EIF3F_MAGGR     ----LTVTIQPQAILSILDHAVRR---DIRDTQATRVIGALVGVRSEDGVEVRSTFAIPHTENEDQVEVD
EI3F2_DROWI     --------LQPLVLLHIIDAYERRPKDCTQ------VIGTLLGRNESGHLEISNCFTLLHKDNSDRIDVD
EIF3F_ARATH     --------IHPLVIFNVCDCFVRRPDSA------ERVIGTLLGILPDGTVDIRNSYAVPHNESSDQVAVD
EIF3F_CHAGB     ----LTVHIQPQAVFSVIDHAVRR---DTRDTQSTRVIGALVGTREDGSVEVRSTFAIPHTENEDQVEVD
EIF3F_NEUCR     ----LTVNIQPQAVFSIIDHAVRRDDRDTQST---RVIGALVGVREDGSVEVRSTFAIPHTENEDQVEVD
EIF3F_CRYNE     ------ITVHPSVIAQILTHHSRHSADSEST----RVIGALMGNRSDNGVDIRSCFAVPHTEQGQQISVD
EI3F2_DROVI     ------VRLQPLVLFQIIAAYERRPKTA------KMAVGTLLGRRDRCNIEITNSYTVQHKEQQEQFKLD
EI3F2_DROMO     ------VRLQPLVLFQIIAAYERRPKTA------KMAVGTLLGRRDRCNIEITNSYTVQHKEQQEQFKLD
PSD7_DICDI      --------VHPTVLLSVVDHYNRVAKDTNK-----RVVGALLGSNNKGVVDVSNCYGLPFEEDEANPNID
EI3F2_DROGR     ------VRLQPLVLFQIISAYEHRPKLA------EVAVGTLLGLRDRSNIEITNSYMVIHKTQQEQVKLD
PSD7_ARATH      ------VVVHPLVLLSIVDHYNRVAKDSSK-----RVVGVLLGSSSRGVVDVTNSYAVPFEEDDKDPSID
PSD7_DROME      ------VIVHPLVLLSVVD-HFNRM---GKIGNQKRVVGVLLGCWRKGVLDVSNSFAVPFDEDDKDKSVD
CSN6_DICDI      -SSGLEVDLHPLVLINISD-HFTRTKVQSNYQDNCRVIGVILGVQNGRNVEICNSFEMVYATVDKQLVLD
RPN8_SCHPO      ------VIVHPLVLLSAVDSYNR----SAKGT-KRRVVGILLGQNNGDVVNVANSYAIPFEEDEKNASVD
RPN8_ASHGO      ------VNVAPLVLLSVLDHYKRMNTPDNK-----RCVGVLLGDNSGSTIKVTNSFALPFEEDEKNPDVD
PSD7_MOUSE      ---------------------------------QKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVD
PSD7_HUMAN      ---------------------------------QKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVD
RPN8_CANGA      ------VTIAPLVLLSVLDHYERTNTPEGK-----RCVGVILGDSQTNTIRVTNSFALPFEEDEKNSDVD
PSD7_BOVIN      ---------------------------------QKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVD
RPN8_YEAST      ------VTIAPLVLLSALD-HYERTQTKEN----KRCVGVILGDANSSTIRVTNSFALPFEEDEKNSDVD
RPN8_NEUCR      --------------------HYNRTQ--ANKSKSKRVVGVLLGQNDGKNVRVSNSFAVPFEEDDKDPSVD
EIF3H_NEMVE     --------------------------------------GVLLGLIQDNRLEITNCFPFPSNKAGDD-EDD
CSN6B_ARATH     -SSGLTFKLHPLVMLNISD-HFTRVKSCATGNGSNRVYGCVIGLQRGRTVEIFNSFELIFDPALDTL--D
CSN6_XENLA      VTGSVTVALHPLVILNISD-HWIRMRSQEGRPMQ--VIGALIGKQEGRNIEVMNSFELLSQINDEKITIN
CSN6_DROME      -SGSVTISLHPLVIMNISE---HWTRFRAQHGEPRQVYGALIGKQKGRNIEIMNSFELKTDVIGDETVIN
EIF3H_ARATH     --------------------------------------GQLLGLDVGSVLEVTNCFPFPVRDDDEEIEAD
EIF3H_DROGR     -----------------------------ESSNMDLAQGALLGLVVDKCLEITNCF--PFPKSGDETMDD
EIF3H_BOMMO     -------------------------------SNMEVAQGALLGLVVENRLEITNCFPFP---KHDDTMDE
EIF3H_DROYA     -----------------------------ESSNMDLAQGALLGLVVDKCLEITNCF--PFPKSGDETMDE
EIF3H_DROVI     -----------------------------ESSNMDLAQGALLGLVVDKCLEITNCF--PFPKSGDETMDE
EIF3H_DROSE     -----------------------------ESSNMDLAQGALLGLVVDKCLEITNCF--PFPKSGDETMDE
EIF3H_DROPS     -----------------------------ESSNMDLAQGALLGLVVDKCLEITNCF--PFPKSGDETMDE
EIF3H_DROMO     -----------------------------ESSNMDLAQGALLGLVVDKCLEITNCF--PFPKSGDETMDE
EIF3H_DROME     -----------------------------ESSNMDLAQGALLGLVVDKCLEITNCF--PFPKSGDETMDE
EIF3H_DROAN     -----------------------------ESSNMDLAQGALLGLVVDKCLEITNCF--PFPKSGDETMDE
CSN6_XENTR      VTGSVTVALHPLVILNISDHWIRMRSQEGRPV---QVIGALIGKQEGRNIEVMNSFELLSQINEEKITIN
EIF3H_DROWI     -----------------------------ESNNMDLAQGALLGLVVDKCLEITNCF--PFPKSGDETMDE
EIF3H_CULQU     -------------------------------SNMEVAQGALLGLVVDDRLEITNCF--PFPKSSDETIDE
EIF3H_ANOGA     ----------------------------------EVAQGALLGLVVDDRLEITNCF--PFPKSDETID-E
EIF3H_AEDAE     -------------------------------SNMEVAQGALLGLVVDDRLEITNCF--PFPKSSDETIDE
EIF3H_DROER     -----------------------------ESSNMDLAQGALLGLVVDKCLEITNCF--PFPKSGDETMDE
RPN11_CANGA     -------------------------------------MGLMLGFVDEYTVNVVDVFAMPQSGTGVSVEVD
RPN11_ASHGO     -------------------------------------MGLMLGFVDEYTVNVVDVFAMPQSGTGVSVEVD
EI3HA_DANRE     -------------------------------------------------LEITNCFPFP-QHTEDDVEFD
CSN5_EMENI      ----------------------------ARSGGSLEVMGLMQGYILPNTFVVTDAFRLPVEGTETRVNAQ
EIF3H_YARLI     --------------------------------------GQLLGLDVDGELRISHAFAFPQNAAGGNPNSD
RPN11_YEAST     -------------------------------------MGLMLGFVDDYTVNVVDVFAMPQSGTGVSVEVD
EIF3H_XENTR     -------------------------------------------------LEITNCFPFP-QHTEDDVDFD
EIF3H_XENLA     -------------------------------------------------LEITNCFPFP-QHTEDDVDFD
EIF3H_TAEGU     -------------------------------------------------LEITNCFPFP-QHTEDDADFD
EIF3H_RAT       -------------------------------------------------LEITNCFPFP-QHTEDDADFD
EIF3H_MOUSE     -------------------------------------------------LEITNCFPFP-QHTEDDADFD
EIF3H_HUMAN     -------------------------------------------------LEITNCFPFP-QHTEDDADFD
EIF3H_CHICK     -------------------------------------------------LEITNCFPFP-QHTEDDADFD
EIF3H_BOVIN     -------------------------------------------------LEITNCFPFP-QHTEDDADFD
CSN6_PONAB      VTGSVSVALHPLVILNISDHWIRMRSQEGRPV---QVIGALIGKQEGRNIEVMNSFELLSHTVEEKIIID
CSN6_PIG        VTGSVSVALHPLVILNISD-HWIRMRSQEGRPMQ--VIGALIGKQEGRNIEVMNSFELLSHTVEEKIIID
CSN6_MOUSE      VTGSVSVALHPLVILNISD-HWIRMRSQEGRPMQ--VIGALIGKQEGRNIEVMNSFELLSHTVEEKIIID
CSN6_HUMAN      VTGSVSVALHPLVILNISDHWIRMRSQEGRPV---QVIGALIGKQEGRNIEVMNSFELLSHTVEEKIIID
PSDE_DROME      -------------------------------------MGLMLGFVDDYTVQVIDVFAMPQTGTGVSVEVD
EIF3H_SALSA     -------------------------------------------------LEITNCFPFP-QHTEDDADFD
CSN6_BOVIN      VTGSVSVALHPLVILNISD-HWIRMRSQEGRPMQ--VIGALIGKQEGRNIEVMNSFELLSHTVEEKIIID
PSDE_ARATH      -------------------------------------MGLMLGFVDEYTVRVVDVFAMPQSGTGVSVEVD


                         .         .         *         .         .         .         .:140
query           DQFNQQMISALKKTSPNEQPVGWFLTTSDITSSCLIYHDYYVRVITEASARRESPPIVVLTIDTTFSGDM
EIF3F_CAEEL     DQFNQQMISALKKTSPNEQPVGWFLTTSDITSSCLIYHDYYVRVITEASARRESPPIVVLTIDTTFSGDM
EIF3F_MOUSE     MEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYY---------SRESPNPIHLTVDT---GLQ
EIF3F_PANTR     MEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYY---------SREAPNPIHLTVDTSL---Q
EIF3F_MACFA     MEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYY---------SREAPNPIHLTVDTSL---Q
EIF3F_HUMAN     MEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYY---------SREAPNPIHLTVDTSL---Q
EIF3F_AEDAE     LGYASDLYDLNRRVNPSENIVGWWATGQEVTNHSSVIHEYYA---------RECNNPIHLTLDTSLS---
EIF3F_CULQU     LGYASDLYDLNRRVNPSENIVGWWATGQEVTNHSSVIHEYYA---------RECNNPIHLTLDTSLT---
EI3F1_DROVI     LSYALDMYDLNRKVNANESVVGWWATGNEVTNHSSVIHEYYA---------RECNNPVHLTVDTSLQGG-
EI3F1_DROGR     LSYALDMYDLNRKVNSNESVVGWWATGNEVTNHSSVIHEYYA---------RECNNPVHLTVDTSLQGG-
EI3F1_DROWI     LSYALDMYELNRKVNSNESVVGWWATGNEVTNHSSVIHEYYA---------RECNNPVHVTVDTSLQGG-
EI3F1_DROPS     LSYALDMYDLNRKVNSNEAVVGWWATGNDVTNHSSVIHEYYA---------RECNNPVHLTVDTSLQGG-
EI3F1_DROPE     LSYALDMYDLNRKVNSNEAVVGWWATGNDVTNHSSVIHEYYA---------RECNNPVHLTVDTSLQGG-
EI3F1_DROYA     LSYALDMYDLNRKVNSNESVVGWWATGNDVTNHSSVIHEYYA---------RECNNPVHLTVDTSLQGG-
EI3F1_DROSI     LSYALDMYDLNRKVNSNESVVGWWATGNDVTNHSSVIHEYYA---------RECNNPVHLTVDTSLQGG-
EI3F1_DROSE     LSYALDMYDLNRKVNSNESVVGWWATGNDVTNHSSVIHEYYA---------RECNNPVHLTVDTSLQGG-
EI3F1_DROME     LSYALDMYDLNRKVNSNESVVGWWATGNDVTNHSSVIHEYYA---------RECNNPVHLTVDTSLQGG-
EI3F1_DROER     LSYALDMYDLNRKVNSNESVVGWWATGNDVTNHSSVIHEYYA---------RECNNPVHLTVDTSLQGG-
EI3F1_DROMO     LSYALDMYDLNRKVNANENVVGWWATGNEVTNHSSVIHEYYA---------RECNNPVHLTVDTSL---Q
EI3F1_DROAN     LSYALDMYDLNRKVNPNESVVGWWATGNDVTNHSSVIHEYYA---------RECNNPVHLTVDTSLQGG-
EIF3F_ANOGA     LGYASDLYELNQRVNASENIVGWWATGQEVTNHSSVIHEYYARECTNP---------VHLTLDTSLTG--
EIF3F_USTMA     MEYHRSMYELCQKVRPDEVIVGWYATSPELNTYSALIQDFYSRETAPHQA-------VHLTMDTTIDGSK
EI3F2_DROME     MAYASEVLELNMFAYPNERVLGWFCTGKSVSRSASLIHDYYVRECCEGQP-------LHLLVDAALK---
EIF3F_PHANO     MDYQKQMLALHLRANPREVLVGWYATSSDLNTFSALIQNFY----SQQGDGTWPHPAVHLTVSTVPGQDI
EI3F2_DROER     IAYASEILELNMLTYPNERVLGWFCTGKSVSRSASLLHDYYARECGEVQP-------LHLVVDATLK---
EIF3F_ASPNC     MEYQKQMLALHLKANPKEVLVGWYATSSELNTFSALIQNFY----SGQGDGTWPHPAVHLTVST----EA
EIF3F_ASPOR     MEYQKQMLALHLKANPKEVLVGWYATSSELNTFSALIQNFY----SGQGDGTFPHPAVHLTVST----EP
EIF3F_COCIM     MEYQKQMLALHLKANPKEVLVGWYATSSELNTFSALIQNFY----GGQGDGTWPHPAVHLTVST----EP
EIF3F_ASPCL     MEYQKQMLALHLKANPKEVLVGWYATSSELNTFSALIQNFY----SGQGDGTWPHPAVHLTVST----EA
EIF3F_NEOFI     MEYQKQMLALHLKANPKEVLVGWYATSSELNTFSALIQNFY----SGQGDGTWPHPAVHLTVST----EP
EIF3F_ASPFU     MEYQKQMLALHLKANPKEVLVGWYATSSELNTFSALIQNFY----SGQGDGTWPHPAVHLTVST----EP
EIF3F_ASPFC     MEYQKQMLALHLKANPKEVLVGWYATSSELNTFSALIQNFY----SGQGDGTWPHPAVHLTVST----EP
EI3F2_DROSE     MAYASEVLELNMFAYPNERVLGWFCTGKSVSRSASLIHDYYVRECGERQP-------LHLLVDASLK---
EIF3F_YARLI     LEYNPTMLALHRKAFPKEVIVGWYATSSELNTFSGLIHDYYTQL--------DGTPAIHLTVE---AANL
EI3F2_DROYA     ISYASEFLELNMLTYSNERVLGWFSTGKSVSRSASLLHDYYARECGEIQP-------VHLVMDATLK---
EIF3F_DICDI     MEYQRKMLDLHLKSSPREPIIGWYATGNDINENSVHINNFY------RDEMGNSTPI-HLTVDTGLTND-
EI3F2_DROSI     MTYASEVLELNMFAYPNERVLGWFCTGKSVSRSASLIHDYYVRECGERQP-------LHLLVDASLK---
EIF3F_SCHPO     MEYHRAMYHLHLKANPREVVVGWYATSPDLDAFSALIQNLYASPAEPGTAPLGTHPCVHLTVNT----DV
EI3F2_DROAN     LGYANDMLELNQLTYPQEKVLGWFSTGKSVSRSALLLHDYYSRECSDGQP-------LHLLVDATLKG--
EIF3F_BOMMO     LNYAMDVYELNRRVNSSESIVGWWATGNEVTNHSSVIHEYYSRECREP---------VHVTLDTSLAGG-
EIF3F_MALGO     AEHHRRMLDLHLRVRPDEVVLGWYSTNTELNSNSALIQDHYSRETAPHQA-------IHLTLNTNVA-DE
EI3F2_DROPS     LKYDNDMLELAQIAYPQEKVLGWFSTGKSVSAAAVELHEYY-----ERQCHNGQP--LHLLMDTSLRG--
EIF3F_ASPTN     MEYQKQMLALHLKANPKEVLVGWYATSSELNTFSALIQNFY----SGQGDGTFPHPAVHLTVST----EP
EI3F2_DROPE     LKYDNDMLELAQIAYPQEKVVGWFSTGKAVSAAAVELHEYYER-------QCHSGQPLHLLMDTSLRG--
EIF3F_MAGGR     VEYQKNMLALTLKASPRESLLGWYTTSHELNSFSALIQNFFASPETGTFPH----PAVHLTMSTDPGADI
EI3F2_DROWI     LQYANDMYELNQLTYPQEKIIGWYATGKEVSRSAVNLHEYYARECADGNPMH-------LLIDTSLRG--
EIF3F_ARATH     IDYHHNMLASHLKVNSKETIVGWYSTGAGVNGGSSLIHDFYA---------REVPNPIHLTVDTGFTNGE
EIF3F_CHAGB     VEYQKNMLALTLKASPRETLLGWYTTSHELNSFSALIQNFFASPETGTFPH----PAVHLTIST----EP
EIF3F_NEUCR     VEYQKNMLALTLKANPRETLLGWYTTSHELNSFSALIQNFFASPETGTFPH----PAVHLTIGT----EA
EIF3F_CRYNE     RPFQQDMVNFLAKNGTKEVIVGWYASQKTVNSNSAIIQEYF-------SFETNPYPAVHLTVDTDIE-ES
EI3F2_DROVI     TQYASEMFELNQITYPQEKIIGWYSTGKSLSRSAAALHAYYSRECGDVQP-------LHLLVDTTLRGG-
EI3F2_DROMO     TQYASEMFELNQVTYPQEKIIGWYCTGKTLSRSAAALHGYYSRECGDMQP-------LHLLVDTSLRGG-
PSD7_DICDI      HNFHENMFAMFKKINARENVVGWYSTGPKIRPADQDINELF---------RRYTPNPVMVIIDV---APK
EI3F2_DROGR     KQYASEMYELNQINNPQEKIVGWYNTAKSLSRSSAALHAYYARECADAQP-------LHLLVDLKLRGG-
PSD7_ARATH      HNYHESMFHMFKRINAKEHVVGWYSTGPKLRENDLDVHALFNGYV-------PNPVLVIIDVQPKELG--
PSD7_DROME      HDYLENMYGMFKKVNARERVVGWYHTGPKLHQNDIAINEL---------VRRYCPNSVLVIID---AKPK
CSN6_DICDI      IEYLRKKYEQL---FPLYDLLGWYSTGSQVSKDDILLH-------KQISEHNESPLYLMLDTDS----PK
RPN8_SCHPO      HNFMESMNEMFKKINANEKLVGWYHTGPQLRPSDLEINNLLKKYI-------PNPVLVIIDVKPKSVG--
RPN8_ASHGO      HNYIENMNDMCKKINAKEKMIGWYHSGPKLRSSDL-----------------------------------
PSD7_MOUSE      HDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINEL---------MKRYCPNSVLVIIDVK---PK
PSD7_HUMAN      HDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINEL---------MKRYCPNSVLVIIDVK---PK
RPN8_CANGA      HNYIESMNEMCKKINAKEKLIGWYHSGPKLRASDLKINELF-----------------------------
PSD7_BOVIN      HDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINEL---------MKRYCPNSVLVIIDVK---PK
RPN8_YEAST      HNYIENMNEMCKKINAKEKLIGWYHSGPKLRASDLKINELF-----------------------------
RPN8_NEUCR      HNYVESMNDMFKKVNAREKLIGWYHSGPKLRASDLDINELFKR---------------------------
EIF3H_NEMVE     DDVNYQMMRRLRAVNIDHLHVGWYQST-------------------------------------------
CSN6B_ARATH     RSFLEKKQELYKKVFPDFYVLGWYSTGSDATESDMHIHKALMDI-------NESPVYVLLNPAINHA---
CSN6_XENLA      KEYYYTKEEQFKQVFKDMEFLGWYTTGGTPDPSDIHVHKQVCEII-------ESPLFLKLNPMTKHTD--
CSN6_DROME      KDYYNKKEQQYKQVFSDLDFIGWYTTGDNPTAD-------DIKIQRQIAAINECPIMLQLN-PLSRSVD-
EIF3H_ARATH     GNYQLEMMRCLREVNVDNNTVGWYQST-------------------------------------------
EIF3H_DROGR     ETYQLTVMRHLRRVNVDHLHVGWY-QSSDVGNSALLESQYHYQTSIEES---------------------
EIF3H_BOMMO     EEYQLDMMRRLRRVNVDHFHVGWYQSVGNFLSLSLLESQYHYQTSIEES---------------------
EIF3H_DROYA     EMYQLTVMRRLRRVNVDHLHVGWY-QSSDVGNSALLESQYHYQTSIEES---------------------
EIF3H_DROVI     EMYQLTVMRRLRRVNVDHLHVGWY-QSSDVGNSALLESQYHYQTSIEES---------------------
EIF3H_DROSE     EMYQLTVMRRLRRVNVDHLHVGWY-QSSDVGNSALLESQYHYQTSIEES---------------------
EIF3H_DROPS     EMYQLTVMRRLRRVNVDHLHVGWY-QSSDVGNSALLESQYHYQTSIEES---------------------
EIF3H_DROMO     EMYQLTVMRRLRRVNVDHLHVGWY-QSSDVGNSALLESQYHYQTSIEES---------------------
EIF3H_DROME     EMYQLTVMRRLRRVNVDHLHVGWY-QSSDVGNSALLESQYHYQTSIEES---------------------
EIF3H_DROAN     EMYQLTVMRRLRRVNVDHLHVGWY-QSSDVGNSALLESQYHYQTSIEES---------------------
CSN6_XENTR      KEYYYTKEEQFKQVFKDMEFLGWYTTGGTPDPSDIHVHKQVCEII-------ESPLFLKLNPMTKHTD--
EIF3H_DROWI     EMYQLTVMRRLRRVNVDHLHVGWY-QSSDVGNSALLESQYHYQTSIEES---------------------
EIF3H_CULQU     EEYQLNMMRRLRLVNVDHFHVGWYQSVGNFLSLPLLESQYHYQTSIEES---------------------
EIF3H_ANOGA     EEYQLNMMRRLRHVNVDHFHVGWYQSVGNFLSSTLLESQYHYQTSIEES---------------------
EIF3H_AEDAE     EEYQLNMMRRLRLVNVDHFHVGWYQSVGNFLSLPLLESQYHYQTSIEES---------------------
EIF3H_DROER     ELYQLTVMRRLRRVNVDHLHVGWY-QSSDVGNSALLESQYHYQTSIEES---------------------
RPN11_CANGA     DVFQARMMDMLKQTGRDQMVVGWY----------------------------------------------
RPN11_ASHGO     DVFQAKMMDMLKQTGRDQMVVGWY----------------------------------------------
EI3HA_DANRE     EQYQMEMMRSLRHVNIDHLHVGWYQST-------------------------------------------
CSN5_EMENI      DEANEYMVSYLREAGRMENAVGWY----------------------------------------------
EIF3H_YARLI     DKYQPEMIDHLKEVNVDSNSVGWYQST-------VLGRIYNASVIENLAVFQENPDSVVLVYDVAGSEVV
RPN11_YEAST     DVFQAKMMDMLKQTGRDQMVVGWY----------------------------------------------
EIF3H_XENTR     EQYQMEMMRSLRHVNIDHLHVGWYQST-------------------------------------------
EIF3H_XENLA     EQYQMEMMRSLRHVNIDHLHVGWYQST-------------------------------------------
EIF3H_TAEGU     EQYQMEMMRSLRHVNIDHLHVGWYQSTSFVTRALLDSQFSYQHAIEES----------------------
EIF3H_RAT       EQYQMEMMRSLRHVNIDHLHVGWYQSTSFVTRALLDSQFSYQHAIEES----------------------
EIF3H_MOUSE     EQYQMEMMRSLRHVNIDHLHVGWYQSTSFVTRALLDSQFSYQHAIEES----------------------
EIF3H_HUMAN     EQYQMEMMRSLRHVNIDHLHVGWYQSTSFVTRALLDSQFSYQHAIEES----------------------
EIF3H_CHICK     EQYQMEMMRSLRHVNIDHLHVGWYQSTSFVTRALLDSQFSYQHAIEES----------------------
EIF3H_BOVIN     EQYQMEMMRSLRHVNIDHLHVGWYQSTSFVTRALLDSQFSYQHAIEES----------------------
CSN6_PONAB      KEYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVHKQVCEII-------------------------
CSN6_PIG        KEYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVHKQVCEII-------------------------
CSN6_MOUSE      KEYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVHKQVCEII-------------------------
CSN6_HUMAN      KEYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVHKQVCEII-------------------------
PSDE_DROME      PVFQAKMLDMLKQTGRPEMVVGWY----------------------------------------------
EIF3H_SALSA     EQYQMEMMRSLRHVNIDHLHVGWYQST-------------------------------------------
CSN6_BOVIN      KEYYYTKEEQFKQVFKELDFLGWYTTGGPPDPSDIHVHKQVCEII-------------------------
PSDE_ARATH      HVFQTNMLDMLKQTGRPEMVVGWY----------------------------------------------


                         +         .         .         .         .         *         .:210
query           SKRMPVRAYLRSKAGIPGAAGPHCAIFNPLRVELAAFPGELVAMQLIEKALDSRRREATLESGLEQLETS
EIF3F_CAEEL     SKRMPVRAYLRSKAGIPGAAGPHCAIFNPLRVELAAFPGELVAMQLIEKALDSRRREATLESGLEQLETS
EIF3F_MOUSE     HGRMSIKAYVSTLMGVPGRT--MGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGA
EIF3F_PANTR     NGRMSIKAYVSTLMGVPGRT--MGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGA
EIF3F_MACFA     NGRMSIKAYVSTLMGVPGRT--MGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGA
EIF3F_HUMAN     NGRMSIKAYVSTLMGVPGRT--MGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGA
EIF3F_AEDAE     AARMGIKAYVCVSLGVPG--GKTGCMFTPINVEISSYEPEVVGLQLCSKTIGSRPRTVSPMLDLAQITEA
EIF3F_CULQU     AARMGIKAYVCVSLGVPG--GKTGCMFTPINVEVTSYEPEVVGLSLCAKTIPARPRTVSPMLDLAQVSEA
EI3F1_DROVI     --RMGLRAYVCIQLGVPG--GKTGCMFTPIPVELTSYEPETFGLKLLQKGVSPAHRPKTVPPMLDQISEA
EI3F1_DROGR     --RMGLRAYVCIQLGVPG--GKTGCMFTPIPVELTSYEPETFGLKLLQKGVSPAQRPKTVPPMLDQISEA
EI3F1_DROWI     --RMGLRAYVCIQLGVPG--GKSGCMFTPIPVELTSYEPETFGLKLLQKGVSPAHRPKTVPPMLDQISEA
EI3F1_DROPS     --RMGLRSYVCIQLGVPG--GKTGCMFTPIPVELTSYEPETFGLKLLQKTVGNRPKTVPPMLDLAQISEA
EI3F1_DROPE     --RMGLRSYVCIQLGVPG--GKTGCMFTPIPVELTSYEPETFGLKLLQKTVGNRPKTVPPMLDLAQISEA
EI3F1_DROYA     --RMGLRAYVCIQLGVPG--GKSGCMFTPIPVELTSYEPETFGLKLLQKGVSPAHRPKTVPPMLDQISEA
EI3F1_DROSI     --RMGLRAYVCIQLGVPG--GKSGCMFTPIPVELTSYEPETFGLKLLQKGVSPAHRPKTVPPMLDQISEA
EI3F1_DROSE     --RMGLRAYVCIQLGVPG--GKSGCMFTPIPVELTSYEPETFGLKLLQKGVSPAHRPKTVPPMLDQISEA
EI3F1_DROME     --RMGLRAYVCIQLGVPG--GKSGCMFTPIPVELTSYEPETFGLKLLQKGVSPAHRPKTVPPMLDQISEA
EI3F1_DROER     --RMGLRAYVCIQLGVPG--GKSGCMFTPIPVELTSYEPETFGLKLLQKGVSPAHRPKTVPPMLDQISEA
EI3F1_DROMO     SGRMGLRAYICIQLGVPG--GKTGCMFTPIPVELTSYEPETFGLKLLQKTVTHRPKTVAPMLDLAQISEA
EI3F1_DROAN     --RMGLRAYVCIQLGVPG--GKSGCMFTPIPVELTSYEPETFGLKLLQKGVSPAHRPKTVPPMLDQISEA
EIF3F_ANOGA     -ARMGIKAYVCVSLGVPG--GKSGCMFTPINVEVTSYEPEIVGLQLCMKTIPSRPRTVSPMLDLAQVTXX
EIF3F_USTMA     PSGLGIKSYISSPLGATPKA-ENC-VFLPLPTNLLHSTPEHSSLSL----LASQNISSPL-TDLDALAVS
EI3F2_DROME     NQRLSTRLYCAVEMGVPG--GTKGLMFSLVPLEISNENSDLVALRCIEKQSQQQKQMERFVPELAQVVDA
EIF3F_PHANO     ES----RTYISAPIGVTAERAADSCLFIPVPHEIKYGEAEKSGLELISSAKDREDRSQEIMTDLDSLERA
EI3F2_DROER     SQRLSTRLYCAVEIGVPG--GTKGLMFSLVPLEISNGNSDLVALRSIEK--------QSLQQGTKQLDDA
EIF3F_ASPNC     GKDIETRAYISAPVGVTAERAADSAAFIPVPYEIRYGEAEKSGLEAIGAARDAEERRANIFTDIEALERA
EIF3F_ASPOR     GKDVETRAYISAPVGVTAERAADSAAFIPVPYEIRYGETEKSGLESIAAARDVESRAANIFTDIEALERA
EIF3F_COCIM     GKDIETRTYISAPVGVTAERAADSAAFIPVPYEIRYSEAERNGLEAIAQARDAEDRASSLFTDIETLEKS
EIF3F_ASPCL     GKDIETRAYISAPVGVTAERAADSAAFIPVPYEIRYGEAEKSGLEAISSARDAENRATNIFTDIEALERA
EIF3F_NEOFI     GKDIETRAYISAPVGVTAERAADSAAFIPVPYEIRYGEAEKSGLETIASAKDAESRATNIFTDIEALERA
EIF3F_ASPFU     GKDIETRAYISAPVGVTAERAADSAAFIPVPYEIRYGEAEKSGLEAIASAKDAESRATNIFTDIEALERA
EIF3F_ASPFC     GKDIETRAYISAPVGVTAERAADSAAFIPVPYEIRYGEAEKSGLEAIASAKDAESRATNIFTDIEALERA
EI3F2_DROSE     NQRLSTRLYCAVEMGVPG--GTKGLMFSLVPLEISSENSDLVAVRCIEKQSQQQKQMERFVPELVQVVDA
EIF3F_YARLI     ADTLLPRTYVASAVGIDPSKNSGNCVFVPISNEVKNDSADRAALEAISSARESPERSINLTSDLANLENS
EI3F2_DROYA     SQRLSTRLYCAVEIGVPG--GTKGLMFSLVPLEISNGNSDLVALRSLEKQQGTKQMERFLPE-LVQVVDA
EIF3F_DICDI     --TMGIHAYMAHNLSL----NPESSLFSQLPLEILTFEAENAGLESIAQT-KYDXXXXXXXXXXXXXXXX
EI3F2_DROSI     NQRLSTRLYCAVEMGVPG--GTKGLMFSLVPLEISSENSDLLAMRCIEKQSQQQKQMERFAPELVQVVDA
EIF3F_SCHPO     SSPLAIKTYVSSPVGITERLADSCA-FVPTPFTIRDDEAVRSGLKAVAAPKNDPSRLASLFTDLQQLRRS
EI3F2_DROAN     -QRLSTRLYCGVEMGVPG--GTKGLMFSLVPLEMASDSAEMVALRLMQKLQPGAKQVGRILPELVQVVEA
EIF3F_BOMMO     --RMGLRAYVCVPLGVPN--GKQGCMFTPVDVTLTCYEPEIVGLQVCQKTXXXXXXXXXXXXXXXDLAQV
EIF3F_MALGO     ANGLGVQCYVSALLG--AMAKPEDCAFLSLPTHLLMSTPEQTALRHLAAPKPQNITD------LDALKAS
EI3F2_DROPS     -QRMNTRIFCAVATGVPG--GTKGLMFSLLPMDIYFGSPDIVAMRHMGRQCAQPTKDARLLPELEQVVDA
EIF3F_ASPTN     GKDIETRAYISAPVGVTAERAADSAAFIPVPHEIRYGETEKSGLXXXXXXXXXXXXXXNLFTDIEALERA
EI3F2_DROPE     -QRMNTRIFCAVATGVPG--GTKGLMFSLLPMDIYFGSPDIVAMRHMGRQCALPPKEARLLPELEQVVDA
EIF3F_MAGGR     EP----RCYISAPAAVPDRAAESCFFIQVPHRTPPTNESDRAALEAIAAGKDDEARTAPVLSDVEALARS
EI3F2_DROWI     -QRMMMRLYTAVVMGVPN--GTKGLMFSLLPVEMSSGNPESVALNLMKKALQPTKQVGRILPELVQVVDI
EIF3F_ARATH     G---TIKAFVSSNLSL--GDRQLVAHFQEIPVDLRMVDAERVGFDVLKATSVDK-----LPNDLEGMELT
EIF3F_CHAGB     GAPIATKAYISAPVAVSPERAAESCLFIEVPHKLLFSDXXXXXXXXXXXXXXXXXXXXPVISDIETLAQS
EIF3F_NEUCR     GATIDTKTYISAPVAVSPERAAESCLFIEVPHKLLFTDXXXXXXXXXXXXXXXXXXXXPVVSDIENLAQA
EIF3F_CRYNE     GKGLGVKGWVSQPLGLTSKS--ECSVFVPVPVSIKYADSERAA---LDXXXXXXXXXXXXXXXXXXXXXX
EI3F2_DROVI     --HLSTRLYCGVTMGVP-XXXXXXXXXXXXXXXXXXXXDESVALRLMQKALHPTKQLGRMLPELVHVMEA
EI3F2_DROMO     --RLTTRLYCAVTMGV-XXXXXXXXXXXXXXXKVNAEGDEAVALRLMQKALHPTKQLGRMLPELVHVMEA
PSD7_DICDI      ELGIPTKSYVTVEE-INKDTSESTMRFQHIPSSIDAVEAEEICIELLRDVKDS--SISSLTTQITDKKIS
EI3F2_DROGR     --RLNTRLYCGVPIGVPGGTKGLMFTLLPL-LKMGTEIDDSVALRVMQNALNPAKQPGRILPELMSVLEI
PSD7_ARATH      ---IPTKAYYAVEEVKENATQKSQKVFVHVSTEIAAHEVEEIGVE-------------------------
PSD7_DROME      DLGLPTEAYI-SVEEVHDDGSPTSKTFEHVPSEIXXXXXXXLLRDIKDTTVGSLSQKITNQMGLKGLNAQ
CSN6_DICDI      SKDLPVIIY-ESELHIVNDEPTTIFVKTPYKIQTG--EAERIGVNHIAKVTPSGSEGSGLTSHLFTMHNA
RPN8_SCHPO      ---LPTNAY-------------------------------------------------------------
RPN8_ASHGO      ----------------------------------------------------------------------
PSD7_MOUSE      DLGLPTEAYI-SVEEVHDDGTPTSKTFEHVTSEIXXXXXXXXXXHLLRDIKDTSQRITNQVHGLKGLNSK
PSD7_HUMAN      DLGLPTEAYI-SVEEVHDDGTPTSKTFEHVTSEIXXXXXXXXXXHLLRDIKDTSQRITNQVHGLKGLNSK
RPN8_CANGA      ----------------------------------------------------------------------
PSD7_BOVIN      DLGLPTEAYI-SVEEVHDDGTPTSKTFEHVTSEIXXXXXXXXXXHLLRDIKDTSQRITNQVHGLKGLNSK
RPN8_YEAST      ----------------------------------------------------------------------
RPN8_NEUCR      ----------------------------------------------------------------------
EIF3H_NEMVE     ----------------------------------------------------------------------
CSN6B_ARATH     QKDLPVTIY-------------------------------------------------------------
CSN6_XENLA      ---LPVSVY---ESVIDIVNGEATMLLAELSYTLATEEAERIGVDHVARMTATGSGESTVAEHLIAQHSA
CSN6_DROME      --HLPLKLF---ESLIDLVDGEATMLFVPLTYTLATEEAERIGVDHVARMTSNESGEKSVVAEHLVAQDS
EIF3H_ARATH     ----------------------------------------------------------------------
EIF3H_DROGR     ----------------------------------------------------------------------
EIF3H_BOMMO     ----------------------------------------------------------------------
EIF3H_DROYA     ----------------------------------------------------------------------
EIF3H_DROVI     ----------------------------------------------------------------------
EIF3H_DROSE     ----------------------------------------------------------------------
EIF3H_DROPS     ----------------------------------------------------------------------
EIF3H_DROMO     ----------------------------------------------------------------------
EIF3H_DROME     ----------------------------------------------------------------------
EIF3H_DROAN     ----------------------------------------------------------------------
CSN6_XENTR      ---LPVSVY---ESVIDIVNGEATMLLAELSYTLATEEAERIGVDHVARMTATGSGESTVAEHLIAQHSA
EIF3H_DROWI     ----------------------------------------------------------------------
EIF3H_CULQU     ----------------------------------------------------------------------
EIF3H_ANOGA     ----------------------------------------------------------------------
EIF3H_AEDAE     ----------------------------------------------------------------------
EIF3H_DROER     ----------------------------------------------------------------------
RPN11_CANGA     ----------------------------------------------------------------------
RPN11_ASHGO     ----------------------------------------------------------------------
EI3HA_DANRE     ----------------------------------------------------------------------
CSN5_EMENI      ----------------------------------------------------------------------
EIF3H_YARLI     SDTDP-----------------------------------------------------------------
RPN11_YEAST     ----------------------------------------------------------------------
EIF3H_XENTR     ----------------------------------------------------------------------
EIF3H_XENLA     ----------------------------------------------------------------------
EIF3H_TAEGU     ----------------------------------------------------------------------
EIF3H_RAT       ----------------------------------------------------------------------
EIF3H_MOUSE     ----------------------------------------------------------------------
EIF3H_HUMAN     ----------------------------------------------------------------------
EIF3H_CHICK     ----------------------------------------------------------------------
EIF3H_BOVIN     ----------------------------------------------------------------------
CSN6_PONAB      ----------------------------------------------------------------------
CSN6_PIG        ----------------------------------------------------------------------
CSN6_MOUSE      ----------------------------------------------------------------------
CSN6_HUMAN      ----------------------------------------------------------------------
PSDE_DROME      ----------------------------------------------------------------------
EIF3H_SALSA     ----------------------------------------------------------------------
CSN6_BOVIN      ----------------------------------------------------------------------
PSDE_ARATH      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TAQMIEWLERMLHYVEDVNKNGEKPGDAQIGRQLMDIVTASSNNMQPEKLDTLVKNTLRDYVMVSYLAKL
EIF3F_CAEEL     TAQMIEWLERMLHYVEDVNKNGEKPGDAQIGRQLMDIVTASSNNMQPEKLDTLVKNTLRDYVMVSYLAKL
EIF3F_MOUSE     SARIQDALSTVLQYAEDV-LSGKVSADNTVGRFLMSLVN-QVPKIVPDDFETMLNSNINDLLMVTYLANL
EIF3F_PANTR     SARIQDALSTVLQYAEDV-LSGKVSADNTVGRFLMSLVN-QVPKIVPDDFETMLNSNINDLLMVTYLANL
EIF3F_MACFA     SARIQDALSTVLQYAEDV-LSGKVSADNTVGRFLMSLVN-QVPKIVPDDFETMLNSNINDLLMVTYLANL
EIF3F_HUMAN     SARIQDALSTVLQYAEDV-LSGKVSADNTVGRFLMSLVN-QVPKIVPDDFETMLNSNINDLLMVTYLANL
EIF3F_AEDAE     SDKLLTLLGEVLNYVEDVLAEKQQP-DNSVGRALLDLI-HSVPNMTSDQFAQMFNSNVKDLLMVVTLSQL
EIF3F_CULQU     SGKLQTLLGEVLNYVEDVLAEKQQP-DNFVGRALLDLI-HSVPNMKHEEFAKMFNSNVKDLLMVVTLSQL
EI3F1_DROVI     STKLQSLLELILKYVDDVIAHKVTPDNA-VGRQLLDLI-HSVPHMTHEQFTQMFNANVRDLLMVITLSQL
EI3F1_DROGR     SQKLQSLLDLILKYVDDVIAHKVTPDNA-VGRQLLDLI-HSVPHMTHEQFTQMFNANVRDLLMVITLSQL
EI3F1_DROWI     STKLQSLLDLILKYVDDVIAHKVTPDNA-VGRQLLDLIHAVP-HMTHEQFTQMFNANVRDLLMVITLSQL
EI3F1_DROPS     STKLQSLLDLILKYVDDVIAHKVTPDNA-VGRQLLDLI-HSVPHMSHEQFTQMFNANVRNLLMVITLSQL
EI3F1_DROPE     STKLQSLLDLILKYVDDVIAHKVTPDNA-VGRQLLDLI-HSVPHMSHEQFTQMFNANVRNLLMVITLSQL
EI3F1_DROYA     STKLQSLLDLILKYVDDVIAHKVTPDNA-VGRQLLDLI-HSVPHMTHEQFTQMFNANVRNLLLVITLSQL
EI3F1_DROSI     STKLQSLLDLILKYVDDVIAHKVTPDNA-VGRQLLDLI-HSVPHMTHEQFTQMFNANVRNLLLVITLSQL
EI3F1_DROSE     STKLQSLLDLILKYVDDVIAHKVTPDNA-VGRQLLDLI-HSVPHMTHEQFTQMFNANVRNLLLVITLSQL
EI3F1_DROME     STKLQSLLDLILKYVDDVIAHKVTPDNA-VGRQLLDLI-HSVPHMTHEQFTQMFNANVRNLLLVITLSQL
EI3F1_DROER     STKLQSLLDLILKYVDDVIAHKVTPDNA-VGRQLLDLI-HSVPHMTHEQFTQMFNANVRNLLLVITLSQL
EI3F1_DROMO     ATKLQSLLDLILKYVDDVIAHKVTPDNA-VGRQLLDLI-HSVPHMTHEQFTQMFNANVRDLLMVITLSQL
EI3F1_DROAN     SXXXXXXXXXXXXYVDDVIAHKVTPDNA-VGRQLLDLI-HSVPHMTHEQFTQMFNANVRNLLLVITLSQL
EIF3F_ANOGA     XXXXXXXXXXXXXYVEDVLSEKQQP-ENTVGRALLDLI-HSVPNMTGDQFAQMFNSNVKDLLMVVTLSQL
EIF3F_USTMA     LKQVQSQLDRVLTYVRAVI-SGEKEGDKAVGRFLNDTISVVPAGLDDNKLETLFNAHLQDVLMVSYLANV
EI3F2_DROME     TRDMQHRLDLVLRYINDVLARKKKP-DNVVGRSLYAALTAVP-LLDSDKFRVMFNTNLRDMLMAITLSTM
EIF3F_PHANO     VQHVLDMLERVSNYVNNVLDEEAEPSSA-LGQFLMNALSLAP-KVDPADIERDFNNHIQDVLVVSYLANT
EI3F2_DROER     TRDIQQRLDLVLRYIKDVLDRKRKP-DNVVGRALHAALTAVP-VMDPDKFRLMFNTNLRDMLMAITLSTM
EIF3F_ASPNC     IEDVLGMIDRVSRYVESV-IDEEAPASTALGQYLLNTL-ALAPKVEPADIERDFNNHIQDVLVVSYLANT
EIF3F_ASPOR     VEEVLGMIDRVSKYVESV-IDEEAPASTALGQFLLNAL-ALAPKVEPADIERDFNNHIQDVLVVSYLANT
EIF3F_COCIM     IEEVLGMIDRVSKYVESV-IDEEAPASTALGQFLLNAL-ALAPKVDPADIESDFNKHIQDVLVVSYLANT
EIF3F_ASPCL     IEDVLGMIDRVSRYVESV-IDEEAPASTALGQFLLNTL-ALAPKVEPADIERDFNNHIQDVLVVSYLANT
EIF3F_NEOFI     IEEVLGMIDRVSRYVESV-IDEEAPASTALGQFLLNAL-ALAPKVEPADIERDFNNHIQDVLVVSYLANT
EIF3F_ASPFU     IEEVLGMIDRVSRYVESV-IDEEAPASTALGQFLLNAL-ALAPKVEPADIERDFNNHIQDVLVVSYLANT
EIF3F_ASPFC     IEEVLGMIDRVSRYVESV-IDEEAPASTALGQFLLNAL-ALAPKVEPADIERDFNNHIQDVLVVSYLANT
EI3F2_DROSE     TRNIQQRLDLLLRYINDVLARKKKP-DNLVGRSLQAALTAVP-LFDSEKFRLMFNTNVRDMLMAITLSTM
EIF3F_YARLI     LTQVLDMLERVQTYVARVISGEESSEKAQVGKQ-XXXXXXXXXXXDAQNLEALFNSHLQDVLMVVYLANT
EI3F2_DROYA     TRDIQQRLDLVLRYINDVLARKRKP-DNVIGRALYAALTAVP-LLDSEKFRLMFNTNLRDMLMAITLSTM
EIF3F_DICDI     XXKLDEMLESITSYIESVEK-GEIQGDPRLGRFLAKTIQALP-KANAQVMDKVINNSVKDLLMIVYLSSL
EI3F2_DROSI     TXXXXXXXXXXXXYINDVLARKKKP-DNVVGRSLQAALTAVP-LLDSEKFRLMFNTNLRDMLMAITLSTM
EIF3F_SCHPO     TLELLSMIERVSDYVQNV-IDGSSPANVAVGRYLMKCFSLIP-CVEGQDFEKIFSSHLQDVLVVVYLANT
EI3F2_DROAN     TRELQLRLDLVLRYINDVLARKRRP-DNVVGRALHDTLT-SVPLVDTDNFKLMFNANVRDMLMAITLSTM
EIF3F_BOMMO     MXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLQLAHSAPDLAKDTFSDAFASSVKDLLMVVTLAQL
EIF3F_MALGO     LEDVQAKLDRVLTYVRRVLA-GEVEGDKAVGRYLSDTIGVVPAGLDESLLESLFQSHLQDVFMVSYLSKL
EI3F2_DROPS     TKDIQQKLDLVLRYINDILNRKRRP-DNTVGRALHDVLT-SVPMVEAERFRHMFNTNMRDLLMSLTLSSM
EIF3F_ASPTN     IEEVLGMIDRVSRYVESV-IDEEAPASTALGQFLLNAL-ALAPKVEPADIERDFNNHIQDVLVVSYLANT
EI3F2_DROPE     TKDIQQKLDLVLRYINDILNRKRRP-DNTVGRALHDVLT-SVPMVEAERFRHMFNTNMRDLLMSLTLSSM
EIF3F_MAGGR     LEQTIDMLDRTSEYVGAVLDEEREPSHA-LGQYLMNNLSLAP-KVDSVSIEHDFNNHIQDVLMVSYLTNT
EI3F2_DROWI     TRDLQTKLDLVLRYVNETLARKRTPNNT-VGRALHDALT-SVPLVDAESFRMMFNANVRDMLMSITLATM
EIF3F_ARATH     MERLLTLINDVYKYVDSV-VGGQIAPDNNIGRFIADAV-ASLPKLPPQVFXXXXXXXXXXXXXXXXXXXI
EIF3F_CHAGB     LESVSDLLERVSGFVGEV-LDEERDGSHALGQYLMNALSLAP-KVSATQIEADFNNHVQDVLMVSYLANT
EIF3F_NEUCR     LETVSDLLERVSGFVGEV-LDEERDGNHALGQYLMNALSLAP-KVSNLAIENDFNNHIQDVLMVSYLANT
EIF3F_CRYNE     XXXXXXXIDQCLAYVQSVN-NGSQTPDVEIGRYLLEGLSASGNEDEGG-----VKAGLQDTLTVEYLSSL
EI3F2_DROVI     TRELEQKLELVMRYINDVLARKRRP-DNSIGRALHDALT-SVPLLDAESFRLMFNANVRNMLMSITLSTM
EI3F2_DROMO     TRELEQKLDLVMRYINDVLTRKRRP-DNSIGRALHDALT-SVPLLDADSFRAMFNANVRNMLMSITLSSM
PSD7_DICDI      LKHLLTNLQEMQHYLKLV-CDGTLPPNHQIIGYIQDIINLSPNNANEISKSFAVQN--NDTMSVIYLSSM
EI3F2_DROGR     TXXXXXXXXXXXRYIKDVLARKRLP-DKRVGRALYEALT-SVPMMDAESFRLMFNTNVRDILLSITLSTM
PSD7_ARATH      ----------------------------------------------------------------------
PSD7_DROME      LRDIKQYLQRV--------GDSKMPINHQIVYQLQDIFNLLPDITNDQFTGTMYVKT-NDQMLVVYLASM
CSN6_DICDI      ISMLNIRVKALSDYLQAV-KEKRLPYEQNILRK------ASSLCNQLPTIDTFKKSYLQEYLLVTYLASI
RPN8_SCHPO      ----------------------------------------------------------------------
RPN8_ASHGO      ----------------------------------------------------------------------
PSD7_MOUSE      LLDIRSYLEKV--------ASGKLPINHQIIYQLQDVFNLLPDASLQEFVKAFYLKT-NDQMVVVYLASL
PSD7_HUMAN      LLDIRSYLEKV--------ATGKLPINHQIIYQLQDVFNLLPDVSLQEFVKAFYLKT-NDQMVVVYLASL
RPN8_CANGA      ----------------------------------------------------------------------
PSD7_BOVIN      LLDIRGYLEKV--------ATGKLPINHQIIYQLQDVFNLLPDVSLQEFVKAFYLKT-NDQMVVVYLASL
RPN8_YEAST      ----------------------------------------------------------------------
RPN8_NEUCR      ----------------------------------------------------------------------
EIF3H_NEMVE     ----------------------------------------------------------------------
CSN6B_ARATH     ----------------------------------------------------------------------
CSN6_XENLA      IKMLHSRVRLILEYVR-AAEGGEVPFNHEILREASALCHCLP-VLSTDKFKTDFYDQCNDVGLMSYLGTI
CSN6_DROME      AIKMLNTIKIVLQYIRDV-----EAGKLRANQEILREAYALCHRMQVPAFQEEFYTQCNDVGLISYLGTL
EIF3H_ARATH     ----------------------------------------------------------------------
EIF3H_DROGR     ----------------------------------------------------------------------
EIF3H_BOMMO     ----------------------------------------------------------------------
EIF3H_DROYA     ----------------------------------------------------------------------
EIF3H_DROVI     ----------------------------------------------------------------------
EIF3H_DROSE     ----------------------------------------------------------------------
EIF3H_DROPS     ----------------------------------------------------------------------
EIF3H_DROMO     ----------------------------------------------------------------------
EIF3H_DROME     ----------------------------------------------------------------------
EIF3H_DROAN     ----------------------------------------------------------------------
CSN6_XENTR      IKMLHSRVRLILEYVR-AAEAGEVPFNHEILREASALCHCLP-VLSTDKFKMDFYDQCNDVGLMSYLGTI
EIF3H_DROWI     ----------------------------------------------------------------------
EIF3H_CULQU     ----------------------------------------------------------------------
EIF3H_ANOGA     ----------------------------------------------------------------------
EIF3H_AEDAE     ----------------------------------------------------------------------
EIF3H_DROER     ----------------------------------------------------------------------
RPN11_CANGA     ----------------------------------------------------------------------
RPN11_ASHGO     ----------------------------------------------------------------------
EI3HA_DANRE     ----------------------------------------------------------------------
CSN5_EMENI      ----------------------------------------------------------------------
EIF3H_YARLI     ----------------------------------------------------------------------
RPN11_YEAST     ----------------------------------------------------------------------
EIF3H_XENTR     ----------------------------------------------------------------------
EIF3H_XENLA     ----------------------------------------------------------------------
EIF3H_TAEGU     ----------------------------------------------------------------------
EIF3H_RAT       ----------------------------------------------------------------------
EIF3H_MOUSE     ----------------------------------------------------------------------
EIF3H_HUMAN     ----------------------------------------------------------------------
EIF3H_CHICK     ----------------------------------------------------------------------
EIF3H_BOVIN     ----------------------------------------------------------------------
CSN6_PONAB      ----------------------------------------------------------------------
CSN6_PIG        ----------------------------------------------------------------------
CSN6_MOUSE      ----------------------------------------------------------------------
CSN6_HUMAN      ----------------------------------------------------------------------
PSDE_DROME      ----------------------------------------------------------------------
EIF3H_SALSA     ----------------------------------------------------------------------
CSN6_BOVIN      ----------------------------------------------------------------------
PSDE_ARATH      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           TQTQLQVHERLVSA
EIF3F_CAEEL     TQTQLQVHERLVSA
EIF3F_MOUSE     TQSQIALNEKLVN-
EIF3F_PANTR     TQSQIALNEKLVN-
EIF3F_MACFA     TQSQIALNEKLVN-
EIF3F_HUMAN     TQSQIALNEKLVN-
EIF3F_AEDAE     IKTQLQLNEKLTS-
EIF3F_CULQU     IKTQLQLNEKLTS-
EI3F1_DROVI     IKTQLQLNEKL---
EI3F1_DROGR     IKTQLQLNEKL---
EI3F1_DROWI     IKTQLQLNEKL---
EI3F1_DROPS     IKTQLQLNEKL---
EI3F1_DROPE     IKTQLQLNEKL---
EI3F1_DROYA     IKTQLQLNEKL---
EI3F1_DROSI     IKTQLQLNEKL---
EI3F1_DROSE     IKTQLQLNEKL---
EI3F1_DROME     IKTQLQLNEKL---
EI3F1_DROER     IKTQLQLNEKL---
EI3F1_DROMO     IKTQLQLNEKL---
EI3F1_DROAN     IKTQLQLNEKL---
EIF3F_ANOGA     IKTQLQLNEKLTS-
EIF3F_USTMA     VRAQAEVSSRL---
EI3F2_DROME     IKTQLEISEKL---
EIF3F_PHANO     IRTQIDLSNRLATA
EI3F2_DROER     IKTQLEISEKL---
EIF3F_ASPNC     IRTQMELSNRLATA
EIF3F_ASPOR     IRTQMELSNRLATA
EIF3F_COCIM     IRTQMELSNRLATA
EIF3F_ASPCL     IRTQMELSNRLATA
EIF3F_NEOFI     IRTQMELSNRLATA
EIF3F_ASPFU     IRTQMELSNRLATA
EIF3F_ASPFC     IRTQMELSNRLATA
EI3F2_DROSE     IKTQLEISEKL---
EIF3F_YARLI     VKTQLQLSAKLTT-
EI3F2_DROYA     IKTQLEISEKL---
EIF3F_DICDI     TRSQLAVATKI---
EI3F2_DROSI     IKTQLEISEKL---
EIF3F_SCHPO     LRTQVDIASRL---
EI3F2_DROAN     IKTQLQISEKL---
EIF3F_BOMMO     IKTQLQLNEKL---
EIF3F_MALGO     VSAQAEMSTRLV--
EI3F2_DROPS     IKTQLQLSERL---
EIF3F_ASPTN     IRTQMELSNRLATA
EI3F2_DROPE     IKVQLQLSERL---
EIF3F_MAGGR     IRTQVDLAQRLALA
EI3F2_DROWI     IKAQLKISESVIA-
EIF3F_ARATH     TRTQLSLAEKLNTA
EIF3F_CHAGB     IRTQIDLAQRLATA
EIF3F_NEUCR     IRTQIELSQRLATA
EIF3F_CRYNE     VRSQVELAGRL---
EI3F2_DROVI     IKTQMELSEKL---
EI3F2_DROMO     IKTQMELSEKL---
PSD7_DICDI      IRSIIALHNLIIN-
EI3F2_DROGR     IKTQLELSEKL---
PSD7_ARATH      --------------
PSD7_DROME      VRSIIALH------
CSN6_DICDI      TKTSASLNDTI---
RPN8_SCHPO      --------------
RPN8_ASHGO      --------------
PSD7_MOUSE      IRSVVALH------
PSD7_HUMAN      IRSVVALH------
RPN8_CANGA      --------------
PSD7_BOVIN      IRSVVALH------
RPN8_YEAST      --------------
RPN8_NEUCR      --------------
EIF3H_NEMVE     --------------
CSN6B_ARATH     --------------
CSN6_XENLA      TKT-----------
CSN6_DROME      TKGCNDMH------
EIF3H_ARATH     --------------
EIF3H_DROGR     --------------
EIF3H_BOMMO     --------------
EIF3H_DROYA     --------------
EIF3H_DROVI     --------------
EIF3H_DROSE     --------------
EIF3H_DROPS     --------------
EIF3H_DROMO     --------------
EIF3H_DROME     --------------
EIF3H_DROAN     --------------
CSN6_XENTR      TKT-----------
EIF3H_DROWI     --------------
EIF3H_CULQU     --------------
EIF3H_ANOGA     --------------
EIF3H_AEDAE     --------------
EIF3H_DROER     --------------
RPN11_CANGA     --------------
RPN11_ASHGO     --------------
EI3HA_DANRE     --------------
CSN5_EMENI      --------------
EIF3H_YARLI     --------------
RPN11_YEAST     --------------
EIF3H_XENTR     --------------
EIF3H_XENLA     --------------
EIF3H_TAEGU     --------------
EIF3H_RAT       --------------
EIF3H_MOUSE     --------------
EIF3H_HUMAN     --------------
EIF3H_CHICK     --------------
EIF3H_BOVIN     --------------
CSN6_PONAB      --------------
CSN6_PIG        --------------
CSN6_MOUSE      --------------
CSN6_HUMAN      --------------
PSDE_DROME      --------------
EIF3H_SALSA     --------------
CSN6_BOVIN      --------------
PSDE_ARATH      --------------