[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cele0:CAA93431.1

[Show Plain Result]


## Summary of Sequence Search
    1::305
   33::311     7e-54  42% 1308 aa  TTBK1_MOUSE RecName: Full=Tau-tubulin kinase 1;       
   33::311     7e-54  42% 1321 aa  TTBK1_HUMAN RecName: Full=Tau-tubulin kinase 1;       
   20::298     3e-52  42% 1244 aa  TTBK2_HUMAN RecName: Full=Tau-tubulin kinase 2;       
   20::298     1e-51  41% 1243 aa  TTBK2_MOUSE RecName: Full=Tau-tubulin kinase 2;
   14::293     1e-46  35%  495 aa  Y2354_DICDI RecName: Full=Probable serine/threonine-protein kinase
   10::301     2e-42  37%  346 aa  YMX8_CAEEL RecName: Full=Putative serine/threonine-protein kinase
   71::354     2e-34  32%  363 aa  YKL2_CAEEL RecName: Full=Putative casein kinase I C03C10.2;        
   14::221     1e-30  39%  331 aa  YOO1_CAEEL RecName: Full=Putative serine/threonine-protein kinase
   16::295     4e-30  33%  435 aa  CKI2_SCHPO RecName: Full=Casein kinase I homolog 2;       
    7::290     5e-29  33%  426 aa  KC1_DICDI RecName: Full=Casein kinase I;         Short=CK1;        
    1::290     8e-29  33%  416 aa  KC1E_MOUSE RecName: Full=Casein kinase I isoform epsilon;       
    1::290     8e-29  33%  416 aa  KC1E_HUMAN RecName: Full=Casein kinase I isoform epsilon;       
    8::290     1e-28  32%  323 aa  KC1_PLAF7 RecName: Full=Casein kinase I;         EC=2.7.11.1;
    1::290     1e-28  33%  416 aa  KC1E_CHICK RecName: Full=Casein kinase I isoform epsilon;       
    1::290     1e-28  31%  415 aa  KC1D_XENTR RecName: Full=Casein kinase I isoform delta;       
    1::290     1e-28  31%  415 aa  KC1D_XENLA RecName: Full=Casein kinase I isoform delta;       
    8::290     1e-28  32%  323 aa  KC1_PLAYO RecName: Full=Casein kinase I;         EC=2.7.11.1;
    1::290     1e-28  31%  409 aa  KC1DB_DANRE RecName: Full=Casein kinase I isoform delta-B;       
    1::290     1e-28  31%  403 aa  KC1DA_DANRE RecName: Full=Casein kinase I isoform delta-A;       
    1::290     2e-28  31%  415 aa  KC1D_RAT RecName: Full=Casein kinase I isoform delta;       
    1::290     2e-28  31%  415 aa  KC1D_MOUSE RecName: Full=Casein kinase I isoform delta;       
    1::290     2e-28  31%  415 aa  KC1D_HUMAN RecName: Full=Casein kinase I isoform delta;       
    1::290     2e-28  31%  415 aa  KC1D_BOVIN RecName: Full=Casein kinase I isoform delta;       
   15::298     2e-28  32%  325 aa  KC1A_RAT RecName: Full=Casein kinase I isoform alpha;       
    1::290     2e-28  31%  415 aa  KC1D_PONAB RecName: Full=Casein kinase I isoform delta;       
   18::301     3e-28  31%  337 aa  KC1A_DROME RecName: Full=Casein kinase I isoform alpha;       
   76::359     3e-28  32%  546 aa  KC12_YEAST RecName: Full=Casein kinase I homolog 2;       
    7::290     4e-28  31%  324 aa  KC1_TOXGO RecName: Full=Casein kinase I;         EC=2.7.11.1;
    8::290     4e-28  32%  324 aa  KC1_PLAF4 RecName: Full=Casein kinase I;         EC=2.7.11.1;
   10::292     4e-28  34%  365 aa  HHP1_SCHPO RecName: Full=Casein kinase I homolog hhp1;       
   15::298     7e-28  32%  337 aa  KC1A_XENLA RecName: Full=Casein kinase I isoform alpha;       
   15::298     7e-28  32%  325 aa  KC1A_SHEEP RecName: Full=Casein kinase I isoform alpha;       
   15::298     7e-28  32%  325 aa  KC1A_RABIT RecName: Full=Casein kinase I isoform alpha;       
   15::298     7e-28  32%  337 aa  KC1A_MOUSE RecName: Full=Casein kinase I isoform alpha;       
   15::298     7e-28  32%  337 aa  KC1A_HUMAN RecName: Full=Casein kinase I isoform alpha;       
   15::298     7e-28  32%  337 aa  KC1A_CHICK RecName: Full=Casein kinase I isoform alpha;       
   15::298     7e-28  32%  325 aa  KC1A_BOVIN RecName: Full=Casein kinase I isoform alpha;       
    8::290     9e-28  30%  450 aa  KC1D_ARATH RecName: Full=Casein kinase I isoform delta-like;       
   15::297     3e-27  31%  341 aa  KC1A_CAEEL RecName: Full=Casein kinase I isoform alpha;       
   69::352     4e-27  31%  538 aa  KC11_YEAST RecName: Full=Casein kinase I homolog 1;       
    1::290     4e-27  30%  440 aa  DCO_DROME RecName: Full=Discs overgrown protein kinase;       
   25::247     7e-27  38%  374 aa  YOO3_CAEEL RecName: Full=Putative serine/threonine-protein kinase
   77::360     1e-26  31%  536 aa  RAG8_KLULA RecName: Full=Casein kinase I homolog RAG8;       
   15::298     2e-26  31%  337 aa  KC1AL_HUMAN RecName: Full=Casein kinase I isoform alpha-like;      
  183::471     2e-26  31%  497 aa  KIN20_CAEEL RecName: Full=Casein kinase I isoform delta;       
    7::290     2e-26  31%  335 aa  KC1_EIMTE RecName: Full=Casein kinase I;         EC=2.7.11.1;
   19::298     2e-26  29%  439 aa  CKI3_SCHPO RecName: Full=Casein kinase I homolog 3;       
    8::290     4e-26  32%  494 aa  HRR25_YEAST RecName: Full=Casein kinase I homolog HRR25;       
    3::291     5e-26  31%  400 aa  HHP2_SCHPO RecName: Full=Casein kinase I homolog hhp2;       
   15::273     3e-25  33%  336 aa  KC1B_BOVIN RecName: Full=Casein kinase I isoform beta;       
   48::328     3e-24  32%  381 aa  KC1G1_MACFA RecName: Full=Casein kinase I isoform gamma-1;       
   48::328     3e-24  32%  422 aa  KC1G1_HUMAN RecName: Full=Casein kinase I isoform gamma-1;       
   48::327     4e-24  30%  421 aa  KC1G1_DANRE RecName: Full=Casein kinase I isoform gamma-1;       
   30::249     6e-24  36%  290 aa  YQI1_CAEEL RecName: Full=Uncharacterized protein C45G9.1;
   47::325     6e-24  30%  448 aa  KC1G3_RAT RecName: Full=Casein kinase I isoform gamma-3;       
   47::325     6e-24  30%  424 aa  KC1G3_MOUSE RecName: Full=Casein kinase I isoform gamma-3;       
   48::328     6e-24  32%  459 aa  KC1G1_MOUSE RecName: Full=Casein kinase I isoform gamma-1;       
   10::276     8e-24  31%  304 aa  KC11_ENCCU RecName: Full=Probable casein kinase I homolog
   47::327     1e-23  32%  457 aa  KC1G1_BOVIN RecName: Full=Casein kinase I isoform gamma-1;       
   48::328     1e-23  30%  390 aa  KC1G1_RAT RecName: Full=Casein kinase I isoform gamma-1;       
   47::325     2e-23  30%  456 aa  KC1G3_PONAB RecName: Full=Casein kinase I isoform gamma-3;       
  111::327     2e-23  31%  456 aa  KC1G1_CHICK RecName: Full=Casein kinase I isoform gamma-1;       
   50::329     4e-23  29%  415 aa  KC1G2_RAT RecName: Full=Casein kinase I isoform gamma-2;       
   50::329     4e-23  29%  415 aa  KC1G2_MOUSE RecName: Full=Casein kinase I isoform gamma-2;       
   50::329     6e-23  29%  415 aa  KC1G2_HUMAN RecName: Full=Casein kinase I isoform gamma-2;       
  102::295     6e-23  33%  446 aa  CKI1_SCHPO RecName: Full=Casein kinase I homolog 1;       
   47::324     8e-23  30%  447 aa  KC1G3_HUMAN RecName: Full=Casein kinase I isoform gamma-3;       
  112::328     1e-22  29%  460 aa  KC1G1_XENLA RecName: Full=Casein kinase I isoform gamma-1;       
  100::332     4e-22  32%  524 aa  KC13_YEAST RecName: Full=Casein kinase I homolog 3;       
   33::238     2e-21  34%  276 aa  KC1G3_BOVIN RecName: Full=Casein kinase I isoform gamma-3;       
   25::250     2e-18  29%  508 aa  VRK2_HUMAN RecName: Full=Serine/threonine-protein kinase VRK2;     
    8::280     4e-17  28%  318 aa  KC12_ENCCU RecName: Full=Probable casein kinase I homolog
  126::343     1e-15  28%  411 aa  389L_IIV6 RecName: Full=Probable serine/threonine-protein kinase
   15::294     2e-15  24%  300 aa  VPK1_VARV RecName: Full=Serine/threonine-protein kinase 1;       
   15::294     2e-15  24%  300 aa  VPK1_VACCW RecName: Full=Serine/threonine-protein kinase 1;        
   15::294     2e-15  24%  300 aa  VPK1_VACCA RecName: Full=Serine/threonine-protein kinase 1;        
   15::294     3e-15  24%  300 aa  VPK1_VACCC RecName: Full=Serine/threonine-protein kinase 1;        
   13::250     1e-14  27%  503 aa  VRK2_MOUSE RecName: Full=Serine/threonine-protein kinase VRK2;     
   37::336     2e-14  25%  425 aa  VRK1_DANRE RecName: Full=Serine/threonine-protein kinase VRK1;     
   36::263     2e-14  27%  396 aa  VRK1_BOVIN RecName: Full=Serine/threonine-protein kinase VRK1;     
   24::243     5e-14  30%  303 aa  V212_FOWPV RecName: Full=Probable serine/threonine-protein kinase
    7::166     9e-14  32%  706 aa  ZYG1_CAEEL RecName: Full=Probable serine/threonine-protein kinase
   20::187     1e-13  29%  559 aa  MDE3_SCHPO RecName: Full=Sporulation protein kinase mde3;       
   36::263     2e-13  27%  440 aa  VRK1_MOUSE RecName: Full=Serine/threonine-protein kinase VRK1;     
   12::156     2e-13  40%  295 aa  MYLKA_DICDI RecName: Full=Myosin light chain kinase A;       
   36::263     5e-13  26%  396 aa  VRK1_HUMAN RecName: Full=Serine/threonine-protein kinase VRK1;     
   45::264     5e-13  29%  599 aa  NHK1_DROME RecName: Full=Nucleosomal histone kinase 1;       
 1175::1383    1e-12  34% 1478 aa  BCK1_YEAST RecName: Full=Serine/threonine-protein kinase
    3::207     3e-12  31%  309 aa  Y8H9_ENCCU RecName: Full=Probable cell division protein kinase
   46::125     3e-12  39%  125 aa  KC1A_PIG RecName: Full=Casein kinase I isoform alpha;       
   93::281     4e-12  31%  469 aa  ORB6_SCHPO RecName: Full=Serine/threonine-protein kinase orb6;     
   23::234     1e-11  29%  493 aa  CHK1_CAEBR RecName: Full=Serine/threonine-protein kinase chk-1;    
   38::201     1e-11  34%  591 aa  CDK9_SCHPO RecName: Full=Serine/threonine-protein kinase cdk9;     
   36::190     2e-11  29%  650 aa  PIT1_SCHPO RecName: Full=Sporulation protein kinase pit1;       
    4::150     2e-11  34%  313 aa  MYLKD_DICDI RecName: Full=Probable myosin light chain kinase
    3::151     2e-11  35%  292 aa  CDK5_DICDI RecName: Full=Cell division protein kinase 5 homolog;   
  393::605     4e-11  27%  659 aa  BYR2_SCHPO RecName: Full=Protein kinase byr2;       
   11::217     6e-11  29%  830 aa  PKN2_MYXXA RecName: Full=Serine/threonine-protein kinase pkn2;     
   26::225     6e-11  33%  476 aa  KCC1G_RAT RecName: Full=Calcium/calmodulin-dependent protein kinase
   26::225     6e-11  33%  477 aa  KCC1G_MOUSE RecName: Full=Calcium/calmodulin-dependent protein
  355::559     7e-11  32%  642 aa  STE20_PENMA RecName: Full=Serine/threonine-protein kinase pakA;    
  129::342     7e-11  28%  766 aa  PKH1_YEAST RecName: Full=Serine/threonine-protein kinase PKH1;     
  169::377     7e-11  32%  942 aa  MKKA_DICDI RecName: Full=Mitogen-activated protein kinase kinase
   26::225     7e-11  33%  476 aa  KCC1G_HUMAN RecName: Full=Calcium/calmodulin-dependent protein
    7::152     7e-11  32%  305 aa  CDK3_HUMAN RecName: Full=Cell division protein kinase 3;       
  311::478     7e-11  32%  730 aa  CD2L7_CAEEL RecName: Full=Putative cell division cycle 2-related
    7::152     1e-10  32%  303 aa  CDK3_MOUSE RecName: Full=Cell division protein kinase 3;       
  756::903     1e-10  29% 1350 aa  Y1558_DICDI RecName: Full=Probable serine/threonine-protein kinase
   95::236     2e-10  37%  458 aa  ST38L_DROPS RecName: Full=Serine/threonine-protein kinase 38-like; 
  526::666     2e-10  32%  926 aa  ERN2_HUMAN RecName: Full=Serine/threonine-protein
   54::212     2e-10  33%  538 aa  CDPKW_ARATH RecName: Full=Calcium-dependent protein kinase 32;     
   92::233     2e-10  36%  465 aa  STK38_PONAB RecName: Full=Serine/threonine-protein kinase 38;      
   92::233     2e-10  36%  465 aa  STK38_MOUSE RecName: Full=Serine/threonine-protein kinase 38;      
   92::233     2e-10  36%  465 aa  STK38_HUMAN RecName: Full=Serine/threonine-protein kinase 38;      
   92::233     2e-10  36%  465 aa  STK38_BOVIN RecName: Full=Serine/threonine-protein kinase 38;      
   20::254     2e-10  26%  323 aa  RAF_MSV36 RecName: Full=Serine/threonine-protein
  345::579     2e-10  26%  648 aa  RAF1_MOUSE RecName: Full=RAF proto-oncogene
  272::534     3e-10  23%  536 aa  YRK_CHICK RecName: Full=Proto-oncogene tyrosine-protein kinase Yrk;
  679::872     3e-10  32%  954 aa  STE20_NEUCR RecName: Full=Serine/threonine-protein kinase ste-20;  
  107::324     3e-10  29%  571 aa  CDPKG_ARATH RecName: Full=Calcium-dependent protein kinase 16;     
   93::234     4e-10  36%  464 aa  ST38L_HUMAN RecName: Full=Serine/threonine-protein kinase 38-like; 
   96::237     4e-10  37%  463 aa  ST38L_DROME RecName: Full=Serine/threonine-protein kinase 38-like; 
   62::280     4e-10  31%  733 aa  KS6AA_XENLA RecName: Full=Ribosomal protein S6 kinase 2 alpha;     
   64::280     4e-10  31%  735 aa  KS6A1_HUMAN RecName: Full=Ribosomal protein S6 kinase alpha-1;     
   29::176     4e-10  36%  385 aa  KCC1D_MOUSE RecName: Full=Calcium/calmodulin-dependent protein
   29::176     4e-10  36%  385 aa  KCC1D_HUMAN RecName: Full=Calcium/calmodulin-dependent protein
   83::238     4e-10  35%  639 aa  DMPK_HUMAN RecName: Full=Myotonin-protein kinase;       
  345::579     5e-10  26%  648 aa  RAF1_RAT RecName: Full=RAF proto-oncogene serine/threonine-protein
   62::280     5e-10  31%  629 aa  KS6AB_XENLA RecName: Full=Ribosomal protein S6 kinase 2 beta;      
  283::542     6e-10  23%  544 aa  YES_XIPHE RecName: Full=Tyrosine-protein kinase Yes;       
    9::216     6e-10  28%  626 aa  PKNH_MYCTU RecName: Full=Probable serine/threonine-protein kinase
    9::216     6e-10  28%  596 aa  PKNH_MYCBO RecName: Full=Probable serine/threonine-protein kinase
   64::280     6e-10  31%  735 aa  KS6A1_RAT RecName: Full=Ribosomal protein S6 kinase alpha-1;       
  210::380     6e-10  33%  588 aa  CBK1_YARLI RecName: Full=Serine/threonine-protein kinase CBK1;     
  280::539     8e-10  24%  541 aa  YES_CHICK RecName: Full=Tyrosine-protein kinase Yes;       
  205::373     8e-10  35%  595 aa  FHKC_DICDI RecName: Full=Probable serine/threonine-protein kinase
  537::732     1e-09  32%  815 aa  STE20_ASPFU RecName: Full=Serine/threonine-protein kinase ste20;   
  345::622     1e-09  27%  648 aa  RAF1_PONAB RecName: Full=RAF proto-oncogene
  345::622     1e-09  27%  648 aa  RAF1_HUMAN RecName: Full=RAF proto-oncogene
  487::654     1e-09  30%  911 aa  ERN2_MOUSE RecName: Full=Serine/threonine-protein
   71::282     1e-09  27%  513 aa  CDPK2_PLAFK RecName: Full=Calcium-dependent protein kinase 2;      
   71::282     1e-09  27%  509 aa  CDPK2_PLAF7 RecName: Full=Calcium-dependent protein kinase 2;      
  146::365     1e-09  33%  600 aa  CAMK1_ORYSJ RecName: Full=Calcium/calmodulin-dependent
  280::537     1e-09  23%  541 aa  YES_MOUSE RecName: Full=Proto-oncogene tyrosine-protein kinase Yes;
  282::539     1e-09  23%  543 aa  YES_HUMAN RecName: Full=Proto-oncogene tyrosine-protein kinase Yes;
  230::442     1e-09  21%  451 aa  VRK3_BOVIN RecName: Full=Serine/threonine-protein kinase VRK3;     
  345::548     1e-09  29%  638 aa  RAF1_XENLA RecName: Full=RAF proto-oncogene
  345::622     1e-09  26%  648 aa  RAF1_BOVIN RecName: Full=RAF proto-oncogene
  247::507     1e-09  22%  509 aa  LCK_AOTNA RecName: Full=Proto-oncogene tyrosine-protein kinase LCK;
   79::298     1e-09  30%  752 aa  KS6AA_CHICK RecName: Full=Ribosomal protein S6 kinase 2 alpha;     
   47::186     1e-09  31%  474 aa  KCC4_RAT RecName: Full=Calcium/calmodulin-dependent protein kinase
   51::190     1e-09  31%  473 aa  KCC4_HUMAN RecName: Full=Calcium/calmodulin-dependent protein
   27::237     1e-09  28%  414 aa  KCC1_EMENI RecName: Full=Calcium/calmodulin-dependent protein
    4::153     1e-09  29%  297 aa  CDC2_BOVIN RecName: Full=Cell division control protein 2 homolog;  
  524::736     2e-09  29%  856 aa  TTK_MOUSE RecName: Full=Dual specificity protein kinase TTK;       
  525::737     2e-09  29%  857 aa  TTK_HUMAN RecName: Full=Dual specificity protein kinase TTK;       
  345::579     2e-09  25%  647 aa  RAF1_CHICK RecName: Full=RAF proto-oncogene
   40::201     2e-09  35%  355 aa  PRKX_MOUSE RecName: Full=Serine/threonine-protein kinase PRKX;     
   14::224     2e-09  25%  726 aa  PKH3_ASHGO RecName: Full=Serine/threonine-protein kinase PKH3;     
   22::232     2e-09  27%  382 aa  KCC1_METAN RecName: Full=Calcium/calmodulin-dependent protein
    1::175     2e-09  31%  372 aa  CDK9_CHICK RecName: Full=Cell division protein kinase 9;       
    8::179     2e-09  31%  376 aa  CDK9B_XENLA RecName: Full=Cell division protein kinase 9-B;        
    3::151     2e-09  33%  292 aa  CDK5_RAT RecName: Full=Cell division protein kinase 5;       
    7::153     2e-09  30%  303 aa  CDC2_ORYLU RecName: Full=Cell division control protein 2 homolog;  
    7::153     2e-09  30%  303 aa  CDC2_ORYLA RecName: Full=Cell division control protein 2 homolog;  
    7::153     2e-09  30%  303 aa  CDC2_ORYJA RecName: Full=Cell division control protein 2 homolog;  
  698::866     2e-09  29% 1511 aa  CD2L5_MOUSE RecName: Full=Cell division cycle 2-like protein kinase
  698::866     2e-09  29% 1512 aa  CD2L5_HUMAN RecName: Full=Cell division cycle 2-like protein kinase
  129::274     2e-09  33%  507 aa  CBK1_PNECA RecName: Full=Serine/threonine-protein kinase CBK1;     
  278::523     2e-09  24%  539 aa  YES_CANFA RecName: Full=Proto-oncogene tyrosine-protein kinase Yes;
   44::211     2e-09  33%  495 aa  SPKF_SYNY3 RecName: Full=Serine/threonine-protein kinase F;        
   33::183     2e-09  35%  612 aa  SNF1_CANGA RecName: Full=Carbon catabolite-derepressing protein
   51::251     2e-09  32%  620 aa  SNF1_CANAL RecName: Full=Carbon catabolite-derepressing protein
  274::478     2e-09  28%  908 aa  PDPKB_DICDI RecName: Full=3-phosphoinositide-dependent protein
  247::507     2e-09  22%  509 aa  LCK_HUMAN RecName: Full=Proto-oncogene tyrosine-protein kinase LCK;
   47::186     2e-09  31%  469 aa  KCC4_MOUSE RecName: Full=Calcium/calmodulin-dependent protein
  266::520     2e-09  24%  526 aa  HCK_HUMAN RecName: Full=Tyrosine-protein kinase HCK;       
   79::241     2e-09  31%  532 aa  CDPK_DAUCA RecName: Full=Calcium-dependent protein kinase;       
    7::173     2e-09  34%  324 aa  CDC2_AJECA RecName: Full=Cell division control protein 2;       
  524::736     3e-09  30%  856 aa  TTK_MACFA RecName: Full=Dual specificity protein kinase TTK;       
  570::765     3e-09  32%  848 aa  STE20_ASPOR RecName: Full=Serine/threonine-protein kinase ste20;   
   52::204     3e-09  34%  358 aa  PRKX_HUMAN RecName: Full=Serine/threonine-protein kinase PRKX;     
  244::498     3e-09  23%  504 aa  HCK_MACFA RecName: Full=Tyrosine-protein kinase HCK;       
    3::151     3e-09  33%  292 aa  CDK5_MOUSE RecName: Full=Cell division protein kinase 5;       
    3::151     3e-09  33%  292 aa  CDK5_HUMAN RecName: Full=Cell division protein kinase 5;       
    3::151     3e-09  33%  292 aa  CDK5_BOVIN RecName: Full=Cell division protein kinase 5;       
   44::201     3e-09  33%  358 aa  CDK11_DICDI RecName: Full=PITSVRE serine/threonine protein-kinase
    4::153     3e-09  29%  297 aa  CDC2_PONAB RecName: Full=Cell division control protein 2 homolog;  
    4::153     3e-09  29%  297 aa  CDC2_HUMAN RecName: Full=Cell division control protein 2 homolog;  
    7::156     4e-09  30%  709 aa  ZYG1_CAEBR RecName: Full=Probable serine/threonine-protein kinase
   32::171     4e-09  31%  485 aa  STK4_XENTR RecName: Full=Serine/threonine-protein kinase 4;        
  639::832     4e-09  31%  914 aa  STE20_MAGGR RecName: Full=Serine/threonine-protein kinase MST20;   
   67::273     4e-09  30%  651 aa  M3K3_ARATH RecName: Full=Mitogen-activated protein kinase kinase
   73::228     4e-09  33%  631 aa  DMPK_MOUSE RecName: Full=Myotonin-protein kinase;       
   62::275     4e-09  31%  523 aa  CDPKS_ARATH RecName: Full=Calcium-dependent protein kinase 28;     
    1::179     4e-09  31%  376 aa  CDK9_XENTR RecName: Full=Cell division protein kinase 9;       
    1::179     4e-09  31%  376 aa  CDK9A_XENLA RecName: Full=Cell division protein kinase 9-A;        
    3::151     4e-09  32%  292 aa  CDK5_XENLA RecName: Full=Cell division protein kinase 5;       
    7::153     4e-09  29%  303 aa  CDC2_ORYCU RecName: Full=Cell division control protein 2 homolog;  
    4::153     4e-09  29%  303 aa  CDC2_CHICK RecName: Full=Cell division control protein 2 homolog;  
   87::289     4e-09  31%  355 aa  ARK1_SCHPO RecName: Full=Serine/threonine-protein kinase ark1;     
  355::509     5e-09  27%  719 aa  YP62_CAEEL RecName: Full=Putative serine/threonine-protein kinase
  272::517     5e-09  24%  528 aa  YES_AVISY RecName: Full=Tyrosine-protein kinase transforming
   93::234     5e-09  33%  464 aa  ST38L_MOUSE RecName: Full=Serine/threonine-protein kinase 38-like; 
   65::275     5e-09  28%  367 aa  RMIL_AVII1 RecName: Full=Serine/threonine-protein
   81::291     5e-09  28%  450 aa  RMIL_AVEVR RecName: Full=Serine/threonine-protein
   89::286     5e-09  27%  559 aa  PDPK1_MOUSE RecName: Full=3-phosphoinositide-dependent protein
   86::283     5e-09  27%  556 aa  PDPK1_HUMAN RecName: Full=3-phosphoinositide-dependent protein
  242::445     5e-09  28%  524 aa  PAK2_RAT RecName: Full=Serine/threonine-protein kinase PAK 2;      
  242::445     5e-09  28%  524 aa  PAK2_RABIT RecName: Full=Serine/threonine-protein kinase PAK 2;    
  242::445     5e-09  28%  524 aa  PAK2_MOUSE RecName: Full=Serine/threonine-protein kinase PAK 2;    
  242::445     5e-09  28%  524 aa  PAK2_HUMAN RecName: Full=Serine/threonine-protein kinase PAK 2;    
  262::465     5e-09  29%  544 aa  PAK1_RAT RecName: Full=Serine/threonine-protein kinase PAK 1;      
  263::466     5e-09  29%  545 aa  PAK1_MOUSE RecName: Full=Serine/threonine-protein kinase PAK 1;    
  263::466     5e-09  29%  545 aa  PAK1_HUMAN RecName: Full=Serine/threonine-protein kinase PAK 1;    
  262::465     5e-09  29%  544 aa  PAK1_BOVIN RecName: Full=Serine/threonine-protein kinase PAK 1;    
    3::158     5e-09  33%  418 aa  NEK2_DICDI RecName: Full=Probable serine/threonine-protein kinase
  249::498     5e-09  23%  512 aa  LYN_MOUSE RecName: Full=Tyrosine-protein kinase Lyn;       
  247::507     5e-09  22%  509 aa  LCK_SAISC RecName: Full=Proto-oncogene tyrosine-protein kinase LCK;
   64::193     5e-09  34%  504 aa  KCC2_SCHPO RecName: Full=Calcium/calmodulin-dependent protein
   26::167     5e-09  36%  370 aa  KCC1A_HUMAN RecName: Full=Calcium/calmodulin-dependent protein
  612::750     5e-09  29%  977 aa  ERN1_HUMAN RecName: Full=Serine/threonine-protein
    3::149     5e-09  34%  342 aa  CDKL4_MOUSE RecName: Full=Cyclin-dependent kinase-like 4;       
   43::201     5e-09  32%  380 aa  CDK8_DICDI RecName: Full=Probable cyclin-dependent kinase 8;       
  492::702     5e-09  28%  804 aa  BRAF1_MOUSE RecName: Full=B-Raf proto-oncogene
  455::665     5e-09  28%  766 aa  BRAF1_HUMAN RecName: Full=B-Raf proto-oncogene
  495::705     5e-09  28%  807 aa  BRAF1_COTJA RecName: Full=B-Raf proto-oncogene
  495::705     5e-09  28%  806 aa  BRAF1_CHICK RecName: Full=B-Raf proto-oncogene
  475::668     7e-09  31%  746 aa  STE20_USTMA RecName: Full=Serine/threonine-protein kinase SMU1;    
  570::765     7e-09  31%  848 aa  STE20_EMENI RecName: Full=Serine/threonine-protein kinase ste20;   
   15::235     7e-09  26%  898 aa  PKH3_YEAST RecName: Full=Serine/threonine-protein kinase PKH3;     
   10::171     7e-09  31%  652 aa  NAK1_SCHPO RecName: Full=Serine/threonine-protein kinase nak1;     
  707::852     7e-09  36% 1129 aa  LATS1_MOUSE RecName: Full=Serine/threonine-protein kinase LATS1;   
  708::853     7e-09  36% 1130 aa  LATS1_HUMAN RecName: Full=Serine/threonine-protein kinase LATS1;   
   47::199     7e-09  36%  351 aa  KAPCA_RAT RecName: Full=cAMP-dependent protein kinase catalytic
   47::199     7e-09  36%  351 aa  KAPCA_MOUSE RecName: Full=cAMP-dependent protein kinase catalytic
   72::274     7e-09  32%  520 aa  CIPKI_ARATH RecName: Full=CBL-interacting serine/threonine-protein
    7::152     7e-09  28%  297 aa  CDK2_XENLA RecName: Full=Cell division protein kinase 2;       
  716::884     7e-09  29% 1484 aa  CD2L7_RAT RecName: Full=Cell division cycle 2-related protein
  716::884     7e-09  29% 1484 aa  CD2L7_MOUSE RecName: Full=Cell division cycle 2-related protein
  253::400     9e-09  23%  474 aa  VRK3_HUMAN RecName: Full=Serine/threonine-protein kinase VRK3;     
  116::409     9e-09  31%  486 aa  STK33_BOVIN RecName: Full=Serine/threonine-protein kinase 33;      
  614::759     9e-09  33%  915 aa  STE20_CANGA RecName: Full=Serine/threonine-protein kinase STE20;   
   28::175     9e-09  32%  363 aa  MK12_DANRE RecName: Full=Mitogen-activated protein kinase 12;      
   51::270     9e-09  29%  447 aa  KCC2_YEAST RecName: Full=Calcium/calmodulin-dependent protein
   47::199     9e-09  36%  351 aa  KAPCA_HUMAN RecName: Full=cAMP-dependent protein kinase catalytic
   47::199     9e-09  36%  351 aa  KAPCA_CRIGR RecName: Full=cAMP-dependent protein kinase catalytic
  273::535     9e-09  23%  537 aa  FYN_XENLA RecName: Full=Proto-oncogene tyrosine-protein kinase Fyn;
  273::474     9e-09  24%  537 aa  FYN_MOUSE RecName: Full=Proto-oncogene tyrosine-protein kinase Fyn;
   26::180     9e-09  37%  454 aa  CDK8_DROME RecName: Full=Cell division protein kinase 8;       
    7::153     9e-09  28%  297 aa  CDC2_MOUSE RecName: Full=Cell division control protein 2 homolog;  
    7::153     9e-09  30%  302 aa  CDC2_CARAU RecName: Full=Cell division control protein 2 homolog;  
  806::965     1e-08  30% 1157 aa  Y7597_DROME RecName: Full=Cell division cycle 2-like protein kinase
  232::445     1e-08  22%  453 aa  VRK3_MOUSE RecName: Full=Serine/threonine-protein kinase VRK3;     
  111::333     1e-08  32%  491 aa  STK33_MOUSE RecName: Full=Serine/threonine-protein kinase 33;      
    9::149     1e-08  34%  312 aa  PPK11_SCHPO RecName: Full=Serine/threonine-protein kinase ppk11;   
   89::286     1e-08  27%  559 aa  PDPK1_RAT RecName: Full=3-phosphoinositide-dependent protein kinase
  223::370     1e-08  27%  493 aa  PAKC_DICDI RecName: Full=Serine/threonine-protein kinase pakC;     
  288::491     1e-08  29%  572 aa  PAK1_CAEEL RecName: Full=Serine/threonine-protein kinase pak-1;    
   78::312     1e-08  25%  380 aa  MIL_AVIMH RecName: Full=Serine/threonine-protein
  249::498     1e-08  23%  512 aa  LYN_RAT RecName: Full=Tyrosine-protein kinase Lyn;       
  561::710     1e-08  32%  952 aa  KP58_DROME RecName: Full=Serine/threonine-protein kinase PITSLRE;  
   46::198     1e-08  34%  209 aa  KAPCG_MACMU RecName: Full=cAMP-dependent protein kinase catalytic
    9::208     1e-08  33%  474 aa  CHK1_XENLA RecName: Full=Serine/threonine-protein kinase Chk1;     
    6::161     1e-08  34%  938 aa  CDKL5_MOUSE RecName: Full=Cyclin-dependent kinase-like 5;       
    6::161     1e-08  34% 1030 aa  CDKL5_HUMAN RecName: Full=Cyclin-dependent kinase-like 5;       
    7::153     1e-08  28%  297 aa  CDC2_RAT RecName: Full=Cell division control protein 2 homolog;    
   32::171     2e-08  33%  485 aa  STK4_XENLA RecName: Full=Serine/threonine-protein kinase 4;        
  261::464     2e-08  28%  544 aa  PAK3_RAT RecName: Full=Serine/threonine-protein kinase PAK 3;      
  276::479     2e-08  28%  559 aa  PAK3_PONPY RecName: Full=Serine/threonine-protein kinase PAK 3;    
  276::479     2e-08  28%  559 aa  PAK3_PANTR RecName: Full=Serine/threonine-protein kinase PAK 3;    
  276::479     2e-08  28%  559 aa  PAK3_MOUSE RecName: Full=Serine/threonine-protein kinase PAK 3;    
  276::479     2e-08  28%  559 aa  PAK3_HUMAN RecName: Full=Serine/threonine-protein kinase PAK 3;    
   92::307     2e-08  28%  764 aa  KS6A6_MOUSE RecName: Full=Ribosomal protein S6 kinase alpha-6;     
  420::572     2e-08  31%  789 aa  KS6A5_CHICK RecName: Full=Ribosomal protein S6 kinase alpha-5;     
  136::331     2e-08  32%  465 aa  KPK1_ARATH RecName: Full=Serine/threonine-protein kinase
  142::337     2e-08  32%  471 aa  KPK19_ARATH RecName: Full=Serine/threonine-protein kinase AtPK19;  
   26::167     2e-08  36%  374 aa  KCC1A_RAT RecName: Full=Calcium/calmodulin-dependent protein kinase
   26::167     2e-08  36%  374 aa  KCC1A_MOUSE RecName: Full=Calcium/calmodulin-dependent protein
  264::518     2e-08  24%  524 aa  HCK_MOUSE RecName: Full=Tyrosine-protein kinase HCK;       
  273::535     2e-08  23%  537 aa  FYN_XIPHE RecName: Full=Proto-oncogene tyrosine-protein kinase FYN;
  273::474     2e-08  24%  537 aa  FYN_RAT RecName: Full=Proto-oncogene tyrosine-protein kinase Fyn;  
  273::474     2e-08  24%  537 aa  FYN_PIG RecName: Full=Proto-oncogene tyrosine-protein kinase Fyn;  
  273::474     2e-08  24%  537 aa  FYN_HUMAN RecName: Full=Proto-oncogene tyrosine-protein kinase Fyn;
  273::474     2e-08  24%  537 aa  FYN_BOVIN RecName: Full=Proto-oncogene tyrosine-protein kinase Fyn;
  612::719     2e-08  30%  977 aa  ERN1_MOUSE RecName: Full=Serine/threonine-protein
   59::281     2e-08  29%  524 aa  CDPK1_PLAFK RecName: Full=Calcium-dependent protein kinase 1;      
   59::281     2e-08  29%  524 aa  CDPK1_PLAF7 RecName: Full=Calcium-dependent protein kinase 1;      
    3::149     2e-08  31%  350 aa  CDKL1_DANRE RecName: Full=Cyclin-dependent kinase-like 1;       
   26::180     2e-08  35%  501 aa  CDK8_AEDAE RecName: Full=Cell division protein kinase 8;       
    8::153     2e-08  29%  296 aa  CDC28_ENCCU RecName: Full=Probable cell division control protein 28
  720::888     2e-08  29% 1490 aa  CD2L7_HUMAN RecName: Full=Cell division cycle 2-related protein
    8::152     2e-08  32%  301 aa  CC2H1_TRYCO RecName: Full=Cell division control protein 2 homolog
  355::500     2e-08  32%  756 aa  CBK1_YEAST RecName: Full=Serine/threonine-protein kinase CBK1;     
  310::572     2e-08  26%  604 aa  ARAF_RAT RecName: Full=A-Raf proto-oncogene
  310::572     2e-08  26%  604 aa  ARAF_MOUSE RecName: Full=A-Raf proto-oncogene
  114::252     2e-08  30%  467 aa  AFC1_ARATH RecName: Full=Serine/threonine-protein kinase AFC1;     
  244::498     2e-08  24%  509 aa  STK_HYDAT RecName: Full=Tyrosine-protein kinase STK;       
  794::941     2e-08  32% 1770 aa  RIM15_YEAST RecName: Full=Serine/threonine-protein kinase RIM15;   
   93::224     2e-08  37%  690 aa  PKNB_BIFLO RecName: Full=Probable serine/threonine-protein kinase
  449::631     2e-08  35%  981 aa  NEKL4_CAEEL RecName: Full=Serine/threonine-protein kinase D1044.8; 
  247::507     2e-08  22%  509 aa  LCK_RAT RecName: Full=Proto-oncogene tyrosine-protein kinase LCK;  
  430::640     2e-08  29%  802 aa  KS6A5_PONAB RecName: Full=Ribosomal protein S6 kinase alpha-5;     
  274::480     2e-08  30%  583 aa  KDC2_DROME RecName: Full=Protein kinase DC2;         EC=2.7.11.1;
   47::199     2e-08  30%  351 aa  KAPCG_HUMAN RecName: Full=cAMP-dependent protein kinase catalytic
  264::518     2e-08  24%  524 aa  HCK_RAT RecName: Full=Tyrosine-protein kinase HCK;       
  389::537     2e-08  31%  740 aa  DCLK1_HUMAN RecName: Full=Serine/threonine-protein kinase DCLK1;   
  217::362     2e-08  35%  598 aa  COT1_NEUCR RecName: Full=Serine/threonine-protein kinase cot-1;    
   17::171     2e-08  34%  312 aa  CDC2D_ANTMA RecName: Full=Cell division control protein 2 homolog
  376::518     2e-08  33%  773 aa  CBK1_CANGA RecName: Full=Serine/threonine-protein kinase CBK1;     
  276::535     3e-08  23%  537 aa  YES_XENLA RecName: Full=Tyrosine-protein kinase Yes;       
  138::302     3e-08  36%  562 aa  STT7_ARATH RecName: Full=Serine/threonine-protein kinase SNT7,
   49::199     3e-08  34%  633 aa  SNF1_YEAST RecName: Full=Carbon catabolite-derepressing protein
   59::256     3e-08  27%  396 aa  PDPK2_HUMAN RecName: Full=Putative 3-phosphoinositide-dependent
  114::262     3e-08  29%  530 aa  NDRA_DICDI RecName: Full=Probable serine/threonine-protein kinase
  430::640     3e-08  29%  802 aa  KS6A5_HUMAN RecName: Full=Ribosomal protein S6 kinase alpha-5;     
   61::251     3e-08  30%  724 aa  KS6A1_MOUSE RecName: Full=Ribosomal protein S6 kinase alpha-1;     
   47::199     3e-08  32%  351 aa  KAPCA_PIG RecName: Full=cAMP-dependent protein kinase catalytic
   46::198     3e-08  35%  350 aa  KAPCA_CANFA RecName: Full=cAMP-dependent protein kinase catalytic
  139::298     3e-08  34%  712 aa  FHKE_DICDI RecName: Full=Probable serine/threonine-protein kinase
   22::220     3e-08  27%  512 aa  CHK1_DROME RecName: Full=Serine/threonine-protein kinase grp;      
  589::736     3e-08  31% 1338 aa  CEK1_SCHPO RecName: Full=Serine/threonine-protein kinase cek1;     
    7::152     3e-08  29%  298 aa  CDK2_MESAU RecName: Full=Cell division protein kinase 2;       
    7::152     3e-08  28%  298 aa  CDK2_CARAU RecName: Full=Cell division protein kinase 2;       
    7::153     3e-08  27%  297 aa  CDC2_DROME RecName: Full=Cell division control protein 2 homolog;  
    3::153     3e-08  28%  302 aa  CDC2B_XENLA RecName: Full=Cell division control protein 2-B;       
  306::451     3e-08  32%  718 aa  CBK1_KLULA RecName: Full=Serine/threonine-protein kinase CBK1;     
  313::458     3e-08  32%  719 aa  CBK1_ASHGO RecName: Full=Serine/threonine-protein kinase CBK1;     
  237::485     3e-08  23%  499 aa  BLK_MOUSE RecName: Full=Tyrosine-protein kinase BLK;       
   97::228     3e-08  30%  427 aa  AFC2_ARATH RecName: Full=Serine/threonine-protein kinase AFC2;     
   13::230     3e-08  23%  292 aa  V226_FOWPV RecName: Full=Probable serine/threonine-protein kinase
   32::171     3e-08  28%  487 aa  STK4_PAPAN RecName: Full=Serine/threonine-protein kinase 4;        
   28::167     3e-08  29%  493 aa  STK3_XENLA RecName: Full=Serine/threonine-protein kinase 3;        
   52::204     3e-08  34%  277 aa  PRKY_HUMAN RecName: Full=Serine/threonine-protein kinase PRKY;     
  555::724     3e-08  29%  928 aa  MYLKF_DICDI RecName: Full=Probable myosin light chain kinase
   72::287     3e-08  27%  745 aa  KS6A6_HUMAN RecName: Full=Ribosomal protein S6 kinase alpha-6;     
  103::295     3e-08  29%  371 aa  IPL1_YARLI RecName: Full=Spindle assembly checkpoint kinase;       
  543::770     3e-08  31%  842 aa  CLA4_YEAST RecName: Full=Serine/threonine-protein kinase CLA4;     
   73::222     3e-08  28%  521 aa  CDPKX_ARATH RecName: Full=Calcium-dependent protein kinase 33;     
    3::149     3e-08  34%  315 aa  CDKL4_HUMAN RecName: Full=Cyclin-dependent kinase-like 4;       
    1::175     3e-08  30%  372 aa  CDK9_RAT RecName: Full=Cell division protein kinase 9;       
    1::175     3e-08  30%  372 aa  CDK9_MOUSE RecName: Full=Cell division protein kinase 9;       
    1::175     3e-08  30%  372 aa  CDK9_HUMAN RecName: Full=Cell division protein kinase 9;       
    3::153     3e-08  28%  302 aa  CDC2A_XENLA RecName: Full=Cell division control protein 2-A;       
   11::158     3e-08  30%  317 aa  CDC28_CANAL RecName: Full=Cell division control protein 28;        
   34::173     4e-08  33%  491 aa  STK4_SQUAC RecName: Full=Serine/threonine-protein kinase 3/4;      
   32::171     4e-08  29%  487 aa  STK4_COLGU RecName: Full=Serine/threonine-protein kinase 4;        
   32::171     4e-08  28%  487 aa  STK4_AOTNA RecName: Full=Serine/threonine-protein kinase 4;        
   23::184     4e-08  31%  865 aa  MASTL_MOUSE RecName: Full=Microtubule-associated
  249::498     4e-08  23%  512 aa  LYN_HUMAN RecName: Full=Tyrosine-protein kinase Lyn;       
  247::507     4e-08  22%  509 aa  LCK_MOUSE RecName: Full=Proto-oncogene tyrosine-protein kinase LCK;
   48::199     4e-08  33%  351 aa  KAPCB_RAT RecName: Full=cAMP-dependent protein kinase catalytic
   48::199     4e-08  33%  351 aa  KAPCB_PIG RecName: Full=cAMP-dependent protein kinase catalytic
   48::199     4e-08  33%  351 aa  KAPCB_MOUSE RecName: Full=cAMP-dependent protein kinase catalytic
   48::199     4e-08  33%  351 aa  KAPCB_CRIGR RecName: Full=cAMP-dependent protein kinase catalytic
   47::199     4e-08  35%  351 aa  KAPCA_SHEEP RecName: Full=cAMP-dependent protein kinase catalytic
   47::199     4e-08  35%  351 aa  KAPCA_BOVIN RecName: Full=cAMP-dependent protein kinase catalytic
   31::185     4e-08  30%  326 aa  CKB21_ORYSJ RecName: Full=Cyclin-dependent kinase B2-1;       
   28::220     4e-08  30%  519 aa  CDKC1_ORYSJ RecName: Full=Cyclin-dependent kinase C-1;       
    1::175     4e-08  30%  372 aa  CDK9_BOVIN RecName: Full=Cell division protein kinase 9;       
    3::151     4e-08  33%  292 aa  CDK5_GLOMM RecName: Full=Cell division protein kinase 5 homolog;   
    7::153     4e-08  29%  294 aa  CDC2_MAIZE RecName: Full=Cell division control protein 2 homolog;  
    7::151     4e-08  35%  298 aa  CDC2H_THEPA RecName: Full=Cell division control protein 2 homolog; 
    7::151     4e-08  35%  298 aa  CDC2H_THEAN RecName: Full=Cell division control protein 2 homolog; 
   26::180     4e-08  33%  501 aa  CD2L6_MOUSE RecName: Full=Cell division cycle 2-like protein kinase
   26::180     4e-08  33%  502 aa  CD2L6_HUMAN RecName: Full=Cell division cycle 2-like protein kinase
   58::242     4e-08  30%  667 aa  BUR1_CANGA RecName: Full=Serine/threonine-protein kinase BUR1;     
   32::171     6e-08  28%  487 aa  STK4_OTOGA RecName: Full=Serine/threonine-protein kinase 4;        
   32::171     6e-08  28%  487 aa  STK4_MOUSE RecName: Full=Serine/threonine-protein kinase 4;        
   32::171     6e-08  28%  487 aa  STK4_MACMU RecName: Full=Serine/threonine-protein kinase 4;        
   32::171     6e-08  28%  487 aa  STK4_LEMCA RecName: Full=Serine/threonine-protein kinase 4;        
   32::171     6e-08  28%  487 aa  STK4_HUMAN RecName: Full=Serine/threonine-protein kinase 4;        
   32::171     6e-08  28%  487 aa  STK4_CERAE RecName: Full=Serine/threonine-protein kinase 4;        
   32::171     6e-08  28%  487 aa  STK4_BOVIN RecName: Full=Serine/threonine-protein kinase 4;        
  269::467     6e-08  24%  523 aa  SRC_RSVPA RecName: Full=Tyrosine-protein kinase transforming
  272::470     6e-08  23%  526 aa  SRC_RSVP RecName: Full=Tyrosine-protein kinase transforming protein
  564::693     6e-08  35% 1316 aa  PPK18_SCHPO RecName: Full=Serine/threonine-protein kinase ppk18;   
    8::227     6e-08  28%  527 aa  OXSR1_PONAB RecName: Full=Serine/threonine-protein kinase OSR1;    
    8::227     6e-08  28%  529 aa  OXSR1_PIG RecName: Full=Serine/threonine-protein kinase OSR1;      
    8::227     6e-08  28%  527 aa  OXSR1_HUMAN RecName: Full=Serine/threonine-protein kinase OSR1;    
  496::742     6e-08  29%  778 aa  NTRK1_CHICK RecName: Full=High affinity nerve growth factor
  480::694     6e-08  25%  813 aa  KRAF1_CAEEL RecName: Full=Raf homolog serine/threonine-protein
   15::162     6e-08  34%  343 aa  KCC1B_RAT RecName: Full=Calcium/calmodulin-dependent protein kinase
   15::162     6e-08  34%  343 aa  KCC1B_MOUSE RecName: Full=Calcium/calmodulin-dependent protein
  208::351     6e-08  28%  749 aa  FHKD_DICDI RecName: Full=Probable serine/threonine-protein kinase
    9::226     6e-08  28%  476 aa  CHK1_RAT RecName: Full=Serine/threonine-protein kinase Chk1;       
   28::220     6e-08  30%  513 aa  CDKC2_ORYSJ RecName: Full=Cyclin-dependent kinase C-2;       
    3::151     6e-08  31%  294 aa  CDK5_DROME RecName: Full=Cell division protein kinase 5 homolog;   
    7::152     6e-08  28%  298 aa  CDK2_RAT RecName: Full=Cell division protein kinase 2;       
    7::152     6e-08  28%  346 aa  CDK2_MOUSE RecName: Full=Cell division protein kinase 2;       
   45::194     6e-08  32%  345 aa  CC2H2_TRYBB RecName: Full=Cell division control protein 2 homolog
  793::926     6e-08  34% 1085 aa  BUB1_HUMAN RecName: Full=Mitotic checkpoint
  312::518     6e-08  28%  606 aa  ARAF_PIG RecName: Full=A-Raf proto-oncogene
   29::168     8e-08  28%  491 aa  STK3_RAT RecName: Full=Serine/threonine-protein kinase 3;       
   28::167     8e-08  29%  492 aa  STK3_DANRE RecName: Full=Serine/threonine-protein kinase 3;        
   50::249     8e-08  32%  619 aa  SNF1_CANTR RecName: Full=Carbon catabolite-derepressing protein
  246::501     8e-08  23%  508 aa  LCK_CHICK RecName: Full=Proto-oncogene tyrosine-protein kinase LCK;
   12::202     8e-08  30%  478 aa  KCC2A_RAT RecName: Full=Calcium/calmodulin-dependent protein kinase
   12::202     8e-08  30%  478 aa  KCC2A_PONAB RecName: Full=Calcium/calmodulin-dependent protein
   12::202     8e-08  30%  478 aa  KCC2A_MOUSE RecName: Full=Calcium/calmodulin-dependent protein
   12::202     8e-08  30%  478 aa  KCC2A_HUMAN RecName: Full=Calcium/calmodulin-dependent protein
   48::199     8e-08  33%  351 aa  KAPCB_HUMAN RecName: Full=cAMP-dependent protein kinase catalytic
   48::199     8e-08  33%  351 aa  KAPCB_BOVIN RecName: Full=cAMP-dependent protein kinase catalytic
  104::297     8e-08  32%  358 aa  IPL1_CANGA RecName: Full=Spindle assembly checkpoint kinase;       
   82::230     8e-08  30%  433 aa  DCLK1_RAT RecName: Full=Serine/threonine-protein kinase DCLK1;     
  405::553     8e-08  30%  756 aa  DCLK1_MOUSE RecName: Full=Serine/threonine-protein kinase DCLK1;   
   17::171     8e-08  33%  313 aa  CKB21_ARATH RecName: Full=Cyclin-dependent kinase B2-1;       
    3::152     8e-08  30%  357 aa  CDKL1_HUMAN RecName: Full=Cyclin-dependent kinase-like 1;       
    8::148     8e-08  35%  291 aa  CDK2_ENTHI RecName: Full=Cell division protein kinase 2 homolog;   
    7::152     8e-08  28%  298 aa  CDK2_CRIGR RecName: Full=Cell division protein kinase 2;       
    7::172     8e-08  32%  323 aa  CDC2_EMENI RecName: Full=Cell division control protein 2;       
    8::152     8e-08  30%  301 aa  CC2H1_TRYBB RecName: Full=Cell division control protein 2 homolog
   17::241     8e-08  28%  745 aa  ANKK1_MOUSE RecName: Full=Ankyrin repeat and protein kinase
   62::276     1e-07  31%  560 aa  TOS3_YEAST RecName: Full=Serine/threonine-protein kinase TOS3;     
   62::276     1e-07  31%  560 aa  TOS3_YEAS7 RecName: Full=Serine/threonine-protein kinase TOS3;     
   29::168     1e-07  28%  497 aa  STK3_MOUSE RecName: Full=Serine/threonine-protein kinase 3;        
   29::168     1e-07  31%  491 aa  STK3_HUMAN RecName: Full=Serine/threonine-protein kinase 3;        
   74::230     1e-07  29%  398 aa  PPK23_SCHPO RecName: Full=Serine/threonine-protein kinase ppk23;   
   29::172     1e-07  33% 1110 aa  PKNK_MYCTU RecName: Full=Probable serine/threonine-protein kinase
   29::172     1e-07  33% 1110 aa  PKNK_MYCBO RecName: Full=Probable serine/threonine-protein kinase
   27::178     1e-07  29%  364 aa  MK11_HUMAN RecName: Full=Mitogen-activated protein kinase 11;      
   14::203     1e-07  30%  527 aa  KCC2G_RAT RecName: Full=Calcium/calmodulin-dependent protein kinase
   14::203     1e-07  30%  529 aa  KCC2G_MOUSE RecName: Full=Calcium/calmodulin-dependent protein
   14::203     1e-07  30%  558 aa  KCC2G_HUMAN RecName: Full=Calcium/calmodulin-dependent protein
   13::203     1e-07  30%  479 aa  KCC2D_CHICK RecName: Full=Calcium/calmodulin-dependent protein
   19::160     1e-07  29%  353 aa  FUS3_YEAST RecName: Full=Mitogen-activated protein kinase FUS3;    
  856::962     1e-07  32% 1077 aa  E2AK3_CAEEL RecName: Full=Eukaryotic translation initiation factor
  682::880     1e-07  29%  971 aa  CLA4_CANAL RecName: Full=Serine/threonine-protein kinase CLA4;     
    9::226     1e-07  29%  476 aa  CHK1_MOUSE RecName: Full=Serine/threonine-protein kinase Chk1;     
    8::153     1e-07  29%  294 aa  CDKA1_ORYSJ RecName: Full=Cyclin-dependent kinase A-1;       
   88::253     1e-07  31%  478 aa  CDK9_CAEEL RecName: Full=Probable cell division protein kinase 9;  
    7::152     1e-07  28%  298 aa  CDK2_HUMAN RecName: Full=Cell division protein kinase 2;       
    7::152     1e-07  28%  298 aa  CDK2_BOVIN RecName: Full=Cell division protein kinase 2;       
    3::151     1e-07  33%  289 aa  CDC2H_PLAYO RecName: Full=Cell division control protein 2 homolog; 
    3::150     1e-07  35%  288 aa  CDC2H_PLAFK RecName: Full=Cell division control protein 2 homolog; 
    3::150     1e-07  35%  288 aa  CDC2H_PLAF7 RecName: Full=Cell division control protein 2 homolog; 
  426::572     1e-07  29%  780 aa  CD2L2_HUMAN RecName: Full=PITSLRE serine/threonine-protein kinase
  430::576     1e-07  29%  784 aa  CD2L1_MOUSE RecName: Full=PITSLRE serine/threonine-protein kinase
  441::587     1e-07  29%  795 aa  CD2L1_HUMAN RecName: Full=PITSLRE serine/threonine-protein kinase
  318::463     1e-07  34%  716 aa  CBK1_DEBHA RecName: Full=Serine/threonine-protein kinase CBK1;     
   44::202     1e-07  32%  746 aa  BUR1_CANAL RecName: Full=Serine/threonine-protein kinase BUR1;     
   31::170     1e-07  28%  486 aa  STK4_CHICK RecName: Full=Serine/threonine-protein kinase 4;        
    3::163     1e-07  28%  476 aa  PKNF_MYCTU RecName: Full=Serine/threonine-protein kinase pknF;     
    3::163     1e-07  28%  476 aa  PKNF_MYCBO RecName: Full=Serine/threonine-protein kinase pknF;     
   26::224     1e-07  29%  469 aa  PKN2_CORGL RecName: Full=Serine/threonine-protein kinases pknA;    
  122::227     1e-07  34%  527 aa  OXSR1_MOUSE RecName: Full=Serine/threonine-protein kinase OSR1;    
   24::185     1e-07  29%  879 aa  MASTL_HUMAN RecName: Full=Microtubule-associated
  105::312     1e-07  29%  592 aa  KSG1_SCHPO RecName: Full=Serine/threonine-protein kinase ksg1;     
  547::704     1e-07  29%  863 aa  KS6A5_MOUSE RecName: Full=Ribosomal protein S6 kinase alpha-5;     
   15::162     1e-07  33%  343 aa  KCC1B_HUMAN RecName: Full=Calcium/calmodulin-dependent protein
  339::542     1e-07  31%  648 aa  KAPC_DICDI RecName: Full=cAMP-dependent protein kinase catalytic
  197::361     1e-07  34%  589 aa  G11A_ORYSJ RecName: Full=Protein kinase G11A;         EC=2.7.11.1;
  197::361     1e-07  34%  589 aa  G11A_ORYSI RecName: Full=Protein kinase G11A;         EC=2.7.11.1;
  236::488     1e-07  22%  505 aa  FRK_HUMAN RecName: Full=Tyrosine-protein kinase FRK;       
   26::239     1e-07  31%  431 aa  CIPKM_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   85::244     1e-07  34%  525 aa  CIPKL_ORYSJ RecName: Full=CBL-interacting protein kinase 21;       
   24::278     1e-07  33%  489 aa  CIPKC_ARATH RecName: Full=CBL-interacting serine/threonine-protein
    9::226     1e-07  28%  476 aa  CHK1_HUMAN RecName: Full=Serine/threonine-protein kinase Chk1;     
    7::153     1e-07  28%  294 aa  CDKA1_ARATH RecName: Full=Cyclin-dependent kinase A-1;       
   82::228     1e-07  30%  436 aa  CD2L1_RAT RecName: Full=PITSLRE serine/threonine-protein kinase
  114::315     1e-07  32%  384 aa  AURK_DICDI RecName: Full=Probable serine/threonine-protein kinase
 1379::1574    2e-07  29% 1634 aa  Y1199_DICDI RecName: Full=Probable serine/threonine-protein kinase
 1265::1503    2e-07  29% 1579 aa  SSK2_YEAST RecName: Full=MAP kinase kinase kinase SSK2;       
  272::470     2e-07  23%  526 aa  SRC_RSVH1 RecName: Full=Tyrosine-protein kinase transforming
  271::469     2e-07  23%  532 aa  SRC1_XENLA RecName: Full=Tyrosine-protein kinase Src-1;       
    4::163     2e-07  30%  589 aa  PKNJ_MYCTU RecName: Full=Probable serine/threonine-protein kinase
    4::163     2e-07  30%  589 aa  PKNJ_MYCBO RecName: Full=Probable serine/threonine-protein kinase
   11::212     2e-07  30%  627 aa  PKNB_LACLA RecName: Full=Probable serine/threonine-protein kinase
   10::206     2e-07  31%  304 aa  PHO85_KLULA RecName: Full=Negative regulator of the PHO system;    
  203::372     2e-07  28%  649 aa  PAR4_CAEBR RecName: Full=Serine/threonine-protein kinase par-4;    
   43::189     2e-07  30%  312 aa  MYLKC_DICDI RecName: Full=Probable myosin light chain kinase
   25::171     2e-07  30%  392 aa  MYLKB_DICDI RecName: Full=Probable myosin light chain kinase
   79::234     2e-07  36% 1732 aa  MRCKA_RAT RecName: Full=Serine/threonine-protein kinase MRCK alpha;
   79::234     2e-07  36% 1719 aa  MRCKA_MOUSE RecName: Full=Serine/threonine-protein kinase MRCK
   79::234     2e-07  36% 1732 aa  MRCKA_HUMAN RecName: Full=Serine/threonine-protein kinase MRCK
   20::216     2e-07  27%  678 aa  M3K7_DROME RecName: Full=Mitogen-activated protein kinase kinase
  280::422     2e-07  31%  593 aa  CTK1_SCHPO RecName: Full=CTD kinase subunit alpha;       
    8::158     2e-07  31%  335 aa  CRK1_SCHPO RecName: Full=Serine/threonine-protein kinase crk1;     
   21::222     2e-07  29%  527 aa  CHK1_YEAST RecName: Full=Serine/threonine-protein kinase CHK1;     
    9::226     2e-07  29%  476 aa  CHK1_CHICK RecName: Full=Serine/threonine-protein kinase Chk1;     
   70::222     2e-07  32%  534 aa  CDPKI_ARATH RecName: Full=Calcium-dependent protein kinase 18;     
   50::208     2e-07  29%  535 aa  CDPK7_ARATH RecName: Full=Calcium-dependent protein kinase 7;      
   85::234     2e-07  28%  533 aa  CDPK2_ORYSJ RecName: Full=Calcium-dependent protein kinase isoform
   60::280     2e-07  29%  535 aa  CDPK1_PLAYO RecName: Full=Calcium-dependent protein kinase 1;      
  368::514     2e-07  31%  710 aa  CDKG2_ORYSJ RecName: Full=Cyclin-dependent kinase G-2;       
  368::514     2e-07  31%  710 aa  CDKG2_ORYSI RecName: Full=Cyclin-dependent kinase G-2;       
   19::160     2e-07  34%  348 aa  CDKD2_ARATH RecName: Full=Cyclin-dependent kinase D-2;       
    1::161     2e-07  31%  298 aa  CDC28_YEAST RecName: Full=Cell division control protein 28;        
   28::180     2e-07  32%  580 aa  BUR1_ASPFU RecName: Full=Serine/threonine-protein kinase bur1;     
  312::518     2e-07  31%  606 aa  ARAF_HUMAN RecName: Full=A-Raf proto-oncogene
  275::473     2e-07  23%  536 aa  SRC_HUMAN RecName: Full=Proto-oncogene tyrosine-protein kinase Src;
   14::227     2e-07  30%  521 aa  SPKA_SYNY3 RecName: Full=Serine/threonine-protein kinase A;        
   34::182     2e-07  31% 1206 aa  SLK_RAT RecName: Full=STE20-like serine/threonine-protein kinase;  
   34::182     2e-07  31% 1233 aa  SLK_MOUSE RecName: Full=STE20-like serine/threonine-protein kinase;
  140::239     2e-07  41%  385 aa  SBK1_DANRE RecName: Full=Serine/threonine-protein kinase SBK1;     
  444::642     2e-07  30%  790 aa  NPR1_YEAST RecName: Full=Nitrogen permease reactivator protein;    
  720::928     2e-07  31%  983 aa  MPS1_DICDI RecName: Full=Probable serine/threonine-protein kinase
   18::163     2e-07  30%  370 aa  MPKC_ASPTN RecName: Full=Mitogen-activated protein kinase mpkC;    
  178::388     2e-07  33%  476 aa  LOK_DROME RecName: Full=Ovarian-specific serine/threonine-protein
  478::692     2e-07  25%  811 aa  KRAF1_CAEBR RecName: Full=Raf homolog serine/threonine-protein
   79::223     2e-07  35%  415 aa  KPSH1_PINFU RecName: Full=Serine/threonine-protein kinase H1
   13::203     2e-07  30%  533 aa  KCC2D_RAT RecName: Full=Calcium/calmodulin-dependent protein kinase
   13::203     2e-07  30%  533 aa  KCC2D_RABIT RecName: Full=Calcium/calmodulin-dependent protein
   13::203     2e-07  30%  499 aa  KCC2D_PIG RecName: Full=Calcium/calmodulin-dependent protein kinase
   13::203     2e-07  30%  499 aa  KCC2D_MOUSE RecName: Full=Calcium/calmodulin-dependent protein
   13::203     2e-07  30%  499 aa  KCC2D_HUMAN RecName: Full=Calcium/calmodulin-dependent protein
   13::203     2e-07  30%  488 aa  KCC2D_BOVIN RecName: Full=Calcium/calmodulin-dependent protein
   12::222     2e-07  31%  758 aa  IKKA_DANRE RecName: Full=Inhibitor of nuclear factor kappa-B kinase
  776::919     2e-07  28% 1070 aa  DKF2_CAEEL RecName: Full=Serine/threonine-protein kinase dkf-2;    
   91::240     2e-07  28%  541 aa  CDPK9_ARATH RecName: Full=Calcium-dependent protein kinase 9;      
   16::163     2e-07  27%  326 aa  CDC2_CAEBR RecName: Full=Cell division control protein 2 homolog;  
    3::150     2e-07  35%  288 aa  CDC2H_PLAVI RecName: Full=Cell division control protein 2 homolog; 
    3::150     2e-07  35%  288 aa  CDC2H_PLAKH RecName: Full=Cell division control protein 2 homolog; 
  272::463     3e-07  24%  526 aa  SRC_RSVSE RecName: Full=Tyrosine-protein kinase transforming
  272::470     3e-07  23%  533 aa  SRC_CHICK RecName: Full=Proto-oncogene tyrosine-protein kinase Src;
  272::470     3e-07  23%  557 aa  SRC_AVIST RecName: Full=Tyrosine-protein kinase transforming
  272::470     3e-07  23%  568 aa  SRC_AVISS RecName: Full=Tyrosine-protein kinase transforming
  272::470     3e-07  23%  587 aa  SRC_AVIS2 RecName: Full=Tyrosine-protein kinase transforming
  271::469     3e-07  23%  532 aa  SRC2_XENLA RecName: Full=Tyrosine-protein kinase Src-2;       
  598::748     3e-07  30%  899 aa  RLK6_ARATH RecName: Full=Receptor-like protein kinase At3g21340;   
   12::208     3e-07  32%  303 aa  PHO85_ASHGO RecName: Full=Negative regulator of the PHO system;    
  683::890     3e-07  28% 1016 aa  PCK2_SCHPO RecName: Full=Protein kinase C-like 2;       
   78::233     3e-07  31% 1711 aa  MRCKB_HUMAN RecName: Full=Serine/threonine-protein kinase MRCK
  824::1034    3e-07  27% 1116 aa  MKH1_SCHPO RecName: Full=MAP kinase kinase kinase mkh1;       
  160::345     3e-07  28%  587 aa  KKCC2_RAT RecName: Full=Calcium/calmodulin-dependent protein kinase
  161::346     3e-07  28%  588 aa  KKCC2_MOUSE RecName: Full=Calcium/calmodulin-dependent protein
  161::346     3e-07  28%  588 aa  KKCC2_HUMAN RecName: Full=Calcium/calmodulin-dependent protein
   51::255     3e-07  28%  376 aa  KDC1_DROME RecName: Full=Protein kinase DC1;         EC=2.7.11.1;
  714::856     3e-07  32% 1115 aa  IRE1_YEAST RecName: Full=Serine/threonine-protein
   12::215     3e-07  24%  756 aa  IKKB_BOVIN RecName: Full=Inhibitor of nuclear factor kappa-B kinase
    3::148     3e-07  34%  805 aa  FUSED_DROME RecName: Full=Serine/threonine-protein kinase fused;   
   50::217     3e-07  31%  523 aa  CDPKY_ARATH RecName: Full=Calcium-dependent protein kinase 34;     
   40::186     3e-07  30%  358 aa  CDK10_RAT RecName: Full=Cell division protein kinase 10;       
   42::188     3e-07  30%  360 aa  CDK10_HUMAN RecName: Full=Cell division protein kinase 10;       
    7::153     3e-07  27%  302 aa  CDC2_RANDY RecName: Full=Cell division control protein 2 homolog;  
   13::152     3e-07  33%  296 aa  CDC2_DICDI RecName: Full=Cell division control protein 2 homolog;  
    3::150     3e-07  33%  288 aa  CDC2H_PLACH RecName: Full=Cell division control protein 2 homolog; 
    3::150     3e-07  33%  288 aa  CDC2H_PLABA RecName: Full=Cell division control protein 2 homolog; 
  243::443     3e-07  25%  505 aa  BLK_HUMAN RecName: Full=Tyrosine-protein kinase BLK;       
    3::148     4e-07  30%  507 aa  Y8078_DICDI RecName: Full=Probable serine/threonine-protein kinase
  272::463     4e-07  24%  526 aa  SRC_RSVSA RecName: Full=Tyrosine-protein kinase transforming
  272::463     4e-07  24%  526 aa  SRC_AVISR RecName: Full=Tyrosine-protein kinase transforming
  251::454     4e-07  26%  517 aa  SRC42_DROME RecName: Full=Tyrosine-protein kinase Src42A;       
   34::182     4e-07  30% 1235 aa  SLK_HUMAN RecName: Full=STE20-like serine/threonine-protein kinase;
    4::208     4e-07  30%  511 aa  NEK3_MOUSE RecName: Full=Serine/threonine-protein kinase Nek3;     
   56::206     4e-07  28%  349 aa  MYLKG_DICDI RecName: Full=Probable myosin light chain kinase
   19::164     4e-07  30%  396 aa  MPKC_ASPNC RecName: Full=Mitogen-activated protein kinase mpkC;    
   12::202     4e-07  29%  475 aa  KCC2D_XENLA RecName: Full=Calcium/calmodulin-dependent protein
   13::203     4e-07  30%  542 aa  KCC2B_RAT RecName: Full=Calcium/calmodulin-dependent protein kinase
   13::203     4e-07  30%  542 aa  KCC2B_MOUSE RecName: Full=Calcium/calmodulin-dependent protein
   13::203     4e-07  30%  664 aa  KCC2B_HUMAN RecName: Full=Calcium/calmodulin-dependent protein
   13::203     4e-07  30%  542 aa  KCC2B_BOVIN RecName: Full=Calcium/calmodulin-dependent protein
   12::202     4e-07  30%  491 aa  KC2D1_DANRE RecName: Full=Calcium/calmodulin-dependent protein
    9::163     4e-07  36%  717 aa  IKKE_MOUSE RecName: Full=Inhibitor of nuclear factor kappa-B kinase
   12::215     4e-07  24%  756 aa  IKKB_HUMAN RecName: Full=Inhibitor of nuclear factor kappa-B kinase
  102::257     4e-07  34% 1637 aa  GEK_DROME RecName: Full=Serine/threonine-protein kinase Genghis
   25::162     4e-07  32%  329 aa  CTK1_ENCCU RecName: Full=Probable CTD kinase subunit alpha homolog;
   24::234     4e-07  28%  503 aa  CHK1_CAEEL RecName: Full=Serine/threonine-protein kinase chk-1;    
   58::211     4e-07  32%  541 aa  CDPKU_ARATH RecName: Full=Calcium-dependent protein kinase 30;     
    3::152     4e-07  29%  507 aa  CDKL2_RAT RecName: Full=Cyclin-dependent kinase-like 2;       
    3::152     4e-07  29%  568 aa  CDKL2_MOUSE RecName: Full=Cyclin-dependent kinase-like 2;       
    7::152     4e-07  29%  292 aa  CDKA2_ORYSJ RecName: Full=Cyclin-dependent kinase A-2;       
   42::188     4e-07  30%  360 aa  CDK10_MOUSE RecName: Full=Cell division protein kinase 10;       
  159::356     4e-07  32%  485 aa  AKT2B_XENLA RecName: Full=RAC-beta serine/threonine-protein kinase
   19::171     5e-07  26% 1495 aa  Y8901_DICDI RecName: Full=Probable serine/threonine-protein kinase
  116::317     5e-07  31%  514 aa  STK33_HUMAN RecName: Full=Serine/threonine-protein kinase 33;      
   47::179     5e-07  30%  436 aa  STK11_MOUSE RecName: Full=Serine/threonine-protein kinase 11;      
  847::1040    5e-07  26% 1125 aa  STE20_YARLI RecName: Full=Serine/threonine-protein kinase STE20;     
  280::478     5e-07  23%  541 aa  SRC_MOUSE RecName: Full=Neuronal proto-oncogene tyrosine-protein
  204::344     5e-07  32%  821 aa  RAD53_YEAST RecName: Full=Serine/threonine-protein kinase RAD53;   
  128::229     5e-07  32%  556 aa  PKSC_STRCO RecName: Full=Serine/threonine-protein kinase pksC;     
   17::228     5e-07  32%  547 aa  PKN3_MYXXA RecName: Full=Serine/threonine-protein kinase pkn3;     
  155::316     5e-07  32%  479 aa  PK2_DICDI RecName: Full=Protein kinase 2;         Short=PK2;       
  128::354     5e-07  32%  397 aa  PIM1_MOUSE RecName: Full=Proto-oncogene serine/threonine-protein
   78::233     5e-07  32% 1713 aa  MRCKB_RAT RecName: Full=Serine/threonine-protein kinase MRCK beta; 
   18::163     5e-07  30%  344 aa  MPKC_ASPOR RecName: Full=Mitogen-activated protein kinase mpkC;    
  356::561     5e-07  31%  619 aa  M3K2_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
  388::526     5e-07  28%  772 aa  KS6A2_CAEEL RecName: Full=Putative ribosomal protein S6 kinase
  225::376     5e-07  32%  609 aa  KPK1_PHAVU RecName: Full=Protein kinase PVPK-1;       
  185::394     5e-07  27% 1081 aa  KOK0_YEAST RecName: Full=Probable serine/threonine-protein kinase
  311::487     5e-07  28%  737 aa  KNS1_YEAST RecName: Full=Dual specificity protein kinase KNS1;     
   36::253     5e-07  27%  446 aa  KCC1_YEAST RecName: Full=Calcium/calmodulin-dependent protein
   12::202     5e-07  29%  554 aa  KC2D2_DANRE RecName: Full=Calcium/calmodulin-dependent protein
    2::77      5e-07  36%   81 aa  KC1D_RABIT RecName: Full=Casein kinase I isoform delta;       
   19::164     5e-07  31%  355 aa  HOG1_COCHE RecName: Full=Mitogen-activated protein kinase HOG1;    
  237::489     5e-07  21%  506 aa  FRK_RAT RecName: Full=Tyrosine-protein kinase FRK;       
  243::472     5e-07  22%  512 aa  FRK_MOUSE RecName: Full=Tyrosine-protein kinase FRK;       
   19::173     5e-07  30%  315 aa  CKB22_ARATH RecName: Full=Cyclin-dependent kinase B2-2;       
   82::234     5e-07  26%  529 aa  CDPK3_ARATH RecName: Full=Calcium-dependent protein kinase 3;      
   40::186     5e-07  30%  361 aa  CDK10_BOVIN RecName: Full=Cell division protein kinase 10;       
   29::170     5e-07  32%  311 aa  CC2H3_TRYBB RecName: Full=Cell division control protein 2 homolog
  954::1150    6e-07  26% 1228 aa  STE20_CANAL RecName: Full=Serine/threonine-protein kinase CST20;     
  275::473     6e-07  23%  536 aa  SRC_RAT RecName: Full=Proto-oncogene tyrosine-protein kinase Src;  
   83::209     6e-07  35%  657 aa  PKN2_CLOAB RecName: Full=Probable serine/threonine-protein kinase
  387::588     6e-07  26% 1176 aa  PAKF_DICDI RecName: Full=Serine/threonine-protein kinase pakF;     
   19::175     6e-07  31%  421 aa  OXI1_ARATH RecName: Full=Serine/threonine-protein kinase OXI1;     
  245::391     6e-07  27%  623 aa  NRC2_NEUCR RecName: Full=Serine/threonine-protein kinase nrc-2;    
   27::172     6e-07  29%  364 aa  MK11_MOUSE RecName: Full=Mitogen-activated protein kinase 11;      
   11::158     6e-07  29%  443 aa  MHK_ARATH RecName: Full=Serine/threonine-protein kinase MHK;       
  671::841     6e-07  33% 1088 aa  LATS2_HUMAN RecName: Full=Serine/threonine-protein kinase LATS2;   
   19::164     6e-07  30%  355 aa  HOG1_PHANO RecName: Full=Mitogen-activated protein kinase HOG1;    
   19::164     6e-07  31%  359 aa  HOG1_HORWE RecName: Full=Mitogen-activated protein kinase HOG1;    
   19::164     6e-07  31%  354 aa  HOG1_COCMI RecName: Full=Mitogen-activated protein kinase HOG1;    
   19::164     6e-07  30%  355 aa  HOG1_ALTBR RecName: Full=Mitogen-activated protein kinase HOG1;    
  897::1040    6e-07  28% 1191 aa  DKF2_CAEBR RecName: Full=Serine/threonine-protein kinase dkf-2;      
    9::168     6e-07  33%  404 aa  CIPKR_ORYSJ RecName: Full=Putative CBL-interacting protein kinase
  219::373     6e-07  31%  543 aa  CHK2_HUMAN RecName: Full=Serine/threonine-protein kinase Chk2;     
    7::153     6e-07  28%  294 aa  CDC22_MEDSA RecName: Full=Cell division control protein 2 homolog
   68::290     6e-07  27%  340 aa  BYR1_SCHPO RecName: Full=Protein kinase byr1;       
   64::220     6e-07  31%  657 aa  BUR1_YEAST RecName: Full=Serine/threonine-protein kinase BUR1;     
   24::180     6e-07  31%  544 aa  BUR1_EMENI RecName: Full=Serine/threonine-protein kinase bur1;     
  368::525     8e-07  29%  807 aa  YAK1_YEAST RecName: Full=Dual specificity protein kinase YAK1;     
   20::161     8e-07  30%  461 aa  STK4_DICDI RecName: Full=Serine/threonine-protein kinase 4 homolog
    3::200     8e-07  26% 1315 aa  STK36_PONAB RecName: Full=Serine/threonine-protein kinase 36;      
  114::262     8e-07  29%  580 aa  SRK1_SCHPO RecName: Full=Serine/threonine-protein kinase srk1;     
   34::182     8e-07  30% 1231 aa  SLK_CAVPO RecName: Full=STE20-like serine/threonine-protein kinase;
    9::156     8e-07  28%  685 aa  PKN2_CLOPE RecName: Full=Probable serine/threonine-protein kinase
    9::157     8e-07  29%  625 aa  PKN1_THETN RecName: Full=Probable serine/threonine-protein kinase
  712::864     8e-07  23% 1335 aa  NDRC_DICDI RecName: Full=Probable serine/threonine-protein kinase
  362::567     8e-07  27%  626 aa  M3K3_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
   19::164     8e-07  31%  364 aa  HOG1_COCIM RecName: Full=Mitogen-activated protein kinase HOG1;    
  287::489     8e-07  25%  545 aa  FGR_FSVGR RecName: Full=Tyrosine-protein kinase transforming
  102::316     8e-07  28%  554 aa  CDPKF_ARATH RecName: Full=Calcium-dependent protein kinase 15;     
   45::203     8e-07  28%  530 aa  CDPKE_ARATH RecName: Full=Calcium-dependent protein kinase 14;     
  352::498     8e-07  29%  693 aa  CDKG1_ORYSJ RecName: Full=Cyclin-dependent kinase G-1;       
  352::498     8e-07  29%  693 aa  CDKG1_ORYSI RecName: Full=Cyclin-dependent kinase G-1;       
   17::158     8e-07  30%  398 aa  CDKD1_ARATH RecName: Full=Cyclin-dependent kinase D-1;       
   29::220     8e-07  29%  513 aa  CDKC2_ARATH RecName: Full=Cyclin-dependent kinase C-2;       
  501::674     1e-06  29%  717 aa  STE11_YEAST RecName: Full=Serine/threonine-protein kinase STE11;   
  501::674     1e-06  29%  717 aa  STE11_YEAS7 RecName: Full=Serine/threonine-protein kinase STE11;   
  179::380     1e-06  25%  653 aa  SHKB_DICDI RecName: Full=Dual specificity protein kinase shkB;     
   60::271     1e-06  28%  550 aa  PPK21_SCHPO RecName: Full=Serine/threonine-protein kinase ppk21;   
   12::216     1e-06  25%  757 aa  PKNA2_BIFLO RecName: Full=Probable serine/threonine-protein kinase
   78::233     1e-06  32% 1713 aa  MRCKB_MOUSE RecName: Full=Serine/threonine-protein kinase MRCK
  322::532     1e-06  27%  678 aa  MPH1_SCHPO RecName: Full=Serine/threonine-protein kinase mph1;     
   30::177     1e-06  29%  367 aa  MK12_HUMAN RecName: Full=Mitogen-activated protein kinase 12;      
  629::774     1e-06  33% 1042 aa  LATS2_MOUSE RecName: Full=Serine/threonine-protein kinase LATS2;   
  415::577     1e-06  32%  733 aa  KS6A2_HUMAN RecName: Full=Ribosomal protein S6 kinase alpha-2;     
  477::680     1e-06  26%  782 aa  KRAF1_DROME RecName: Full=Raf homolog serine/threonine-protein
   14::203     1e-06  28%  530 aa  KCC2A_DROME RecName: Full=Calcium/calmodulin-dependent protein
   42::199     1e-06  32%  351 aa  KAPL_APLCA RecName: Full=Spermatozoon-associated protein kinase;   
  553::805     1e-06  28%  821 aa  CTR1_ARATH RecName: Full=Serine/threonine-protein kinase CTR1;     
   65::222     1e-06  29%  528 aa  CDPKH_ARATH RecName: Full=Calcium-dependent protein kinase 17;     
    3::152     1e-06  29%  493 aa  CDKL2_PONAB RecName: Full=Cyclin-dependent kinase-like 2;       
    3::149     1e-06  30%  352 aa  CDKL1_MOUSE RecName: Full=Cyclin-dependent kinase-like 1;       
   11::168     1e-06  29%  352 aa  CDK7_XENLA RecName: Full=Cell division protein kinase 7;       
  148::274     1e-06  29%  666 aa  ANP1_ARATH RecName: Full=Mitogen-activated protein kinase kinase
  160::357     1e-06  31%  486 aa  AKT2A_XENLA RecName: Full=RAC-beta serine/threonine-protein kinase
  349::499     1e-06  26%  680 aa  YPK1_YEAST RecName: Full=Serine/threonine-protein kinase YPK1;     
  753::801     1e-06  39% 1078 aa  Y8642_DICDI RecName: Full=Probable serine/threonine-protein kinase
  121::267     1e-06  29%  572 aa  Y1461_ARATH RecName: Full=Probable serine/threonine-protein kinase
 1529::1673    1e-06  31% 2102 aa  Y0701_DICDI RecName: Full=Probable serine/threonine-protein kinase
  371::575     1e-06  28%  631 aa  TEC_HUMAN RecName: Full=Tyrosine-protein kinase Tec;       
  286::481     1e-06  26%  552 aa  SRC64_DROME RecName: Full=Tyrosine-protein kinase Src64B;       
   76::226     1e-06  31% 1369 aa  ROCK1_RAT RecName: Full=Rho-associated protein kinase 1;       
   76::226     1e-06  31% 1354 aa  ROCK1_RABIT RecName: Full=Rho-associated protein kinase 1;       
   76::226     1e-06  31% 1354 aa  ROCK1_MOUSE RecName: Full=Rho-associated protein kinase 1;       
   76::226     1e-06  31% 1354 aa  ROCK1_HUMAN RecName: Full=Rho-associated protein kinase 1;       
  111::361     1e-06  29%  512 aa  RCK1_YEAST RecName: Full=Serine/threonine-protein kinase RCK1;     
  135::361     1e-06  30%  404 aa  PIM1_HUMAN RecName: Full=Proto-oncogene serine/threonine-protein
   10::203     1e-06  33%  294 aa  PHO85_YARLI RecName: Full=Negative regulator of the PHO system;    
  252::402     1e-06  32%  836 aa  PDPK1_DROME RecName: Full=3-phosphoinositide-dependent protein
   43::221     1e-06  30%  413 aa  MKNK1_RAT RecName: Full=MAP kinase-interacting
   28::174     1e-06  29%  361 aa  MK14_XENLA RecName: Full=Mitogen-activated protein kinase 14;      
   28::173     1e-06  28%  366 aa  MK13_BOVIN RecName: Full=Mitogen-activated protein kinase 13;      
   30::177     1e-06  29%  367 aa  MK12_RAT RecName: Full=Mitogen-activated protein kinase 12;        
   30::177     1e-06  28%  367 aa  MK12_MOUSE RecName: Full=Mitogen-activated protein kinase 12;      
  356::561     1e-06  28%  619 aa  M3K2_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
  415::577     1e-06  33%  733 aa  KS6A2_MOUSE RecName: Full=Ribosomal protein S6 kinase alpha-2;     
  454::617     1e-06  31%  784 aa  KS6A1_CAEEL RecName: Full=Putative ribosomal protein S6 kinase
    8::162     1e-06  28%  308 aa  KIN28_ENCCU RecName: Full=Probable serine/threonine-protein kinase
  191::383     1e-06  30%  459 aa  IRAK4_MOUSE RecName: Full=Interleukin-1 receptor-associated kinase
    9::217     1e-06  28%  272 aa  IPL1_ENCCU RecName: Full=Probable spindle assembly checkpoint
   37::232     1e-06  30%  497 aa  CST1_CAEEL RecName: Full=Serine/threonine-protein kinase cst-1;    
   36::174     1e-06  27%  319 aa  CSK2A_ENCCU RecName: Full=Probable casein kinase II subunit alpha
  320::528     1e-06  27%  656 aa  CRK32_ARATH RecName: Full=Putative cysteine-rich receptor-like
   11::225     1e-06  29%  450 aa  CIPKN_ORYSJ RecName: Full=CBL-interacting protein kinase 23;       
   61::214     1e-06  30%  533 aa  CDPK8_ARATH RecName: Full=Calcium-dependent protein kinase 8;      
  150::306     1e-06  27%  610 aa  CDPK1_ARATH RecName: Full=Calcium-dependent protein kinase 1;      
    3::152     1e-06  29%  570 aa  CDKL2_MACFA RecName: Full=Cyclin-dependent kinase-like 2;       
    3::152     1e-06  29%  493 aa  CDKL2_HUMAN RecName: Full=Cyclin-dependent kinase-like 2;       
    3::149     1e-06  30%  352 aa  CDKL1_RAT RecName: Full=Cyclin-dependent kinase-like 1;       
    9::265     1e-06  31%  942 aa  ATG1_CANGA RecName: Full=Serine/threonine-protein kinase ATG1;     
   39::187     2e-06  27%  405 aa  YAK1_ENCCU RecName: Full=Probable dual specificity protein kinase
   34::186     2e-06  26%  496 aa  Y4251_DICDI RecName: Full=Probable serine/threonine-protein kinase
  501::674     2e-06  29%  717 aa  STE11_YEAS6 RecName: Full=Serine/threonine-protein kinase STE11;   
   22::169     2e-06  30%  508 aa  SMKY_MOUSE RecName: Full=Sperm motility kinase Y;       
  122::166     2e-06  44%  470 aa  RAN1_SCHPO RecName: Full=Negative regulator of sexual conjugation
   47::256     2e-06  27%  423 aa  PPK25_SCHPO RecName: Full=Serine/threonine-protein kinase ppk25;   
   20::224     2e-06  27%  520 aa  PKN2_COREF RecName: Full=Serine/threonine-protein kinases drp72;   
   44::270     2e-06  30%  313 aa  PIM1_FELCA RecName: Full=Proto-oncogene serine/threonine-protein
    3::152     2e-06  34%  708 aa  NEK5_HUMAN RecName: Full=Serine/threonine-protein kinase Nek5;     
 1558::1707    2e-06  26% 2112 aa  NDRD_DICDI RecName: Full=Probable serine/threonine-protein kinase
  443::584     2e-06  30%  714 aa  MKCB_DICDI RecName: Full=Probable serine/threonine-protein kinase
  585::733     2e-06  29%  860 aa  MKCA_DICDI RecName: Full=Probable serine/threonine-protein kinase
   31::173     2e-06  28%  366 aa  MK13_MOUSE RecName: Full=Mitogen-activated protein kinase 13;      
  124::221     2e-06  26%  283 aa  KRB2_VACCW RecName: Full=Probable serine/threonine-protein kinase
  124::221     2e-06  26%  283 aa  KRB2_VACCC RecName: Full=Probable serine/threonine-protein kinase
   95::297     2e-06  31%  422 aa  KPSH1_DANRE RecName: Full=Serine/threonine-protein kinase H1
  248::375     2e-06  33%  530 aa  IPL1_CANAL RecName: Full=Spindle assembly checkpoint kinase;       
    9::163     2e-06  34%  716 aa  IKKE_HUMAN RecName: Full=Inhibitor of nuclear factor kappa-B kinase
   19::164     2e-06  30%  386 aa  HOG1_YARLI RecName: Full=Mitogen-activated protein kinase HOG1;    
   45::296     2e-06  32%  540 aa  CIPKC_ORYSJ RecName: Full=CBL-interacting protein kinase 12;       
   97::246     2e-06  30%  556 aa  CDPK5_ARATH RecName: Full=Calcium-dependent protein kinase 5;      
    3::152     2e-06  29%  566 aa  CDKL2_RABIT RecName: Full=Cyclin-dependent kinase-like 2;       
   63::201     2e-06  29%  574 aa  CDC7_HUMAN RecName: Full=Cell division cycle 7-related protein
   22::169     2e-06  28%  332 aa  CDC2_CAEEL RecName: Full=Cell division control protein 2 homolog;  
   25::233     2e-06  32%  294 aa  AUR1_ARATH RecName: Full=Serine/threonine-protein kinase Aurora-1; 
  151::348     2e-06  32%  479 aa  AKT3_RAT RecName: Full=RAC-gamma serine/threonine-protein kinase;  
  151::348     2e-06  32%  479 aa  AKT3_MOUSE RecName: Full=RAC-gamma serine/threonine-protein kinase;
  151::348     2e-06  32%  479 aa  AKT3_HUMAN RecName: Full=RAC-gamma serine/threonine-protein kinase;
  356::623     2e-06  24% 1620 aa  ABL_DROME RecName: Full=Tyrosine-protein kinase Abl;       
  348::537     2e-06  22%  654 aa  Y1839_ARATH RecName: Full=Probable serine/threonine-protein kinase
  370::574     2e-06  28%  630 aa  TEC_MOUSE RecName: Full=Tyrosine-protein kinase Tec;       
    3::200     2e-06  25% 1315 aa  STK36_HUMAN RecName: Full=Serine/threonine-protein kinase 36;      
  614::759     2e-06  30%  939 aa  STE20_YEAST RecName: Full=Serine/threonine-protein kinase STE20;   
  580::771     2e-06  28%  876 aa  SIRK_ARATH RecName: Full=Senescence-induced receptor-like
   89::195     2e-06  34%  626 aa  PKNB_MYCTU RecName: Full=Serine/threonine-protein kinase pknB;     
   89::195     2e-06  34%  626 aa  PKNB_MYCBO RecName: Full=Serine/threonine-protein kinase pknB;     
  195::336     2e-06  32%  523 aa  PCTK2_HUMAN RecName: Full=Serine/threonine-protein kinase
  283::445     2e-06  27%  608 aa  MYLK2_RABIT RecName: Full=Myosin light chain kinase 2,
  107::257     2e-06  24% 1060 aa  MRKA_DICDI RecName: Full=Probable serine/threonine-protein kinase
   27::173     2e-06  29%  360 aa  MK14_RAT RecName: Full=Mitogen-activated protein kinase 14;        
   27::173     2e-06  29%  360 aa  MK14_MOUSE RecName: Full=Mitogen-activated protein kinase 14;      
  362::567     2e-06  27%  626 aa  M3K3_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
   84::276     2e-06  31%  366 aa  M2K4_ARATH RecName: Full=Mitogen-activated protein kinase kinase 4;
  122::321     2e-06  29%  444 aa  KRAC_DICDI RecName: Full=RAC family serine/threonine-protein kinase
   19::164     2e-06  31%  364 aa  HOG1_ASPTN RecName: Full=Mitogen-activated protein kinase hog1;    
  860::1021    2e-06  24% 1321 aa  FNKE_DICDI RecName: Full=Probable serine/threonine-protein kinase
  264::466     2e-06  24%  529 aa  FGR_HUMAN RecName: Full=Proto-oncogene tyrosine-protein kinase FGR;
  245::417     2e-06  29%  515 aa  E2AK2_MOUSE RecName: Full=Interferon-induced, double-stranded
  188::337     2e-06  28%  568 aa  DYRK3_MACFA RecName: Full=Dual specificity
  208::357     2e-06  28%  588 aa  DYRK3_HUMAN RecName: Full=Dual specificity
  209::368     2e-06  30%  599 aa  DYRK2_MOUSE RecName: Full=Dual specificity
  146::187     2e-06  45%  337 aa  CSK2A_DICDI RecName: Full=Casein kinase II subunit alpha;       
   12::227     2e-06  30%  451 aa  CIPKA_ORYSJ RecName: Full=CBL-interacting protein kinase 10;       
   17::164     2e-06  32%  461 aa  CIPK1_ORYSJ RecName: Full=CBL-interacting protein kinase 1;        
  245::327     2e-06  37%  476 aa  CHK2_CAEEL RecName: Full=Serine/threonine-protein kinase chk-2;    
    7::153     2e-06  28%  294 aa  CDC2_CHERU RecName: Full=Cell division control protein 2 homolog;  
    7::153     2e-06  29%  294 aa  CDC2A_ANTMA RecName: Full=Cell division control protein 2 homolog
    4::150     2e-06  27%  291 aa  CDC21_MEDSA RecName: Full=Cell division control protein 2 homolog
  149::243     2e-06  38%  645 aa  BUR1_KLULA RecName: Full=Serine/threonine-protein kinase BUR1;     
  134::352     2e-06  31%  481 aa  AKT2_RAT RecName: Full=RAC-beta serine/threonine-protein kinase;   
   15::219     3e-06  27%  468 aa  ULK3_XENLA RecName: Full=Serine/threonine-protein kinase ULK3;     
33039::33191   3e-06  27% 35213 aa  TITIN_MOUSE RecName: Full=Titin;         EC=2.7.11.1;AltName:
  804::941     3e-06  28% 1079 aa  STE20_DEBHA RecName: Full=Serine/threonine-protein kinase STE20;   
   10::242     3e-06  29%  746 aa  SNRK_RAT RecName: Full=SNF-related serine/threonine-protein kinase;
   10::242     3e-06  29%  748 aa  SNRK_MOUSE RecName: Full=SNF-related serine/threonine-protein
   87::214     3e-06  35%  660 aa  PKN1_COREF RecName: Full=Probable serine/threonine-protein kinase
   44::244     3e-06  32%  313 aa  PIM1_RAT RecName: Full=Proto-oncogene serine/threonine-protein
    9::205     3e-06  30%  302 aa  PHO85_CANGA RecName: Full=Negative regulator of the PHO system;    
  195::336     3e-06  32%  523 aa  PCTK2_MOUSE RecName: Full=Serine/threonine-protein kinase
  271::433     3e-06  28%  596 aa  MYLK2_HUMAN RecName: Full=Myosin light chain kinase 2,
   55::233     3e-06  30%  427 aa  MKNK1_MOUSE RecName: Full=MAP kinase-interacting
   28::174     3e-06  30%  361 aa  MK14A_CYPCA RecName: Full=Mitogen-activated protein kinase 14a;    
   31::173     3e-06  28%  366 aa  MK13_RAT RecName: Full=Mitogen-activated protein kinase 13;        
   31::173     3e-06  28%  365 aa  MK13_PANTR RecName: Full=Mitogen-activated protein kinase 13;      
  386::545     3e-06  28% 1257 aa  LIMK1_DROME RecName: Full=LIM domain kinase 1;       
  358::561     3e-06  31%  683 aa  KPCL_RAT RecName: Full=Protein kinase C eta type;       
  358::561     3e-06  31%  683 aa  KPCL_MOUSE RecName: Full=Protein kinase C eta type;       
  358::561     3e-06  31%  683 aa  KPCL_HUMAN RecName: Full=Protein kinase C eta type;       
  499::643     3e-06  27%  893 aa  KN8R_YEAST RecName: Full=Probable serine/threonine-protein kinase
   29::166     3e-06  30% 1080 aa  KIC1_YEAST RecName: Full=Serine/threonine-protein kinase KIC1;     
   12::215     3e-06  23%  757 aa  IKKB_MOUSE RecName: Full=Inhibitor of nuclear factor kappa-B kinase
   22::167     3e-06  31%  420 aa  HOG2_ZYGRO RecName: Full=Mitogen-activated protein kinase HOG2;    
   22::167     3e-06  31%  427 aa  HOG1_TORDE RecName: Full=Mitogen-activated protein kinase HOG1;    
   19::164     3e-06  31%  366 aa  HOG1_NEOFI RecName: Full=Mitogen-activated protein kinase hog1;    
   19::164     3e-06  31%  365 aa  HOG1_ASPNC RecName: Full=Mitogen-activated protein kinase hog1;    
   19::164     3e-06  31%  366 aa  HOG1_ASPFU RecName: Full=Mitogen-activated protein kinase hog1;    
   19::164     3e-06  31%  365 aa  HOG1_ASPCL RecName: Full=Mitogen-activated protein kinase hog1;    
  272::532     3e-06  22%  534 aa  FYN_CHICK RecName: Full=Proto-oncogene tyrosine-protein kinase Fyn;
  207::356     3e-06  28%  586 aa  DYRK3_RAT RecName: Full=Dual specificity
  207::356     3e-06  28%  586 aa  DYRK3_MOUSE RecName: Full=Dual specificity
  197::439     3e-06  24%  450 aa  CSK_MOUSE RecName: Full=Tyrosine-protein kinase CSK;       
   72::221     3e-06  26%  535 aa  CDPK5_SOLTU RecName: Full=Calcium-dependent protein kinase 5;      
  186::342     3e-06  28%  646 aa  CDPK2_ARATH RecName: Full=Calcium-dependent protein kinase 2;      
    7::151     3e-06  30%  593 aa  CDKL3_RAT RecName: Full=Cyclin-dependent kinase-like 3;       
    7::151     3e-06  30%  595 aa  CDKL3_MOUSE RecName: Full=Cyclin-dependent kinase-like 3;       
    3::148     3e-06  25%  459 aa  CDKF4_ORYSJ RecName: Full=Cyclin-dependent kinase F-4;       
   24::181     3e-06  30%  470 aa  CDKE1_ARATH RecName: Full=Cyclin-dependent kinase E-1;       
    3::161     3e-06  29%  344 aa  CDK7_CARAU RecName: Full=Cell division protein kinase 7;       
    7::153     3e-06  27%  294 aa  CDC2_VIGUN RecName: Full=Cell division control protein 2 homolog;  
    3::159     3e-06  27%  346 aa  CCRK_RAT RecName: Full=Cell cycle-related kinase;       
    3::159     3e-06  27%  346 aa  CCRK_MOUSE RecName: Full=Cell cycle-related kinase;       
  134::352     3e-06  31%  481 aa  AKT2_MOUSE RecName: Full=RAC-beta serine/threonine-protein kinase; 
  655::863     4e-06  27%  982 aa  TTK_DANRE RecName: Full=Dual specificity protein kinase Ttk;       
  143::325     4e-06  29%  754 aa  STT7_CHLRE RecName: Full=Serine/threonine-protein kinase stt7,
  180::282     4e-06  32%  553 aa  STK39_RAT RecName: Full=STE20/SPS1-related proline-alanine-rich
  183::285     4e-06  32%  556 aa  STK39_MOUSE RecName: Full=STE20/SPS1-related proline-alanine-rich
  173::275     4e-06  32%  547 aa  STK39_HUMAN RecName: Full=STE20/SPS1-related proline-alanine-rich
   47::179     4e-06  29%  433 aa  STK11_HUMAN RecName: Full=Serine/threonine-protein kinase 11;      
   24::265     4e-06  24%  640 aa  SMKX_MOUSE RecName: Full=Sperm motility kinase X;       
  206::352     4e-06  27%  607 aa  SID2_SCHPO RecName: Full=Serine/threonine-protein kinase sid2;     
  414::612     4e-06  30%  824 aa  SCH9_YEAST RecName: Full=Serine/threonine-protein kinase SCH9;     
  190::335     4e-06  28%  451 aa  PTK6_HUMAN RecName: Full=Tyrosine-protein kinase 6;       
  102::232     4e-06  28%  354 aa  PPK34_SCHPO RecName: Full=Serine/threonine-protein kinase ppk34;   
    8::168     4e-06  32%  762 aa  PLK4_DROGR RecName: Full=Serine/threonine-protein kinase PLK4;     
   89::195     4e-06  37%  673 aa  PKNX_STRCO RecName: Full=Probable serine/threonine-protein kinase
   31::181     4e-06  29%  368 aa  MPK7_ARATH RecName: Full=Mitogen-activated protein kinase 7;       
   28::174     4e-06  29%  348 aa  MK14B_DANRE RecName: Full=Mitogen-activated protein kinase 14b;    
  345::497     4e-06  26%  647 aa  LIMK1_RAT RecName: Full=LIM domain kinase 1;         Short=LIMK-1; 
  124::221     4e-06  24%  283 aa  KRB2_VACCA RecName: Full=Probable serine/threonine-protein kinase
   97::299     4e-06  29%  424 aa  KPSH1_MOUSE RecName: Full=Serine/threonine-protein kinase H1;      
   97::299     4e-06  29%  424 aa  KPSH1_HUMAN RecName: Full=Serine/threonine-protein kinase H1;      
   97::299     4e-06  29%  424 aa  KPSH1_BOVIN RecName: Full=Serine/threonine-protein kinase H1;      
  339::545     4e-06  29%  672 aa  KPCA_MOUSE RecName: Full=Protein kinase C alpha type;       
  333::554     4e-06  31%  682 aa  KPC2_CAEEL RecName: Full=Protein kinase C-like 2;       
  327::543     4e-06  27%  720 aa  KIN82_YEAST RecName: Full=Probable serine/threonine-protein kinase
   44::277     4e-06  26%  800 aa  KIN4_YEAST RecName: Full=Serine/threonine-protein kinase KIN4;     
  455::655     4e-06  27%  762 aa  KGP2_HUMAN RecName: Full=cGMP-dependent protein kinase 2;       
   35::228     4e-06  30%  337 aa  KAPC_ASCSU RecName: Full=cAMP-dependent protein kinase catalytic
  350::607     4e-06  24%  620 aa  ITK_HUMAN RecName: Full=Tyrosine-protein kinase ITK/TSK;       
    3::149     4e-06  29%  629 aa  ICK_RAT RecName: Full=Serine/threonine-protein kinase ICK;       
    3::149     4e-06  29%  629 aa  ICK_MOUSE RecName: Full=Serine/threonine-protein kinase ICK;       
   19::164     4e-06  30%  379 aa  HOG1_EMENI RecName: Full=Mitogen-activated protein kinase hog1;    
  255::515     4e-06  23%  517 aa  FGR_MOUSE RecName: Full=Proto-oncogene tyrosine-protein kinase FGR;
  211::370     4e-06  30%  601 aa  DYRK2_HUMAN RecName: Full=Dual specificity
   11::236     4e-06  27%  493 aa  CIPKQ_ORYSJ RecName: Full=CBL-interacting protein kinase 26;       
   29::243     4e-06  28%  482 aa  CIPKN_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   94::243     4e-06  25%  557 aa  CDPK4_SOLTU RecName: Full=Calcium-dependent protein kinase 4;      
   29::220     4e-06  27%  505 aa  CDKC1_ARATH RecName: Full=Cyclin-dependent kinase C-1;       
   26::180     4e-06  34%  464 aa  CDK8_MOUSE RecName: Full=Cell division protein kinase 8;       
   26::180     4e-06  34%  464 aa  CDK8_HUMAN RecName: Full=Cell division protein kinase 8;       
    7::153     4e-06  27%  294 aa  CDC2_VIGAC RecName: Full=Cell division control protein 2 homolog;  
   12::155     4e-06  28%  314 aa  CDC2C_DROME RecName: Full=Cell division control protein 2 cognate; 
   41::193     4e-06  31%  706 aa  BUR1_YARLI RecName: Full=Serine/threonine-protein kinase BUR1;     
   23::226     4e-06  27%  765 aa  ANKK1_HUMAN RecName: Full=Ankyrin repeat and protein kinase
   21::167     5e-06  28%  369 aa  Y6373_DICDI RecName: Full=Probable serine/threonine-protein kinase
    3::141     5e-06  31%  516 aa  Y255_ENCCU RecName: Full=Probable serine/threonine-protein kinase
32177::32329   5e-06  24% 34350 aa  TITIN_HUMAN RecName: Full=Titin;         EC=2.7.11.1;AltName:
  137::329     5e-06  30%  403 aa  STK6_HUMAN RecName: Full=Serine/threonine-protein kinase 6;        
  137::329     5e-06  30%  402 aa  STK6_BOVIN RecName: Full=Serine/threonine-protein kinase 6;        
  391::582     5e-06  25%  658 aa  STE20_SCHPO RecName: Full=Serine/threonine-protein kinase
  570::772     5e-06  30%  868 aa  RLK7_ARATH RecName: Full=Receptor-like protein kinase At5g59670;   
  113::254     5e-06  37%  499 aa  PMYT1_HUMAN RecName: Full=Membrane-associated tyrosine- and
   14::165     5e-06  36%  761 aa  PLK4_CULQU RecName: Full=Serine/threonine-protein kinase PLK4;     
   89::194     5e-06  33%  622 aa  PKNB_MYCLE RecName: Full=Serine/threonine-protein kinase pknB;     
   51::222     5e-06  30%  636 aa  PDPK1_CAEEL RecName: Full=3-phosphoinositide-dependent protein
  188::358     5e-06  27%  617 aa  PAR4_CAEEL RecName: Full=Serine/threonine-protein kinase par-4;    
  517::679     5e-06  32% 1111 aa  NEK10_MOUSE RecName: Full=Serine/threonine-protein kinase Nek10;   
   89::228     5e-06  36%  466 aa  MKNK2_XENTR RecName: Full=MAP kinase-interacting
   89::228     5e-06  36%  467 aa  MKNK2_XENLA RecName: Full=MAP kinase-interacting
   27::173     5e-06  29%  360 aa  MK14_PANTR RecName: Full=Mitogen-activated protein kinase 14;      
   27::173     5e-06  29%  360 aa  MK14_HUMAN RecName: Full=Mitogen-activated protein kinase 14;      
   27::173     5e-06  29%  360 aa  MK14_CANFA RecName: Full=Mitogen-activated protein kinase 14;      
  402::545     5e-06  32% 1482 aa  MAST3_XENLA RecName: Full=Microtubule-associated
   67::273     5e-06  23%  651 aa  M3K2_ARATH RecName: Full=Mitogen-activated protein kinase kinase
 1300::1450    5e-06  25% 1493 aa  M3K1_RAT RecName: Full=Mitogen-activated protein kinase kinase kinase
  355::573     5e-06  25%  625 aa  ITK_MOUSE RecName: Full=Tyrosine-protein kinase ITK/TSK;       
   19::164     5e-06  28%  358 aa  HOG1_USTMA RecName: Full=Mitogen-activated protein kinase HOG1;    
  150::366     5e-06  30%  602 aa  CRK_DAUCA RecName: Full=CDPK-related protein kinase;       
  500::721     5e-06  30%  793 aa  CLA4_ASHGO RecName: Full=Serine/threonine-protein kinase CLA4;     
   41::187     5e-06  28%  498 aa  CDPKM_ARATH RecName: Full=Calcium-dependent protein kinase 22;     
   37::203     5e-06  26%  528 aa  CDPKD_ARATH RecName: Full=Calcium-dependent protein kinase 13;     
   26::180     5e-06  34%  464 aa  CDK8_XENTR RecName: Full=Cell division protein kinase 8;       
    3::164     5e-06  29%  305 aa  CDC2C_ANTMA RecName: Full=Cell division control protein 2 homolog
   31::225     5e-06  28%  974 aa  CDC15_YEAST RecName: Full=Cell division control protein 15;        
  133::196     5e-06  33%  368 aa  CAK1_YEAST RecName: Full=Serine/threonine-protein kinase CAK1;     
  403::605     5e-06  24%  659 aa  BTK_HUMAN RecName: Full=Tyrosine-protein kinase BTK;       
  174::372     5e-06  30%  501 aa  AKT_MLVAT RecName: Full=AKT kinase-transforming protein;       
  153::351     5e-06  30%  480 aa  AKT1_RAT RecName: Full=RAC-alpha serine/threonine-protein kinase;  
  153::351     5e-06  30%  480 aa  AKT1_MOUSE RecName: Full=RAC-alpha serine/threonine-protein kinase;
  153::351     5e-06  30%  480 aa  AKT1_HUMAN RecName: Full=RAC-alpha serine/threonine-protein kinase;
  153::351     5e-06  30%  480 aa  AKT1_BOVIN RecName: Full=RAC-alpha serine/threonine-protein kinase;
   70::208     5e-06  32%  400 aa  AFC3_ARATH RecName: Full=Serine/threonine-protein kinase AFC3;     
   31::153     7e-06  30%  671 aa  Y6627_DICDI RecName: Full=Probable serine/threonine-protein kinase
  594::796     7e-06  28%  942 aa  TMK1_ARATH RecName: Full=Probable receptor protein kinase TMK1;    
    9::168     7e-06  29%  725 aa  TBK1_XENLA RecName: Full=Serine/threonine-protein kinase TBK1;     
   16::210     7e-06  27%  478 aa  SVKA_DICDI RecName: Full=Serine/threonine-protein kinase svkA;     
   10::233     7e-06  30%  765 aa  SNRK_HUMAN RecName: Full=SNF-related serine/threonine-protein
  151::371     7e-06  32%  496 aa  SGK3_MOUSE RecName: Full=Serine/threonine-protein kinase Sgk3;     
   92::238     7e-06  33% 1388 aa  ROCK2_BOVIN RecName: Full=Rho-associated protein kinase 2;       
   12::163     7e-06  28%  585 aa  PKNI_MYCTU RecName: Full=Probable serine/threonine-protein kinase
   12::163     7e-06  28%  585 aa  PKNI_MYCBO RecName: Full=Probable serine/threonine-protein kinase
    3::160     7e-06  29%  933 aa  PKND_CHLFF RecName: Full=Serine/threonine-protein kinase pknD;     
   44::270     7e-06  30%  313 aa  PIM1_BOVIN RecName: Full=Proto-oncogene serine/threonine-protein
   11::165     7e-06  32%  326 aa  PHO85_CANAL RecName: Full=Negative regulator of the PHO system;    
  145::286     7e-06  34%  472 aa  PCTK3_PONAB RecName: Full=Serine/threonine-protein kinase
  145::286     7e-06  34%  472 aa  PCTK3_HUMAN RecName: Full=Serine/threonine-protein kinase
   12::276     7e-06  30% 1582 aa  NRK_HUMAN RecName: Full=Nik-related protein kinase;       
  298::460     7e-06  28%  623 aa  MYLK2_BOVIN RecName: Full=Myosin light chain kinase 2,
   28::174     7e-06  28%  361 aa  MK14A_DANRE RecName: Full=Mitogen-activated protein kinase 14a;    
   23::183     7e-06  24% 1308 aa  MINK1_MOUSE RecName: Full=Misshapen-like kinase 1;       
   23::183     7e-06  24% 1332 aa  MINK1_HUMAN RecName: Full=Misshapen-like kinase 1;       
  392::535     7e-06  30% 1321 aa  MAST3_MOUSE RecName: Full=Microtubule-associated
   20::145     7e-06  29%  847 aa  M4K5_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
   20::145     7e-06  29%  846 aa  M4K5_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
 1300::1450    7e-06  25% 1493 aa  M3K1_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
 1319::1469    7e-06  25% 1512 aa  M3K1_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
  339::545     7e-06  29%  672 aa  KPCA_RAT RecName: Full=Protein kinase C alpha type;       
  339::545     7e-06  29%  672 aa  KPCA_RABIT RecName: Full=Protein kinase C alpha type;       
  339::545     7e-06  29%  672 aa  KPCA_HUMAN RecName: Full=Protein kinase C alpha type;       
  339::545     7e-06  29%  672 aa  KPCA_BOVIN RecName: Full=Protein kinase C alpha type;       
  455::655     7e-06  26%  762 aa  KGP2_RAT RecName: Full=cGMP-dependent protein kinase 2;       
  625::821     7e-06  29%  934 aa  KGP25_DROME RecName: Full=cGMP-dependent protein kinase, isozyme 2
  779::975     7e-06  29% 1088 aa  KGP24_DROME RecName: Full=cGMP-dependent protein kinase, isozyme 2
   12::215     7e-06  23%  757 aa  IKKB_RAT RecName: Full=Inhibitor of nuclear factor kappa-B kinase
   21::166     7e-06  31%  444 aa  HOG1_KLULA RecName: Full=Mitogen-activated protein kinase HOG1;    
   25::250     7e-06  28%  960 aa  GEFX_DICDI RecName: Full=RasGEF domain-containing
  136::295     7e-06  25%  526 aa  DYRK2_CHICK RecName: Full=Dual specificity
    3::149     7e-06  30%  311 aa  CKB12_ARATH RecName: Full=Cyclin-dependent kinase B1-2;       
    3::162     7e-06  29%  303 aa  CKB11_ORYSJ RecName: Full=Cyclin-dependent kinase B1-1;       
    3::168     7e-06  29%  309 aa  CKB11_ARATH RecName: Full=Cyclin-dependent kinase B1-1;       
   26::230     7e-06  33%  483 aa  CIPKJ_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   89::234     7e-06  30%  534 aa  CDPKT_ARATH RecName: Full=Calcium-dependent protein kinase 29;     
   73::222     7e-06  31%  528 aa  CDPK4_PLAYO RecName: Full=Calcium-dependent protein kinase 4;      
   73::222     7e-06  31%  528 aa  CDPK4_PLABA RecName: Full=Calcium-dependent protein kinase 4;      
   54::195     7e-06  29%  564 aa  CDC7_MOUSE RecName: Full=Cell division cycle 7-related protein
   20::161     7e-06  27%  351 aa  CDC72_ENCCU RecName: Full=Probable cell division control protein 7
   20::161     7e-06  27%  351 aa  CDC71_ENCCU RecName: Full=Probable cell division control protein 7
   32::194     7e-06  28%  473 aa  BUR1_GIBZE RecName: Full=Serine/threonine-protein kinase BUR1;     
  403::605     7e-06  24%  659 aa  BTK_MOUSE RecName: Full=Tyrosine-protein kinase BTK;       
  155::352     7e-06  31%  481 aa  AKT2_HUMAN RecName: Full=RAC-beta serine/threonine-protein kinase; 
  154::352     7e-06  30%  481 aa  AKT1_XENLA RecName: Full=RAC-alpha serine/threonine-protein kinase;
  172::380     7e-06  24%  746 aa  ABL_MLVAB RecName: Full=Tyrosine-protein kinase transforming
  286::494     7e-06  24% 1123 aa  ABL1_MOUSE RecName: Full=Proto-oncogene tyrosine-protein kinase
  117::271     9e-06  27%  418 aa  Y9865_DICDI RecName: Full=Probable serine/threonine-protein kinase
 1478::1666    9e-06  29% 1761 aa  Y9844_DICDI RecName: Full=Probable serine/threonine-protein kinase
  144::343     9e-06  29%  408 aa  STK6L_XENLA RecName: Full=Serine/threonine-protein kinase Eg2-like;
    3::200     9e-06  25% 1268 aa  STK36_MOUSE RecName: Full=Serine/threonine-protein kinase 36;      
   47::179     9e-06  28%  440 aa  STK11_CHICK RecName: Full=Serine/threonine-protein kinase 11;      
  233::484     9e-06  25%  496 aa  SRMS_MOUSE RecName: Full=Tyrosine-protein kinase Srms;       
   96::298     9e-06  26%  362 aa  SRK2_SPOLA RecName: Full=Tyrosine-protein kinase SRK2;       
   98::171     9e-06  40%  504 aa  SMK3_MOUSE RecName: Full=Sperm motility kinase 3;       
   22::162     9e-06  28%  680 aa  SGK71_HUMAN RecName: Full=Protein kinase-like protein SgK071;
  307::405     9e-06  30%  777 aa  PTK2_CANGA RecName: Full=Serine/threonine-protein kinase PTK2;     
  503::715     9e-06  32%  775 aa  PPK6_SCHPO RecName: Full=Serine/threonine-protein kinase ppk6;     
  201::344     9e-06  28%  566 aa  PPK14_SCHPO RecName: Full=Serine/threonine-protein kinase ppk14;   
  218::337     9e-06  33%  380 aa  PKN5_MYXXA RecName: Full=Serine/threonine-protein kinase pkn5;     
  155::263     9e-06  30%  693 aa  PKN1_MYXXA RecName: Full=Serine/threonine-protein kinase pkn1;     
   46::243     9e-06  32%  323 aa  PIM3_COTJA RecName: Full=Serine/threonine-protein kinase Pim-3;    
    2::206     9e-06  29%  305 aa  PHO85_YEAST RecName: Full=Cyclin-dependent protein kinase PHO85;   
  124::265     9e-06  34%  451 aa  PCTK3_MOUSE RecName: Full=Serine/threonine-protein kinase
   31::173     9e-06  28%  365 aa  MK13_HUMAN RecName: Full=Mitogen-activated protein kinase 13;      
  571::714     9e-06  30% 2618 aa  MAST4_MOUSE RecName: Full=Microtubule-associated
  576::719     9e-06  30% 2626 aa  MAST4_HUMAN RecName: Full=Microtubule-associated
  370::513     9e-06  33% 1309 aa  MAST3_HUMAN RecName: Full=Microtubule-associated
    3::149     9e-06  27%  622 aa  MAK_MOUSE RecName: Full=Serine/threonine-protein kinase MAK;       
   15::210     9e-06  26%  821 aa  M4K2_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
   15::210     9e-06  26%  820 aa  M4K2_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
  147::327     9e-06  32%  467 aa  M3K8_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
  655::867     9e-06  32% 1291 aa  M3K6_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
  654::866     9e-06  32% 1288 aa  M3K6_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
  350::556     9e-06  29%  679 aa  KPC1_DROME RecName: Full=Protein kinase C, brain isozyme;       
   22::167     9e-06  31%  407 aa  HOG1_ZYGRO RecName: Full=Mitogen-activated protein kinase HOG1;    
   22::167     9e-06  31%  431 aa  HOG1_ZYGRC RecName: Full=Mitogen-activated protein kinase HOG1;    
   11::178     9e-06  30%  466 aa  CIPKK_ORYSJ RecName: Full=CBL-interacting protein kinase 20;       
   21::243     9e-06  25%  451 aa  CIPK6_ORYSJ RecName: Full=CBL-interacting protein kinase 6;        
  118::260     9e-06  29%  538 aa  CDPK3_PLAYO RecName: Full=Calcium-dependent protein kinase 3;      
   69::214     9e-06  26%  513 aa  CDPK2_MAIZE RecName: Full=Calcium-dependent protein kinase 2;      
    3::162     9e-06  29%  346 aa  CDK7_HUMAN RecName: Full=Cell division protein kinase 7;       
   31::174     1e-05  33%  328 aa  YBC9_ENCCU RecName: Full=Probable cell division protein kinase
   24::221     1e-05  26%  654 aa  SMK_RAT RecName: Full=Sperm motility kinase;         EC=2.7.11.-;
  165::371     1e-05  32%  496 aa  SGK3_PONAB RecName: Full=Serine/threonine-protein kinase Sgk3;     
  165::371     1e-05  32%  496 aa  SGK3_HUMAN RecName: Full=Serine/threonine-protein kinase Sgk3;     
    6::173     1e-05  29%  272 aa  PK1_NPVAC RecName: Full=Serine/threonine-protein kinase 1;       
  124::265     1e-05  34%  451 aa  PCTK3_RAT RecName: Full=Serine/threonine-protein kinase PCTAIRE-3; 
  195::336     1e-05  31%  523 aa  PCTK2_RAT RecName: Full=Serine/threonine-protein kinase PCTAIRE-2; 
  664::871     1e-05  30%  988 aa  PCK1_SCHPO RecName: Full=Protein kinase C-like 1;       
 1058::1323    1e-05  26% 1383 aa  PASK_MOUSE RecName: Full=PAS domain-containing
  514::740     1e-05  30%  799 aa  NTRK1_MOUSE RecName: Full=High affinity nerve growth factor
  375::582     1e-05  29%  704 aa  KPC1_CAEEL RecName: Full=Protein kinase C-like 1;       
  455::655     1e-05  27%  762 aa  KGP2_MOUSE RecName: Full=cGMP-dependent protein kinase 2;       
   89::233     1e-05  29%  397 aa  KAPA_YEAST RecName: Full=cAMP-dependent protein kinase type 1;     
    3::149     1e-05  28%  632 aa  ICK_HUMAN RecName: Full=Serine/threonine-protein kinase ICK;       
  692::897     1e-05  28%  993 aa  HSL2_ARATH RecName: Full=Receptor-like protein kinase HSL2;        
   22::167     1e-05  30%  447 aa  HOG1_ASHGO RecName: Full=Mitogen-activated protein kinase HOG1;    
    4::166     1e-05  24%  616 aa  HIPK4_RAT RecName: Full=Homeodomain-interacting protein kinase 4;  
    4::166     1e-05  24%  616 aa  HIPK4_MOUSE RecName: Full=Homeodomain-interacting protein kinase 4;
  735::794     1e-05  43% 1576 aa  GCN2_SCHPO RecName: Full=Serine/threonine-protein kinase gcn2;     
  136::174     1e-05  49%  332 aa  CSK2A_MAIZE RecName: Full=Casein kinase II subunit alpha;       
  136::174     1e-05  49%  333 aa  CSK22_ARATH RecName: Full=Casein kinase II subunit alpha-2;        
  136::174     1e-05  49%  333 aa  CSK21_ARATH RecName: Full=Casein kinase II subunit alpha-1;        
   11::169     1e-05  28%  446 aa  CIPK8_ORYSJ RecName: Full=CBL-interacting protein kinase 8;        
   85::234     1e-05  28%  544 aa  CDPK6_ARATH RecName: Full=Calcium-dependent protein kinase 6;      
   73::222     1e-05  27%  528 aa  CDPK4_PLAF7 RecName: Full=Calcium-dependent protein kinase 4;      
    7::159     1e-05  27%  297 aa  CDC2_SCHPO RecName: Full=Cell division control protein 2;       
   20::219     1e-05  28%  282 aa  AURKC_MOUSE RecName: Full=Serine/threonine-protein kinase 13;      
  346::542     2e-05  25%  677 aa  YPK2_YEAST RecName: Full=Serine/threonine-protein kinase YPK2/YKR2;
    4::152     2e-05  30%  680 aa  Y4007_DICDI RecName: Full=Putative cyclin-dependent
  263::469     2e-05  26%  527 aa  TXK_HUMAN RecName: Full=Tyrosine-protein kinase TXK;       
   31::250     2e-05  28%  372 aa  TSSK5_MOUSE RecName: Full=Testis-specific serine/threonine-protein
  110::322     2e-05  30%  397 aa  STK6_RAT RecName: Full=Serine/threonine-protein kinase 6;       
  137::329     2e-05  30%  402 aa  STK6_PIG RecName: Full=Serine/threonine-protein kinase 6;       
   50::184     2e-05  28%  432 aa  STK11_XENLA RecName: Full=Serine/threonine-protein kinase 11;      
  337::467     2e-05  29%  505 aa  SRK1_SPOLA RecName: Full=Tyrosine-protein kinase isoform SRK1;     
   83::229     2e-05  31% 1379 aa  ROCK2_RAT RecName: Full=Rho-associated protein kinase 2;       
   92::238     2e-05  31% 1388 aa  ROCK2_MOUSE RecName: Full=Rho-associated protein kinase 2;       
   92::238     2e-05  31% 1388 aa  ROCK2_HUMAN RecName: Full=Rho-associated protein kinase 2;       
  104::245     2e-05  37%  490 aa  PMYT1_MOUSE RecName: Full=Membrane-associated tyrosine- and
    8::168     2e-05  31%  781 aa  PLK4_DROVI RecName: Full=Serine/threonine-protein kinase PLK4;     
   92::164     2e-05  38%  431 aa  PKNA_MYCTU RecName: Full=Probable serine/threonine-protein kinase
   92::164     2e-05  38%  437 aa  PKNA_MYCLE RecName: Full=Probable serine/threonine-protein kinase
   92::164     2e-05  38%  431 aa  PKNA_MYCBO RecName: Full=Probable serine/threonine-protein kinase
  541::784     2e-05  25%  821 aa  NTRK2_RAT RecName: Full=BDNF/NT-3 growth factors receptor;       
  541::784     2e-05  25%  821 aa  NTRK2_MOUSE RecName: Full=BDNF/NT-3 growth factors receptor;       
  542::785     2e-05  25%  822 aa  NTRK2_HUMAN RecName: Full=BDNF/NT-3 growth factors receptor;       
    4::158     2e-05  28%  568 aa  NEK3_ARATH RecName: Full=Serine/threonine-protein kinase Nek3;     
  378::570     2e-05  27%  652 aa  MKCD_DICDI RecName: Full=Probable serine/threonine-protein kinase
  106::176     2e-05  39%  365 aa  MK14B_DROME RecName: Full=Mitogen-activated protein kinase 14B;    
  327::479     2e-05  30%  608 aa  M3K1_ARATH RecName: Full=Mitogen-activated protein kinase kinase
  407::614     2e-05  29%  737 aa  KPCE_RAT RecName: Full=Protein kinase C epsilon type;       
   61::217     2e-05  26%  595 aa  KIN1_ENTBH RecName: Full=Probable serine/threonine-protein kinase
   80::242     2e-05  24%  507 aa  HSK1_SCHPO RecName: Full=Cell cycle serine/threonine-protein kinase
   44::183     2e-05  27%  669 aa  HIPPO_DROME RecName: Full=Serine/threonine-protein kinase hippo;   
   92::303     2e-05  31%  574 aa  FRAY1_DICDI RecName: Full=Serine/threonine-protein kinase fray1;   
   25::184     2e-05  33%  456 aa  CIPK9_ORYSJ RecName: Full=CBL-interacting protein kinase 9;        
   80::229     2e-05  26%  531 aa  CDPKL_ARATH RecName: Full=Calcium-dependent protein kinase 21;     
  401::603     2e-05  24%  657 aa  BTK_CHICK RecName: Full=Tyrosine-protein kinase BTK;       
  286::494     2e-05  23% 1130 aa  ABL1_HUMAN RecName: Full=Proto-oncogene tyrosine-protein kinase
  783::937     2e-05  29% 1128 aa  Y3337_DICDI RecName: Full=Probable serine/threonine-protein kinase
   12::246     2e-05  26% 1051 aa  ULK1_MOUSE RecName: Full=Serine/threonine-protein kinase ULK1;     
  701::822     2e-05  28%  989 aa  STE20_KLULA RecName: Full=Serine/threonine-protein kinase STE20;   
  362::584     2e-05  30%  655 aa  SKM1_YEAST RecName: Full=Serine/threonine-protein kinase SKM1;     
  151::371     2e-05  32%  496 aa  SGK3_RAT RecName: Full=Serine/threonine-protein kinase Sgk3;       
    4::168     2e-05  29%  933 aa  PKND_CHLAB RecName: Full=Serine/threonine-protein kinase pknD;     
  382::538     2e-05  30%  714 aa  PKD1_DICDI RecName: Full=Developmentally-regulated protein kinase
   11::214     2e-05  29%  330 aa  PHO85_DEBHA RecName: Full=Negative regulator of the PHO system;    
  138::279     2e-05  33%  469 aa  PFTK1_MOUSE RecName: Full=Serine/threonine-protein kinase
  129::250     2e-05  32%  657 aa  P2C04_ORYSJ RecName: Full=Protein kinase and PP2C-like
  542::788     2e-05  26%  825 aa  NTRK3_SAIBB RecName: Full=NT-3 growth factor receptor;       
  542::788     2e-05  26%  825 aa  NTRK3_PANTR RecName: Full=NT-3 growth factor receptor;       
  542::788     2e-05  26%  825 aa  NTRK3_MOUSE RecName: Full=NT-3 growth factor receptor;       
  542::788     2e-05  26%  825 aa  NTRK3_MACFA RecName: Full=NT-3 growth factor receptor;       
    8::164     2e-05  31%  443 aa  NEK2_MOUSE RecName: Full=Serine/threonine-protein kinase Nek2;     
    3::164     2e-05  32%  445 aa  NEK2_HUMAN RecName: Full=Serine/threonine-protein kinase Nek2;     
  517::679     2e-05  31% 1172 aa  NEK10_HUMAN RecName: Full=Serine/threonine-protein kinase Nek10;   
  285::447     2e-05  26%  610 aa  MYLK2_RAT RecName: Full=Myosin light chain kinase 2,
   90::245     2e-05  30%  465 aa  MKNK2_HUMAN RecName: Full=MAP kinase-interacting
   10::170     2e-05  28%  358 aa  MK01_RAT RecName: Full=Mitogen-activated protein kinase 1;       
   10::170     2e-05  28%  358 aa  MK01_MOUSE RecName: Full=Mitogen-activated protein kinase 1;       
   12::172     2e-05  28%  360 aa  MK01_HUMAN RecName: Full=Mitogen-activated protein kinase 1;       
   12::172     2e-05  28%  360 aa  MK01_BOVIN RecName: Full=Mitogen-activated protein kinase 1;       
  352::495     2e-05  26%  662 aa  LIMK1_CHICK RecName: Full=LIM domain kinase 1;       
  511::584     2e-05  35%  740 aa  KS6A3_MOUSE RecName: Full=Ribosomal protein S6 kinase alpha-3;     
  511::584     2e-05  35%  740 aa  KS6A3_HUMAN RecName: Full=Ribosomal protein S6 kinase alpha-3;     
  375::510     2e-05  28%  686 aa  KGP1B_MOUSE RecName: Full=cGMP-dependent protein kinase 1, beta
  375::510     2e-05  28%  686 aa  KGP1B_HUMAN RecName: Full=cGMP-dependent protein kinase 1, beta
  375::510     2e-05  28%  686 aa  KGP1B_BOVIN RecName: Full=cGMP-dependent protein kinase 1, beta
  360::495     2e-05  28%  671 aa  KGP1A_RABIT RecName: Full=cGMP-dependent protein kinase 1, alpha
  360::495     2e-05  28%  671 aa  KGP1A_MOUSE RecName: Full=cGMP-dependent protein kinase 1, alpha
  360::495     2e-05  28%  671 aa  KGP1A_HUMAN RecName: Full=cGMP-dependent protein kinase 1, alpha
  360::495     2e-05  28%  671 aa  KGP1A_BOVIN RecName: Full=cGMP-dependent protein kinase 1, alpha
   22::167     2e-05  30%  435 aa  HOG1_YEAST RecName: Full=Mitogen-activated protein kinase HOG1;    
    2::137     2e-05  31%  329 aa  HOG1_SETTU RecName: Full=Mitogen-activated protein kinase HOG1;    
   19::164     2e-05  29%  366 aa  HOG1_EURHE RecName: Full=Mitogen-activated protein kinase hog1;    
   22::167     2e-05  29%  387 aa  HOG1_DEBHA RecName: Full=Mitogen-activated protein kinase HOG1;    
   19::164     2e-05  28%  365 aa  HOG1_CRYNV RecName: Full=Mitogen-activated protein kinase HOG1;    
   19::164     2e-05  28%  365 aa  HOG1_CRYNE RecName: Full=Mitogen-activated protein kinase HOG1;    
   19::164     2e-05  29%  357 aa  HOG1_BLUGR RecName: Full=Mitogen-activated protein kinase HOG1;    
 1353::1552    2e-05  24% 1620 aa  GDT4_DICDI RecName: Full=Probable serine/threonine-protein kinase
  232::385     2e-05  30%  569 aa  GAD8_SCHPO RecName: Full=Serine/threonine-protein kinase gad8;     
  477::766     2e-05  23%  824 aa  FGFR2_PLEWA RecName: Full=Fibroblast growth factor receptor 2;     
  372::566     2e-05  26%  690 aa  CRK12_ARATH RecName: Full=Putative cysteine-rich receptor-like
   14::177     2e-05  29%  444 aa  CIPK1_ARATH RecName: Full=CBL-interacting serine/threonine-protein
  223::377     2e-05  29%  546 aa  CHK2_MOUSE RecName: Full=Serine/threonine-protein kinase Chk2;     
    5::162     2e-05  29%  346 aa  CDK7_MOUSE RecName: Full=Cell division protein kinase 7;       
   10::157     2e-05  29%  366 aa  CDK10_DICDI RecName: Full=Probable cyclin-dependent kinase 10;     
  104::234     2e-05  31%  368 aa  AUKBB_XENLA RecName: Full=Serine/threonine-protein kinase 12-B;    
  664::807     3e-05  29%  916 aa  Y9955_DICDI RecName: Full=Probable serine/threonine-protein kinase
 1620::1772    3e-05  30% 1895 aa  WRK19_ARATH RecName: Full=Probable WRKY transcription factor
  719::817     3e-05  31% 1072 aa  PPK4_SCHPO RecName: Full=Serine/threonine-protein kinase ppk4;     
  158::303     3e-05  27%  526 aa  PPK22_SCHPO RecName: Full=Serine/threonine-protein kinase ppk22;   
  149::289     3e-05  28%  750 aa  PKNG_MYCTU RecName: Full=Probable serine/threonine-protein kinase
  149::289     3e-05  28%  750 aa  PKNG_MYCBO RecName: Full=Probable serine/threonine-protein kinase
    3::170     3e-05  28%  930 aa  PKND_CHLCV RecName: Full=Serine/threonine-protein kinase pknD;     
  111::298     3e-05  24%  470 aa  PEPK2_ARATH RecName: Full=Serine/threonine-protein kinase PEPKR2;  
   73::215     3e-05  29%  686 aa  PDPKA_DICDI RecName: Full=Probable serine/threonine-protein kinase
  122::240     3e-05  35%  658 aa  P2C31_ARATH RecName: Full=Protein kinase and PP2C-like
    4::210     3e-05  32%  506 aa  NEK3_HUMAN RecName: Full=Serine/threonine-protein kinase Nek3;     
  521::663     3e-05  26%  819 aa  MYLK3_PONAB RecName: Full=Putative myosin light chain kinase 3;    
  521::663     3e-05  26%  819 aa  MYLK3_HUMAN RecName: Full=Putative myosin light chain kinase 3;    
   73::200     3e-05  28% 1551 aa  MRCKG_HUMAN RecName: Full=Serine/threonine-protein kinase MRCK
   78::164     3e-05  34%  415 aa  MPKC_EMENI RecName: Full=Mitogen-activated protein kinase mpkC;    
   31::183     3e-05  27%  361 aa  MPK14_ARATH RecName: Full=Mitogen-activated protein kinase 14;     
   43::187     3e-05  29%  418 aa  MKNK1_XENLA RecName: Full=MAP kinase-interacting
   41::189     3e-05  27%  379 aa  MK03_HUMAN RecName: Full=Mitogen-activated protein kinase 3;       
    3::149     3e-05  26%  622 aa  MAK_RAT RecName: Full=Serine/threonine-protein kinase MAK;       
    3::149     3e-05  26%  623 aa  MAK_HUMAN RecName: Full=Serine/threonine-protein kinase MAK;       
   17::159     3e-05  31%  833 aa  M4K1_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
 1885::2039    3e-05  27% 2527 aa  LRRK2_HUMAN RecName: Full=Leucine-rich repeat
  345::483     3e-05  26%  647 aa  LIMK1_MOUSE RecName: Full=LIM domain kinase 1;       
   30::179     3e-05  27%  335 aa  KCC1_SCHPO RecName: Full=Calcium/calmodulin-dependent protein
  113::306     3e-05  33%  367 aa  IPL1_ASHGO RecName: Full=Spindle assembly checkpoint kinase;       
   19::164     3e-05  28%  356 aa  HOG1_TRIHA RecName: Full=Mitogen-activated protein kinase hog1;    
   19::164     3e-05  28%  358 aa  HOG1_NEUCR RecName: Full=Mitogen-activated protein kinase hog-1;   
   19::164     3e-05  28%  357 aa  HOG1_MYCGR RecName: Full=Mitogen-activated protein kinase Hog1;    
   19::164     3e-05  28%  357 aa  HOG1_GLOLA RecName: Full=Mitogen-activated protein kinase HOG1;    
   19::164     3e-05  28%  358 aa  HOG1_CRYPA RecName: Full=Mitogen-activated protein kinase HOG1;    
   19::164     3e-05  28%  358 aa  HOG1_BEABA RecName: Full=Mitogen-activated protein kinase HOG1;    
  470::639     3e-05  30%  813 aa  FGFR2_XENLA RecName: Full=Fibroblast growth factor receptor 2;     
   23::164     3e-05  25%  485 aa  DST4_DICDI RecName: Full=Serine/threonine-protein kinase dst4;     
   31::171     3e-05  30%  737 aa  DST1_DICDI RecName: Full=Serine/threonine-protein kinase dst1;     
   80::222     3e-05  31%  544 aa  DSK1_SCHPO RecName: Full=Protein kinase dsk1;       
  393::541     3e-05  33%  766 aa  DCLK2_HUMAN RecName: Full=Serine/threonine-protein kinase DCLK2;   
  197::439     3e-05  23%  450 aa  CSK_RAT RecName: Full=Tyrosine-protein kinase CSK;       
  139::177     3e-05  46%  336 aa  CSK2A_DROME RecName: Full=Casein kinase II subunit alpha;       
  136::174     3e-05  46%  333 aa  CSK23_ARATH RecName: Full=Probable casein kinase II subunit alpha; 
  141::179     3e-05  46%  392 aa  CSK21_XENLA RecName: Full=Casein kinase II subunit alpha;       
  141::179     3e-05  46%  391 aa  CSK21_RAT RecName: Full=Casein kinase II subunit alpha;       
  141::179     3e-05  46%  391 aa  CSK21_RABIT RecName: Full=Casein kinase II subunit alpha;       
  141::179     3e-05  46%  391 aa  CSK21_MOUSE RecName: Full=Casein kinase II subunit alpha;       
  141::179     3e-05  46%  391 aa  CSK21_HUMAN RecName: Full=Casein kinase II subunit alpha;       
  141::179     3e-05  46%  391 aa  CSK21_CHICK RecName: Full=Casein kinase II subunit alpha;       
  141::179     3e-05  46%  391 aa  CSK21_BOVIN RecName: Full=Casein kinase II subunit alpha;       
    9::182     3e-05  25%  301 aa  CRK1_LEIME RecName: Full=Cell division protein kinase 2 homolog
   10::167     3e-05  28%  435 aa  CIPKS_ORYSJ RecName: Full=CBL-interacting protein kinase 28;       
   30::190     3e-05  28%  588 aa  CDK8_CAEEL RecName: Full=Cell division protein kinase 8;       
   30::190     3e-05  28%  613 aa  CDK8_CAEBR RecName: Full=Cell division protein kinase 8;       
    2::136     3e-05  28%  474 aa  CDC2H_CRIFA RecName: Full=Cell division control protein 2 homolog; 
   81::280     3e-05  27%  344 aa  AURKB_BOVIN RecName: Full=Serine/threonine-protein kinase 12;      
 1365::1613    4e-05  30% 1624 aa  YR831_MIMIV RecName: Full=Putative serine/threonine-protein
   23::183     4e-05  23% 1323 aa  TNIK_MOUSE RecName: Full=Traf2 and NCK-interacting protein kinase; 
   23::183     4e-05  23% 1360 aa  TNIK_HUMAN RecName: Full=TRAF2 and NCK-interacting protein kinase; 
    7::148     4e-05  30%  484 aa  SMK2B_MOUSE RecName: Full=Sperm motility kinase 2B;       
   22::162     4e-05  28%  649 aa  SGK71_MACFA RecName: Full=Protein kinase-like protein SgK071;
  158::307     4e-05  26%  624 aa  PPK35_SCHPO RecName: Full=Serine/threonine-protein kinase ppk35;   
   91::168     4e-05  40%  778 aa  PLK4_DROMO RecName: Full=Serine/threonine-protein kinase PLK4;     
    6::199     4e-05  26%  288 aa  PEF1_SCHPO RecName: Full=Serine/threonine-protein kinase pef1;     
  575::766     4e-05  23%  852 aa  PAKB_DICDI RecName: Full=Serine/threonine-protein kinase pakB;     
  454::645     4e-05  26%  719 aa  PAK7_MOUSE RecName: Full=Serine/threonine-protein kinase PAK 7;    
  454::645     4e-05  26%  719 aa  PAK7_HUMAN RecName: Full=Serine/threonine-protein kinase PAK 7;    
    3::164     4e-05  28%  943 aa  NEK5_ORYSJ RecName: Full=Serine/threonine-protein kinase Nek5;     
    3::160     4e-05  26%  555 aa  NEK4_ARATH RecName: Full=Serine/threonine-protein kinase Nek4;     
    3::160     4e-05  26%  585 aa  NEK3_ORYSJ RecName: Full=Serine/threonine-protein kinase Nek3;     
 1486::1633    4e-05  27% 1941 aa  MYLK_MOUSE RecName: Full=Myosin light chain kinase, smooth muscle;   
 1464::1611    4e-05  28% 1914 aa  MYLK_HUMAN RecName: Full=Myosin light chain kinase, smooth muscle;   
   90::245     4e-05  30%  459 aa  MKNK2_RAT RecName: Full=MAP kinase-interacting
   90::245     4e-05  30%  459 aa  MKNK2_MOUSE RecName: Full=MAP kinase-interacting
   42::190     4e-05  27%  380 aa  MK03_RAT RecName: Full=Mitogen-activated protein kinase 3;       
   42::190     4e-05  27%  380 aa  MK03_MOUSE RecName: Full=Mitogen-activated protein kinase 3;       
   18::158     4e-05  27%  873 aa  M4K3_RAT RecName: Full=Mitogen-activated protein kinase kinase
   18::158     4e-05  27%  894 aa  M4K3_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
   18::158     4e-05  27%  894 aa  M4K3_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
   17::159     4e-05  31%  827 aa  M4K1_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
  213::327     4e-05  31%  467 aa  M3K8_RAT RecName: Full=Mitogen-activated protein kinase kinase
  353::508     4e-05  25%  690 aa  LKH1_SCHPO RecName: Full=Dual specificity protein kinase lkh1;     
  345::488     4e-05  25%  647 aa  LIMK1_HUMAN RecName: Full=LIM domain kinase 1;       
   93::320     4e-05  24%  510 aa  KPK2_PLAFK RecName: Full=Probable serine/threonine-protein kinase
  124::316     4e-05  29%  505 aa  KKCC1_HUMAN RecName: Full=Calcium/calmodulin-dependent protein
   49::201     4e-05  32%  353 aa  KAPC_DROME RecName: Full=cAMP-dependent protein kinase catalytic
  201::348     4e-05  30%  512 aa  KAPB_SCHPO RecName: Full=cAMP-dependent protein kinase catalytic
    9::221     4e-05  25%  743 aa  IKKA_XENTR RecName: Full=Inhibitor of nuclear factor kappa-B kinase
   22::235     4e-05  31%  759 aa  IKKA_CHICK RecName: Full=Inhibitor of nuclear factor kappa-B kinase
   19::164     4e-05  28%  357 aa  HOG1_TRIAT RecName: Full=Mitogen-activated protein kinase hog1;    
  197::346     4e-05  24%  722 aa  DYRK2_DROME RecName: Full=Dual specificity
  392::540     4e-05  34%  756 aa  DCLK2_MOUSE RecName: Full=Serine/threonine-protein kinase DCLK2;   
  124::270     4e-05  30%  562 aa  CDPK3_PLAF7 RecName: Full=Calcium-dependent protein kinase 3;      
   82::157     4e-05  38%  327 aa  CDKF2_ORYSJ RecName: Full=Putative cyclin-dependent kinase F-2;    
    3::159     4e-05  27%  346 aa  CCRK_HUMAN RecName: Full=Cell cycle-related kinase;       
   97::227     4e-05  31%  360 aa  AURKB_XENTR RecName: Full=Serine/threonine-protein kinase 12;      
   97::227     4e-05  31%  361 aa  AUKBA_XENLA RecName: Full=Serine/threonine-protein kinase 12-A;    
 1117::1279    4e-05  33% 1620 aa  ALK_HUMAN RecName: Full=ALK tyrosine kinase receptor;       
  128::388     4e-05  26% 1040 aa  ACK1_RAT RecName: Full=Activated CDC42 kinase 1;       
  144::343     5e-05  29%  407 aa  STK6_XENLA RecName: Full=Serine/threonine-protein kinase 6;        
   10::212     5e-05  28%  499 aa  SMKW_MOUSE RecName: Full=Sperm motility kinase W;       
  813::956     5e-05  27% 1367 aa  PKGA_DICDI RecName: Full=Probable serine/threonine-protein kinase
   46::260     5e-05  28%  323 aa  PIM3_XENLA RecName: Full=Serine/threonine-protein kinase Pim-3;    
   12::272     5e-05  29% 1455 aa  NRK_MOUSE RecName: Full=Nik-related protein kinase;       
   47::200     5e-05  38%  313 aa  NEK6_RAT RecName: Full=Serine/threonine-protein kinase Nek6;       
   47::200     5e-05  38%  313 aa  NEK6_PIG RecName: Full=Serine/threonine-protein kinase Nek6;       
   47::200     5e-05  38%  313 aa  NEK6_MOUSE RecName: Full=Serine/threonine-protein kinase Nek6;     
   47::200     5e-05  38%  313 aa  NEK6_HUMAN RecName: Full=Serine/threonine-protein kinase Nek6;     
   28::180     5e-05  32%  645 aa  NEK11_HUMAN RecName: Full=Serine/threonine-protein kinase Nek11;   
 1453::1600    5e-05  30% 1906 aa  MYLK_CHICK RecName: Full=Myosin light chain kinase, smooth muscle;   
   13::218     5e-05  29%  481 aa  MYLKE_DICDI RecName: Full=Probable myosin light chain kinase
   71::262     5e-05  29%  393 aa  MP2K1_CRIGR RecName: Full=Dual specificity mitogen-activated
  213::327     5e-05  30%  467 aa  M3K8_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
  406::613     5e-05  29%  736 aa  KPCE_RABIT RecName: Full=Protein kinase C epsilon type;       
  407::614     5e-05  28%  737 aa  KPCE_MOUSE RecName: Full=Protein kinase C epsilon type;       
  407::614     5e-05  29%  737 aa  KPCE_HUMAN RecName: Full=Protein kinase C epsilon type;       
  303::509     5e-05  26%  634 aa  KPC3_DROME RecName: Full=Protein kinase C;         Short=PKC;      
  320::526     5e-05  30%  649 aa  KPC1_APLCA RecName: Full=Calcium-dependent protein kinase C;       
   90::285     5e-05  28%  398 aa  KAPC_YEAST RecName: Full=cAMP-dependent protein kinase type 3;     
   84::236     5e-05  32%  404 aa  KAPC_CAEEL RecName: Full=cAMP-dependent protein kinase catalytic
  170::302     5e-05  31%  361 aa  IPL1_KLULA RecName: Full=Spindle assembly checkpoint kinase;       
  176::290     5e-05  28%  390 aa  HT1_ARATH RecName: Full=Serine/threonine-protein kinase HT1;       
  176::262     5e-05  38% 1518 aa  HSL1_YEAST RecName: Full=Probable serine/threonine-protein kinase
   19::164     5e-05  29%  349 aa  HOG1_SCHPO RecName: Full=Mitogen-activated protein kinase sty1;    
   22::167     5e-05  27%  447 aa  HOG1_CANGA RecName: Full=Mitogen-activated protein kinase HOG1;    
    6::166     5e-05  24%  616 aa  HIPK4_MACFA RecName: Full=Homeodomain-interacting protein kinase 4;
    4::166     5e-05  23%  616 aa  HIPK4_HUMAN RecName: Full=Homeodomain-interacting protein kinase 4;
   91::231     5e-05  26%  473 aa  GLKA_DICDI RecName: Full=Probable serine/threonine-protein kinase
  817::862     5e-05  48% 1659 aa  GCN2_YEAST RecName: Full=Serine/threonine-protein kinase GCN2;     
  416::609     5e-05  30% 1241 aa  GCN2_ARATH RecName: Full=Probable serine/threonine-protein kinase
  430::578     5e-05  29%  722 aa  DKF1_CAEEL RecName: Full=Serine/threonine-protein kinase dkf-1;    
  468::616     5e-05  29%  760 aa  DKF1_CAEBR RecName: Full=Serine/threonine-protein kinase dkf-1;    
  208::308     5e-05  37% 2055 aa  CTRO_MOUSE RecName: Full=Citron Rho-interacting kinase;       
  134::189     5e-05  39%  336 aa  CSK2A_NEUCR RecName: Full=Casein kinase II subunit alpha;       
  103::206     5e-05  34%  414 aa  CHK1_ENCCU RecName: Full=Probable serine/threonine-protein kinase
   23::232     5e-05  26%  484 aa  CDPKV_ARATH RecName: Full=Calcium-dependent protein kinase 31;     
   73::222     5e-05  24%  534 aa  CDPK1_ORYSJ RecName: Full=Calcium-dependent protein kinase isoform
  620::766     5e-05  28% 1061 aa  CDC7_DICDI RecName: Full=Probable serine/threonine-protein kinase
  604::733     5e-05  28%  786 aa  BTKL_DROME RecName: Full=Tyrosine-protein kinase Btk29A;       
  128::388     5e-05  28% 1055 aa  ACK1_MOUSE RecName: Full=Activated CDC42 kinase 1;       
  790::982     6e-05  30% 1657 aa  YR826_MIMIV RecName: Full=Putative serine/threonine-protein
    6::132     6e-05  29% 1397 aa  Y2550_DICDI RecName: Full=Probable cyclin-dependent
  681::801     6e-05  30% 1347 aa  Y1197_DICDI RecName: Full=Probable serine/threonine-protein kinase
   29::171     6e-05  34%  328 aa  TSSK4_MOUSE RecName: Full=Testis-specific serine/threonine-protein
  107::190     6e-05  33%  586 aa  STK11_DICDI RecName: Full=Serine/threonine-protein kinase 11
 2682::2826    6e-05  24% 2995 aa  SPEG_DANRE RecName: Full=Striated muscle preferentially expressed
  269::415     6e-05  32%  646 aa  SCK2_SCHPO RecName: Full=Serine/threonine-protein kinase sck2;     
  704::1014    6e-05  27% 1115 aa  RET_MOUSE RecName: Full=Proto-oncogene tyrosine-protein kinase
  856::1061    6e-05  27% 1155 aa  PYK2_DICDI RecName: Full=Dual specificity protein kinase pyk2;       
  235::284     6e-05  36%  474 aa  PMK3_CAEEL RecName: Full=Mitogen-activated protein kinase pmk-3;   
  169::309     6e-05  32%  978 aa  PLK_DICDI RecName: Full=Probable serine/threonine-protein kinase
  373::564     6e-05  27%  639 aa  PAKM_DROME RecName: Full=Serine/threonine-protein kinase PAK mbt;  
  326::517     6e-05  27%  591 aa  PAK4_HUMAN RecName: Full=Serine/threonine-protein kinase PAK 4;    
  514::740     6e-05  30%  799 aa  NTRK1_RAT RecName: Full=High affinity nerve growth factor receptor;
  513::755     6e-05  30%  796 aa  NTRK1_HUMAN RecName: Full=High affinity nerve growth factor
    6::148     6e-05  36%  627 aa  NEK5_MOUSE RecName: Full=Serine/threonine-protein kinase Nek5;     
  288::450     6e-05  26%  613 aa  MYLK2_MOUSE RecName: Full=Myosin light chain kinase 2,
   73::200     6e-05  28% 1551 aa  MRCKG_MOUSE RecName: Full=Serine/threonine-protein kinase MRCK
   72::174     6e-05  30%  361 aa  MK14B_CYPCA RecName: Full=Mitogen-activated protein kinase 14b;    
   31::175     6e-05  30%  361 aa  MK01_XENLA RecName: Full=Mitogen-activated protein kinase 1;       
   73::268     6e-05  29%  355 aa  M2K1_ORYSJ RecName: Full=Mitogen-activated protein kinase kinase 1;
  511::731     6e-05  28%  864 aa  LTK_HUMAN RecName: Full=Leukocyte tyrosine kinase receptor;        
  192::384     6e-05  30%  461 aa  IRAK4_BOVIN RecName: Full=Interleukin-1 receptor-associated kinase
    9::214     6e-05  24%  743 aa  IKKA_XENLA RecName: Full=Inhibitor of nuclear factor kappa-B kinase
  567::738     6e-05  32%  854 aa  DDR2_MOUSE RecName: Full=Discoidin domain-containing receptor 2;   
  186::340     6e-05  30%  528 aa  CTK1_YEAST RecName: Full=CTD kinase subunit alpha;       
  197::418     6e-05  24%  450 aa  CSK_HUMAN RecName: Full=Tyrosine-protein kinase CSK;       
  141::179     6e-05  44%  353 aa  CSK2A_SPOFR RecName: Full=Casein kinase II subunit alpha;       
   12::215     6e-05  29%  443 aa  CIPK2_ORYSJ RecName: Full=CBL-interacting protein kinase 2;        
   10::154     6e-05  29%  329 aa  CDK7_RAT RecName: Full=Cell division protein kinase 7;       
   47::246     6e-05  28%  309 aa  AURKC_HUMAN RecName: Full=Serine/threonine-protein kinase 13;      
   84::212     6e-05  30%  343 aa  AURKB_RAT RecName: Full=Serine/threonine-protein kinase 12;        
   81::280     6e-05  27%  344 aa  AURKB_PIG RecName: Full=Serine/threonine-protein kinase 12;        
   86::214     6e-05  30%  345 aa  AURKB_MOUSE RecName: Full=Serine/threonine-protein kinase 12;      
   13::151     6e-05  35%  282 aa  AUR2_ARATH RecName: Full=Serine/threonine-protein kinase Aurora-2; 
 1121::1283    6e-05  33% 1621 aa  ALK_MOUSE RecName: Full=ALK tyrosine kinase receptor;       
   19::170     8e-05  28% 1126 aa  Y0111_DICDI RecName: Full=Probable serine/threonine-protein kinase
    9::156     8e-05  25%  471 aa  SID1_SCHPO RecName: Full=Serine/threonine-protein kinase sid1;     
  138::300     8e-05  32%  463 aa  SGK1_CAEEL RecName: Full=Serine/threonine-protein kinase sgk-1;    
  486::677     8e-05  26%  834 aa  PUB33_ARATH RecName: Full=U-box domain-containing protein
   30::163     8e-05  32%  769 aa  PLK4_AEDAE RecName: Full=Serine/threonine-protein kinase PLK4;     
   44::196     8e-05  32%  384 aa  PFTK2_HUMAN RecName: Full=Serine/threonine-protein kinase
  542::802     8e-05  26%  839 aa  NTRK3_HUMAN RecName: Full=NT-3 growth factor receptor;       
  538::777     8e-05  26%  818 aa  NTRK2_CHICK RecName: Full=BDNF/NT-3 growth factors receptor;       
   29::228     8e-05  28%  628 aa  NEK11_MOUSE RecName: Full=Serine/threonine-protein kinase Nek11;   
  696::843     8e-05  31% 1147 aa  MYLK_RABIT RecName: Full=Myosin light chain kinase, smooth muscle; 
   44::253     8e-05  24%  773 aa  MRKC_DICDI RecName: Full=Probable serine/threonine-protein kinase
   71::262     8e-05  29%  393 aa  MP2K1_RAT RecName: Full=Dual specificity mitogen-activated protein
   71::262     8e-05  29%  393 aa  MP2K1_RABIT RecName: Full=Dual specificity mitogen-activated
   71::262     8e-05  29%  393 aa  MP2K1_MOUSE RecName: Full=Dual specificity mitogen-activated
   71::262     8e-05  29%  393 aa  MP2K1_HUMAN RecName: Full=Dual specificity mitogen-activated
   43::187     8e-05  29%  417 aa  MKNK1_XENTR RecName: Full=MAP kinase-interacting
   39::189     8e-05  28%  375 aa  MCK1_YEAST RecName: Full=Protein kinase MCK1;       
 1886::2039    8e-05  26% 2527 aa  LRRK2_MOUSE RecName: Full=Leucine-rich repeat
  491::569     8e-05  35%  682 aa  LRKA1_ARATH RecName: Full=Lectin-domain containing receptor kinase
   62::208     8e-05  30%  385 aa  KPSH2_HUMAN RecName: Full=Serine/threonine-protein kinase H2;      
  384::586     8e-05  26%  707 aa  KPCT_RAT RecName: Full=Protein kinase C theta type;       
  325::531     8e-05  30%  658 aa  KPC1_LYTPI RecName: Full=Protein kinase C;         EC=2.7.11.13;
  124::316     8e-05  29%  505 aa  KKCC1_RAT RecName: Full=Calcium/calmodulin-dependent protein kinase
  628::772     8e-05  26% 1142 aa  FHKB_DICDI RecName: Full=Probable serine/threonine-protein kinase
  388::677     8e-05  23%  729 aa  FGFR2_NOTVI RecName: Full=Fibroblast growth factor receptor 2;     
   13::271     8e-05  28%  369 aa  ERK2_DICDI RecName: Full=Extracellular signal-regulated kinase 2;  
  564::739     8e-05  34%  855 aa  DDR2_HUMAN RecName: Full=Discoidin domain-containing receptor 2;   
    5::168     8e-05  31%  432 aa  CIPKH_ARATH RecName: Full=CBL-interacting serine/threonine-protein
    7::166     8e-05  26%  319 aa  CDK4_XENLA RecName: Full=Cell division protein kinase 4;       
    3::159     8e-05  27%  243 aa  CCRK_MACMU RecName: Full=Cell cycle-related kinase;       
   17::233     8e-05  29%  736 aa  BRSK2_HUMAN RecName: Full=BR serine/threonine-protein kinase 2;    
  183::378     8e-05  29%  528 aa  AKT2_CAEEL RecName: Full=Serine/threonine-protein kinase akt-2;    
  196::391     8e-05  32%  541 aa  AKT1_CAEEL RecName: Full=Serine/threonine-protein kinase akt-1;    
  844::1006    1e-04  24% 1385 aa  Y9956_DICDI RecName: Full=Probable serine/threonine-protein kinase
  414::455     1e-04  43%  605 aa  Y6481_DICDI RecName: Full=Probable serine/threonine-protein kinase
   40::196     1e-04  27%  419 aa  Y1638_DICDI RecName: Full=Probable serine/threonine-protein kinase
   12::238     1e-04  25% 1050 aa  ULK1_HUMAN RecName: Full=Serine/threonine-protein kinase ULK1;     
   18::216     1e-04  29%  364 aa  TSSK1_MOUSE RecName: Full=Testis-specific serine/threonine-protein
   31::186     1e-04  30% 1025 aa  TAOK2_XENLA RecName: Full=Serine/threonine-protein kinase TAO2;    
   96::239     1e-04  27%  488 aa  ST32C_MOUSE RecName: Full=Serine/threonine-protein kinase 32C;     
   37::185     1e-04  28%  371 aa  ST17B_RAT RecName: Full=Serine/threonine-protein kinase 17B;       
  101::307     1e-04  29%  431 aa  SGK1_MOUSE RecName: Full=Serine/threonine-protein kinase Sgk1;     
  102::308     1e-04  28%  432 aa  SGK1_CHICK RecName: Full=Serine/threonine-protein kinase Sgk1;     
  161::260     1e-04  34%  417 aa  SBK1_RAT RecName: Full=Serine/threonine-protein kinase SBK1;       
  161::260     1e-04  34%  417 aa  SBK1_MOUSE RecName: Full=Serine/threonine-protein kinase SBK1;     
  161::260     1e-04  34%  424 aa  SBK1_HUMAN RecName: Full=Serine/threonine-protein kinase SBK1;     
   91::167     1e-04  40%  770 aa  PLK4_DROAN RecName: Full=Serine/threonine-protein kinase PLK4;     
  580::725     1e-04  31%  915 aa  PHOT2_ARATH RecName: Full=Phototropin-2;       
  993::1263    1e-04  27% 1323 aa  PASK_HUMAN RecName: Full=PAS domain-containing
  544::790     1e-04  25%  827 aa  NTRK3_CHICK RecName: Full=NT-3 growth factor receptor;       
  244::395     1e-04  29%  634 aa  NLK_CAEEL RecName: Full=Serine/threonine kinase NLK;       
    3::164     1e-04  28%  943 aa  NEK4_ORYSJ RecName: Full=Serine/threonine-protein kinase Nek4;     
  497::639     1e-04  26%  795 aa  MYLK3_MOUSE RecName: Full=Putative myosin light chain kinase 3;    
  102::166     1e-04  37%  416 aa  MST4_MOUSE RecName: Full=Serine/threonine-protein kinase MST4;     
  102::166     1e-04  37%  416 aa  MST4_HUMAN RecName: Full=Serine/threonine-protein kinase MST4;     
   71::262     1e-04  28%  395 aa  MP2K1_XENLA RecName: Full=Dual specificity mitogen-activated
   64::255     1e-04  28%  388 aa  MP2K1_SERCA RecName: Full=Dual specificity mitogen-activated
  619::756     1e-04  34%  891 aa  MKCC_DICDI RecName: Full=Probable serine/threonine-protein kinase
  172::212     1e-04  49%  464 aa  MK10_RAT RecName: Full=Mitogen-activated protein kinase 10;        
  337::491     1e-04  28%  642 aa  LIMK2_CHICK RecName: Full=LIM domain kinase 2;       
   12::169     1e-04  29%  368 aa  KSS1_YEAST RecName: Full=Mitogen-activated protein kinase KSS1;    
  485::582     1e-04  31%  740 aa  KS6A6_DANRE RecName: Full=Ribosomal protein S6 kinase alpha-6;     
  384::586     1e-04  26%  707 aa  KPCT_MOUSE RecName: Full=Protein kinase C theta type;       
  124::316     1e-04  29%  505 aa  KKCC1_MOUSE RecName: Full=Calcium/calmodulin-dependent protein
  191::383     1e-04  31%  460 aa  IRAK4_HUMAN RecName: Full=Interleukin-1 receptor-associated kinase
   66::208     1e-04  30%  714 aa  HUNK_PANTR RecName: Full=Hormonally up-regulated neu
   66::208     1e-04  30%  714 aa  HUNK_MOUSE RecName: Full=Hormonally up-regulated neu
   66::208     1e-04  30%  714 aa  HUNK_HUMAN RecName: Full=Hormonally up-regulated neu
  197::409     1e-04  27%  552 aa  GRK7_BOVIN RecName: Full=G protein-coupled receptor kinase 7;      
  349::548     1e-04  27%  619 aa  DCLK3_MOUSE RecName: Full=Serine/threonine-protein kinase DCLK3;   
  142::180     1e-04  41%  350 aa  CSK22_CHICK RecName: Full=Casein kinase II subunit alpha';       
  148::266     1e-04  33%  451 aa  CIPKM_ORYSJ RecName: Full=CBL-interacting protein kinase 22;       
   97::234     1e-04  29%  551 aa  CDPKJ_ARATH RecName: Full=Calcium-dependent protein kinase 19;     
    3::159     1e-04  26%  346 aa  CCRK_PONAB RecName: Full=Cell cycle-related kinase;       
  128::388     1e-04  28% 1038 aa  ACK1_HUMAN RecName: Full=Activated CDC42 kinase 1;       
  235::439     1e-04  23%  439 aa  ABL_FSVHY RecName: Full=Tyrosine-protein kinase transforming
  332::550     1e-04  22% 1182 aa  ABL2_MOUSE RecName: Full=Tyrosine-protein kinase ABL2;       
    9::134     1e-04  28%  781 aa  ZAKA_DICDI RecName: Full=Dual specificity protein kinase zakA;     
 1061::1266    1e-04  30% 1328 aa  YSK4_HUMAN RecName: Full=SPS1/STE20-related protein kinase YSK4;     
    9::168     1e-04  30%  729 aa  TBK1_MOUSE RecName: Full=Serine/threonine-protein kinase TBK1;     
   31::186     1e-04  30% 1235 aa  TAOK2_RAT RecName: Full=Serine/threonine-protein kinase TAO2;      
   31::186     1e-04  30% 1055 aa  TAOK2_MOUSE RecName: Full=Serine/threonine-protein kinase TAO2;    
   31::186     1e-04  30% 1235 aa  TAOK2_HUMAN RecName: Full=Serine/threonine-protein kinase TAO2;    
   95::238     1e-04  27%  486 aa  ST32C_HUMAN RecName: Full=Serine/threonine-protein kinase 32C;     
  131::185     1e-04  36%  372 aa  ST17B_MOUSE RecName: Full=Serine/threonine-protein kinase 17B;     
 1943::2105    1e-04  31% 2338 aa  ROS_RAT RecName: Full=Proto-oncogene tyrosine-protein kinase ROS;    
    9::210     1e-04  29%  648 aa  PRKC_BACSU RecName: Full=Serine/threonine-protein kinase prkC;     
  129::281     1e-04  28%  534 aa  PPK15_SCHPO RecName: Full=Serine/threonine-protein kinase ppk15;   
  500::644     1e-04  33%  910 aa  PK3_DICDI RecName: Full=Protein kinase 3;         Short=PK3;       
   16::164     1e-04  25%  641 aa  PK1_STRTO RecName: Full=Serine/threonine-protein kinase PK-1;      
  153::245     1e-04  32%  326 aa  PIM3_RAT RecName: Full=Serine/threonine-protein kinase Pim-3;      
  153::245     1e-04  32%  326 aa  PIM3_MOUSE RecName: Full=Serine/threonine-protein kinase Pim-3;    
   38::238     1e-04  31%  311 aa  PIM2_HUMAN RecName: Full=Serine/threonine-protein kinase Pim-2;    
    3::151     1e-04  35% 1203 aa  NEK1_MOUSE RecName: Full=Serine/threonine-protein kinase Nek1;     
   20::243     1e-04  27%  356 aa  MK14C_DROME RecName: Full=Putative mitogen-activated protein kinase
  112::156     1e-04  47%  643 aa  MELK_MOUSE RecName: Full=Maternal embryonic leucine zipper kinase; 
  693::905     1e-04  32% 1380 aa  M3K5_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
  686::898     1e-04  32% 1374 aa  M3K5_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
   73::274     1e-04  28%  348 aa  M2K5_ARATH RecName: Full=Mitogen-activated protein kinase kinase 5;
  378::584     1e-04  30%  707 aa  KPC1B_CAEEL RecName: Full=Protein kinase C-like 1B;       
   15::221     1e-04  29%  740 aa  IKKA_BOVIN RecName: Full=Inhibitor of nuclear factor kappa-B kinase
   19::164     1e-04  28%  400 aa  HOG1_ARXAD RecName: Full=Mitogen-activated protein kinase hog1;    
  878::940     1e-04  36% 1114 aa  E2AK3_MOUSE RecName: Full=Eukaryotic translation initiation factor
  287::330     1e-04  48%  572 aa  DBF2_YEAST RecName: Full=Cell cycle protein kinase DBF2;       
   25::166     1e-04  31%  424 aa  CDKD1_ORYSI RecName: Full=Cyclin-dependent kinase D-1;       
   18::234     1e-04  29%  735 aa  BRSK2_MOUSE RecName: Full=BR serine/threonine-protein kinase 2;    
   32::178     1e-04  30%  778 aa  BRSK1_MOUSE RecName: Full=BR serine/threonine-protein kinase 1;    
   10::199     1e-04  32%  804 aa  ATG1_PICAN RecName: Full=Serine/threonine-protein kinase ATG1;     
   14::229     1e-04  25%  799 aa  AFSK_STRCO RecName: Full=Serine/threonine-protein kinase afsK;     
  332::550     1e-04  22% 1182 aa  ABL2_HUMAN RecName: Full=Tyrosine-protein kinase ABL2;       
   12::163     2e-04  30%  470 aa  YPC2_CAEEL RecName: Full=Putative serine/threonine-protein kinase
  261::411     2e-04  29%  546 aa  YL268_MIMIV RecName: Full=Putative serine/threonine-protein kinase
   27::182     2e-04  27%  896 aa  TAOK3_XENLA RecName: Full=Serine/threonine-protein kinase TAO3;    
   28::173     2e-04  29% 1001 aa  TAOK1_RAT RecName: Full=Serine/threonine-protein kinase TAO1;      
   28::173     2e-04  29% 1001 aa  TAOK1_MOUSE RecName: Full=Serine/threonine-protein kinase TAO1;    
   28::173     2e-04  29% 1001 aa  TAOK1_HUMAN RecName: Full=Serine/threonine-protein kinase TAO1;    
   18::178     2e-04  30%  490 aa  SPS1_YEAST RecName: Full=Sporulation-specific protein 1;       
   23::184     2e-04  27%  422 aa  SPM1_SCHPO RecName: Full=Mitogen-activated protein kinase spm1;    
   38::239     2e-04  26%  372 aa  SPK1_SCHPO RecName: Full=Mitogen-activated protein kinase spk1;    
  421::570     2e-04  29% 1003 aa  SPK1_CAEEL RecName: Full=Serine/threonine-protein kinase spk-1;    
   51::190     2e-04  28%  527 aa  SHKA_DICDI RecName: Full=Dual specificity protein kinase shkA;     
  101::307     2e-04  28%  430 aa  SGK1_RAT RecName: Full=Serine/threonine-protein kinase Sgk1;       
  101::307     2e-04  28%  431 aa  SGK1_RABIT RecName: Full=Serine/threonine-protein kinase Sgk1;     
  101::307     2e-04  28%  431 aa  SGK1_BOVIN RecName: Full=Serine/threonine-protein kinase Sgk1;     
 1944::2106    2e-04  32% 2340 aa  ROS_MOUSE RecName: Full=Proto-oncogene tyrosine-protein kinase ROS;  
  114::185     2e-04  32%  377 aa  PMK1_CAEEL RecName: Full=Mitogen-activated protein kinase pmk-1;   
    8::168     2e-04  26%  777 aa  PLK4_DROPS RecName: Full=Serine/threonine-protein kinase PLK4;     
    8::168     2e-04  26%  777 aa  PLK4_DROPE RecName: Full=Serine/threonine-protein kinase PLK4;     
   87::214     2e-04  33%  646 aa  PKN1_CORGL RecName: Full=Probable serine/threonine-protein kinase
  602::798     2e-04  26%  925 aa  NORK_MEDTR RecName: Full=Nodulation receptor kinase;       
   28::180     2e-04  29%  637 aa  NEK11_MACFA RecName: Full=Serine/threonine-protein kinase Nek11;   
   43::187     2e-04  30%  420 aa  MKNK1_BOVIN RecName: Full=MAP kinase-interacting
  137::182     2e-04  46%  366 aa  MK14A_DROME RecName: Full=Mitogen-activated protein kinase 14A;    
  662::872     2e-04  30% 1331 aa  M3K15_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
  217::392     2e-04  30%  710 aa  IRAK1_MOUSE RecName: Full=Interleukin-1 receptor-associated kinase
   27::233     2e-04  26%  645 aa  IME2_YEAST RecName: Full=Meiosis induction protein kinase
  266::575     2e-04  30%  979 aa  IKSA_DICDI RecName: Full=Probable serine/threonine-protein kinase
   39::262     2e-04  30%  751 aa  IKKB_DROME RecName: Full=Inhibitor of nuclear factor kappa-B kinase
  197::348     2e-04  26% 1191 aa  HIPK3_RAT RecName: Full=Homeodomain-interacting protein kinase 3;  
  197::348     2e-04  26% 1192 aa  HIPK3_MOUSE RecName: Full=Homeodomain-interacting protein kinase 3;
  185::341     2e-04  26% 1211 aa  HIPK1_RAT RecName: Full=Homeodomain-interacting protein kinase 1;  
  185::341     2e-04  26% 1210 aa  HIPK1_MOUSE RecName: Full=Homeodomain-interacting protein kinase 1;
  185::341     2e-04  26% 1210 aa  HIPK1_HUMAN RecName: Full=Homeodomain-interacting protein kinase 1;
   33::183     2e-04  22%  501 aa  GSK3H_DROME RecName: Full=Putative glycogen synthase kinase-3
  109::272     2e-04  24%  490 aa  GSK3A_MOUSE RecName: Full=Glycogen synthase kinase-3 alpha;        
  104::272     2e-04  24%  483 aa  GSK3A_HUMAN RecName: Full=Glycogen synthase kinase-3 alpha;        
  116::207     2e-04  30%  530 aa  FNKB_DICDI RecName: Full=Probable serine/threonine-protein kinase
  197::442     2e-04  23%  450 aa  CSK_BOVIN RecName: Full=Tyrosine-protein kinase CSK;       
  145::183     2e-04  44%  332 aa  CSK2A_SCHPO RecName: Full=Casein kinase II subunit alpha;       
  180::218     2e-04  41%  372 aa  CSK21_YEAST RecName: Full=Casein kinase II subunit alpha;       
   14::171     2e-04  29%  457 aa  CIPKI_ORYSJ RecName: Full=CBL-interacting protein kinase 18;       
   11::223     2e-04  30%  421 aa  CIPKF_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   56::178     2e-04  34%  502 aa  CIPKD_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   79::228     2e-04  26%  542 aa  CDPKB_ORYSJ RecName: Full=Calcium-dependent protein kinase isoform
    7::151     2e-04  34%  590 aa  CDKL3_MACFA RecName: Full=Cyclin-dependent kinase-like 3;       
    7::151     2e-04  34%  592 aa  CDKL3_HUMAN RecName: Full=Cyclin-dependent kinase-like 3;       
   20::175     2e-04  29%  479 aa  CDKF1_ARATH RecName: Full=Cyclin-dependent kinase F-1;       
   26::180     2e-04  30%  416 aa  CDK8_XENLA RecName: Full=Cell division protein kinase 8;       
    3::155     2e-04  28%  360 aa  CDK7_DICDI RecName: Full=Cell division protein kinase 7;       
    1::140     2e-04  28%  280 aa  CDC2B_ANTMA RecName: Full=Cell division control protein 2 homolog
   48::194     2e-04  29%  794 aa  BRSK1_HUMAN RecName: Full=BR serine/threonine-protein kinase 1;    
  154::328     2e-04  29%  456 aa  Y2070_DICDI RecName: Full=Probable serine/threonine-protein kinase
   64::211     2e-04  22%  462 aa  Y0700_DICDI RecName: Full=Probable serine/threonine-protein kinase
   31::173     2e-04  29% 1001 aa  TAO1B_XENLA RecName: Full=Serine/threonine-protein kinase TAO1-B;  
   20::162     2e-04  28%  426 aa  STK25_MOUSE RecName: Full=Serine/threonine-protein kinase 25;      
   20::162     2e-04  27%  426 aa  STK25_BOVIN RecName: Full=Serine/threonine-protein kinase 25;      
  131::185     2e-04  36%  372 aa  ST17B_HUMAN RecName: Full=Serine/threonine-protein kinase 17B;     
   78::148     2e-04  37%  433 aa  SMK4A_MOUSE RecName: Full=Sperm motility kinase 4a;       
   42::186     2e-04  24%  419 aa  PMK2_CAEEL RecName: Full=Mitogen-activated protein kinase pmk-2;   
  109::170     2e-04  34%  932 aa  PKND_CHLPN RecName: Full=Serine/threonine-protein kinase pknD;     
  153::245     2e-04  32%  326 aa  PIM3_HUMAN RecName: Full=Serine/threonine-protein kinase Pim-3;    
   29::247     2e-04  23%  310 aa  PIM1_DANRE RecName: Full=Serine/threonine-protein kinase Pim-1;    
   93::245     2e-04  32%  433 aa  PFTK2_MOUSE RecName: Full=Serine/threonine-protein kinase
  235::275     2e-04  46%  515 aa  NLK_MOUSE RecName: Full=Serine/threonine protein kinase NLK;       
  235::275     2e-04  46%  515 aa  NLK_HUMAN RecName: Full=Serine/threonine protein kinase NLK;       
  176::216     2e-04  46%  454 aa  NLK2_XENTR RecName: Full=Serine/threonine protein kinase NLK2;     
  169::209     2e-04  46%  447 aa  NLK2_XENLA RecName: Full=Serine/threonine protein kinase NLK2;     
  112::156     2e-04  42%  651 aa  MELK_HUMAN RecName: Full=Maternal embryonic leucine zipper kinase; 
  157::316     2e-04  28%  497 aa  MEK1_YEAST RecName: Full=Meiosis-specific serine/threonine-protein
   21::179     2e-04  27%  370 aa  MAPK1_PNECA RecName: Full=Mitogen-activated protein kinase 1;      
  658::868     2e-04  30% 1313 aa  M3K15_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
  841::997     2e-04  29% 1101 aa  KOE5_YEAST RecName: Full=Probable serine/threonine-protein kinase
  130::170     2e-04  49%  361 aa  JNK_SUBDO RecName: Full=Stress-activated protein kinase JNK;       
   15::221     2e-04  27%  745 aa  IKKA_MOUSE RecName: Full=Inhibitor of nuclear factor kappa-B kinase
   80::164     2e-04  32%  354 aa  HOG1_BOTFB RecName: Full=Mitogen-activated protein kinase hog1;    
  197::348     2e-04  25% 1215 aa  HIPK3_HUMAN RecName: Full=Homeodomain-interacting protein kinase 3;
  197::409     2e-04  26%  553 aa  GRK7_PIG RecName: Full=G protein-coupled receptor kinase 7;        
  459::683     2e-04  27%  800 aa  FGFR3_DANRE RecName: Full=Fibroblast growth factor receptor 3;     
  590::804     2e-04  31%  887 aa  FGFR2_DUGJA RecName: Full=Fibroblast growth factor receptor 2;     
  239::414     2e-04  28%  513 aa  E2AK2_RAT RecName: Full=Interferon-induced, double-stranded
  362::561     2e-04  27%  648 aa  DCLK3_HUMAN RecName: Full=Serine/threonine-protein kinase DCLK3;   
   11::219     2e-04  29%  439 aa  CIPKK_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   20::225     2e-04  26%  456 aa  CIPKG_ORYSJ RecName: Full=CBL-interacting protein kinase 16;       
  167::215     2e-04  39%  582 aa  CDPKO_ARATH RecName: Full=Calcium-dependent protein kinase 24;     
   25::166     2e-04  31%  424 aa  CDKD1_ORYSJ RecName: Full=Cyclin-dependent kinase D-1;       
   19::278     2e-04  29%  897 aa  ATG1_YEAST RecName: Full=Serine/threonine-protein kinase ATG1;     
   19::278     2e-04  29%  897 aa  ATG1_YEAS7 RecName: Full=Serine/threonine-protein kinase ATG1;     
  130::284     3e-04  21%  441 aa  Y31E_CAEEL RecName: Full=Putative serine/threonine-protein kinase
   89::230     3e-04  28%  411 aa  Y1639_DICDI RecName: Full=Probable serine/threonine-protein kinase
    9::168     3e-04  29%  729 aa  TBK1_HUMAN RecName: Full=Serine/threonine-protein kinase TBK1;     
   31::173     3e-04  29% 1001 aa  TAO1A_XENLA RecName: Full=Serine/threonine-protein kinase TAO1-A;  
  118::320     3e-04  30%  395 aa  STK6_MOUSE RecName: Full=Serine/threonine-protein kinase 6;        
   22::164     3e-04  28% 1105 aa  STK4L_DICDI RecName: Full=Serine/threonine-protein kinase 4 homolog
   25::168     3e-04  29%  414 aa  ST32B_MOUSE RecName: Full=Serine/threonine-protein kinase 32B;     
  728::912     3e-04  29% 1114 aa  RET_HUMAN RecName: Full=Proto-oncogene tyrosine-protein kinase
   91::167     3e-04  38%  766 aa  PLK4_DROYA RecName: Full=Serine/threonine-protein kinase PLK4;     
   91::167     3e-04  38%  769 aa  PLK4_DROSI RecName: Full=Serine/threonine-protein kinase PLK4;     
   91::167     3e-04  38%  769 aa  PLK4_DROSE RecName: Full=Serine/threonine-protein kinase PLK4;     
   91::167     3e-04  38%  769 aa  PLK4_DROME RecName: Full=Serine/threonine-protein kinase PLK4;     
   91::167     3e-04  38%  766 aa  PLK4_DROER RecName: Full=Serine/threonine-protein kinase PLK4;     
   42::215     3e-04  26%  664 aa  PKND_MYCTU RecName: Full=Serine/threonine-protein kinase pknD;     
    3::160     3e-04  27%  934 aa  PKND_CHLTR RecName: Full=Serine/threonine-protein kinase pknD;     
    3::160     3e-04  27%  934 aa  PKND_CHLTA RecName: Full=Serine/threonine-protein kinase pknD;     
   97::297     3e-04  29%  370 aa  PIM2_MOUSE RecName: Full=Serine/threonine-protein kinase Pim-2;    
   37::186     3e-04  29%  944 aa  NEK9_XENLA RecName: Full=Serine/threonine-protein kinase Nek9;     
  113::254     3e-04  30%  386 aa  MYLK4_MOUSE RecName: Full=Myosin light chain kinase family member
   19::164     3e-04  27%  380 aa  MPKC_ASPCL RecName: Full=Mitogen-activated protein kinase mpkC;    
  225::331     3e-04  32% 1002 aa  M3KL4_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
  118::229     3e-04  28%  961 aa  LIN2_CAEEL RecName: Full=Protein lin-2;AltName: Full=Abnormal cell
  459::656     3e-04  27%  768 aa  KGP1_DROME RecName: Full=cGMP-dependent protein kinase, isozyme 1; 
  311::429     3e-04  29%  759 aa  HRK1_YEAST RecName: Full=Serine/threonine-protein kinase HRK1;     
   13::99      3e-04  31%  278 aa  HOG1_WALSE RecName: Full=Mitogen-activated protein kinase HOG1;    
   13::99      3e-04  31%  278 aa  HOG1_WALMU RecName: Full=Mitogen-activated protein kinase HOG1;    
   12::98      3e-04  31%  278 aa  HOG1_WALIC RecName: Full=Mitogen-activated protein kinase HOG1;    
  199::350     3e-04  21% 1196 aa  HIPK2_MOUSE RecName: Full=Homeodomain-interacting protein kinase 2;
  199::350     3e-04  21% 1168 aa  HIPK2_MESAU RecName: Full=Homeodomain-interacting protein kinase 2;
  199::350     3e-04  21% 1198 aa  HIPK2_HUMAN RecName: Full=Homeodomain-interacting protein kinase 2;
  104::272     3e-04  24%  483 aa  GSK3A_RAT RecName: Full=Glycogen synthase kinase-3 alpha;       
  186::416     3e-04  24%  548 aa  GRK7_SPETR RecName: Full=G protein-coupled receptor kinase 7;      
  480::704     3e-04  26%  821 aa  FGFR2_MOUSE RecName: Full=Fibroblast growth factor receptor 2;     
  480::704     3e-04  26%  821 aa  FGFR2_HUMAN RecName: Full=Fibroblast growth factor receptor 2;     
   23::181     3e-04  31%  370 aa  DAPK2_MOUSE RecName: Full=Death-associated protein kinase 2;       
   23::181     3e-04  30%  370 aa  DAPK2_HUMAN RecName: Full=Death-associated protein kinase 2;       
  197::447     3e-04  23%  450 aa  CSK_CHICK RecName: Full=Tyrosine-protein kinase CSK;       
  150::190     3e-04  44%  339 aa  CSK22_YEAST RecName: Full=Casein kinase II subunit alpha';       
  142::180     3e-04  41%  350 aa  CSK22_MOUSE RecName: Full=Casein kinase II subunit alpha';       
  142::180     3e-04  41%  350 aa  CSK22_HUMAN RecName: Full=Casein kinase II subunit alpha';       
  142::180     3e-04  41%  350 aa  CSK22_BOVIN RecName: Full=Casein kinase II subunit alpha';       
  344::538     3e-04  24%  666 aa  CRK31_ARATH RecName: Full=Putative cysteine-rich receptor-like
    7::137     3e-04  29%  445 aa  CIPK8_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   23::171     3e-04  26%  429 aa  CIPK7_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   22::180     3e-04  27%  441 aa  CIPK6_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   12::171     3e-04  29%  326 aa  CDK6_MOUSE RecName: Full=Cell division protein kinase 6;       
  363::531     3e-04  31%  884 aa  CBK1_EMENI RecName: Full=Serine/threonine-protein kinase cbk1;     
   68::228     3e-04  28%  504 aa  CAMKV_RAT RecName: Full=CaM kinase-like vesicle-associated
   68::228     3e-04  28%  512 aa  CAMKV_MOUSE RecName: Full=CaM kinase-like vesicle-associated
   68::228     3e-04  28%  501 aa  CAMKV_HUMAN RecName: Full=CaM kinase-like vesicle-associated
   68::180     3e-04  28%  436 aa  CAMKV_DANRE RecName: Full=CaM kinase-like vesicle-associated
   57::256     3e-04  27%  320 aa  AURKB_DANRE RecName: Full=Serine/threonine-protein kinase 12;      
    5::161     3e-04  28%  668 aa  ATG1_DICDI RecName: Full=Serine/threonine-protein kinase atg1;     
  166::211     4e-04  35%  636 aa  Y8487_DICDI RecName: Full=Probable cyclin-dependent
   25::168     4e-04  29%  414 aa  ST32B_HUMAN RecName: Full=Serine/threonine-protein kinase 32B;     
  133::282     4e-04  26%  771 aa  SPK1_CAEBR RecName: Full=Serine/threonine-protein kinase spk-1;    
   32::178     4e-04  31%  576 aa  SNF1_SCHPO RecName: Full=SNF1-like protein kinase ssp2;       
   59::260     4e-04  25%  656 aa  RIPK1_MOUSE RecName: Full=Receptor-interacting
  158::297     4e-04  25%  477 aa  PRP4_SCHPO RecName: Full=Serine/threonine-protein kinase prp4;     
   11::148     4e-04  29%  831 aa  PP395_ARATH RecName: Full=Pentatricopeptide repeat-containing
    3::177     4e-04  29%  934 aa  PKND_CHLMU RecName: Full=Serine/threonine-protein kinase pknD;     
   44::236     4e-04  24%  513 aa  PAKH_DICDI RecName: Full=Serine/threonine-protein kinase pakH;     
  413::602     4e-04  26%  682 aa  PAK6_MOUSE RecName: Full=Serine/threonine-protein kinase PAK 6;    
    7::144     4e-04  25%  485 aa  NEK1_DICDI RecName: Full=Probable serine/threonine-protein kinase
  144::199     4e-04  34%  386 aa  MAPK2_MOUSE RecName: Full=MAP kinase-activated protein kinase 2;   
  158::213     4e-04  34%  400 aa  MAPK2_HUMAN RecName: Full=MAP kinase-activated protein kinase 2;   
   87::142     4e-04  34%  329 aa  MAPK2_CRILO RecName: Full=MAP kinase-activated protein kinase 2;   
  171::359     4e-04  29%  966 aa  M3K13_PONAB RecName: Full=Mitogen-activated protein kinase kinase
  403::609     4e-04  30%  743 aa  KPC2_APLCA RecName: Full=Calcium-independent protein kinase C;     
   63::225     4e-04  30%  380 aa  KAPB_YEAST RecName: Full=cAMP-dependent protein kinase type 2;     
   80::164     4e-04  31%  357 aa  HOG1_MAGGR RecName: Full=Mitogen-activated protein kinase HOG1;    
   80::164     4e-04  31%  357 aa  HOG1_GIBZE RecName: Full=Mitogen-activated protein kinase HOG1;    
   35::119     4e-04  31%  200 aa  HOG1_GIBIN RecName: Full=Mitogen-activated protein kinase HOG1;    
   35::119     4e-04  31%  207 aa  HOG1_FUSCU RecName: Full=Mitogen-activated protein kinase HOG1;    
   80::164     4e-04  31%  360 aa  HOG1_CHAGB RecName: Full=Mitogen-activated protein kinase HOG1;    
   16::253     4e-04  25%  453 aa  CIPKO_ORYSJ RecName: Full=CBL-interacting protein kinase 24;       
    9::139     4e-04  29%  446 aa  CIPKO_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   17::234     4e-04  27%  447 aa  CIPK9_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   11::214     4e-04  27%  461 aa  CIPK5_ORYSJ RecName: Full=CBL-interacting protein kinase 5;        
   12::171     4e-04  25%  441 aa  CIPK3_ARATH RecName: Full=CBL-interacting serine/threonine-protein
  144::270     4e-04  31%  662 aa  CHK1_USTMA RecName: Full=Serine/threonine-protein kinase CHK1;     
   62::219     4e-04  28%  545 aa  CDPKA_ARATH RecName: Full=Calcium-dependent protein kinase 10;     
   18::185     4e-04  30%  475 aa  CDKE1_ORYSJ RecName: Full=Cyclin-dependent kinase E-1;       
   26::178     4e-04  30%  464 aa  CDK8_DANRE RecName: Full=Cell division protein kinase 8;       
   20::261     4e-04  28%  875 aa  ATG1_DEBHA RecName: Full=Serine/threonine-protein kinase ATG1;     
   36::181     5e-04  27%  901 aa  YP150_YEAST RecName: Full=Putative serine/threonine-protein kinase
   18::216     5e-04  28%  367 aa  TSSK1_BOVIN RecName: Full=Testis-specific serine/threonine-protein
  686::807     5e-04  26%  971 aa  STE20_ASHGO RecName: Full=Serine/threonine-protein kinase STE20;   
   47::236     5e-04  28%  367 aa  SGK2_RAT RecName: Full=Serine/threonine-protein kinase Sgk2;       
  101::307     5e-04  28%  431 aa  SGK1_MACFA RecName: Full=Serine/threonine-protein kinase Sgk1;     
  101::307     5e-04  28%  431 aa  SGK1_HUMAN RecName: Full=Serine/threonine-protein kinase Sgk1;     
   21::234     5e-04  27%  532 aa  PPK9_SCHPO RecName: Full=Protein kinase domain-containing protein
  158::302     5e-04  25%  763 aa  PKNG_MYCLE RecName: Full=Probable serine/threonine-protein kinase
    3::160     5e-04  27%  934 aa  PKND_CHLTB RecName: Full=Serine/threonine-protein kinase pknD;     
    3::160     5e-04  27%  934 aa  PKND_CHLT2 RecName: Full=Serine/threonine-protein kinase pknD;     
  412::601     5e-04  26%  681 aa  PAK6_PONAB RecName: Full=Serine/threonine-protein kinase PAK 6;    
  412::601     5e-04  26%  681 aa  PAK6_HUMAN RecName: Full=Serine/threonine-protein kinase PAK 6;    
   44::198     5e-04  30%  334 aa  MRK1_ENCCU RecName: Full=Probable serine/threonine-protein kinase
  141::181     5e-04  44%  369 aa  MPK4_ORYSJ RecName: Full=Mitogen-activated protein kinase 4;       
  157::209     5e-04  42%  501 aa  MKC1_CANAL RecName: Full=Mitogen-activated protein kinase MKC1;    
  134::184     5e-04  45%  427 aa  MK08A_CYPCA RecName: Full=Mitogen-activated protein kinase 8A;     
   22::176     5e-04  25%  355 aa  MAPK_FUSSO RecName: Full=Mitogen-activated protein kinase;       
  174::362     5e-04  26%  961 aa  M313B_XENLA RecName: Full=Mitogen-activated protein kinase kinase
  150::267     5e-04  32%  363 aa  M2K2_ARATH RecName: Full=Mitogen-activated protein kinase kinase 2;
  120::164     5e-04  38%  474 aa  KSP1_SCHPO RecName: Full=Serine/threonine-protein kinase ksp1;     
   62::269     5e-04  25%  482 aa  KS6B2_HUMAN RecName: Full=Ribosomal protein S6 kinase beta-2;      
 1399::1487    5e-04  33% 1637 aa  GDT2_DICDI RecName: Full=Probable serine/threonine-protein kinase
  469::633     5e-04  33%  810 aa  FGR1A_DANRE RecName: Full=Basic fibroblast growth factor receptor
  482::706     5e-04  26%  823 aa  FGFR2_CHICK RecName: Full=Fibroblast growth factor receptor 2;     
  155::201     5e-04  40%  348 aa  CSK2A_THEPA RecName: Full=Casein kinase II subunit alpha;       
  155::201     5e-04  40%  348 aa  CSK2A_THEAN RecName: Full=Casein kinase II subunit alpha;       
   82::239     5e-04  33%  508 aa  CIPKJ_ORYSJ RecName: Full=CBL-interacting protein kinase 19;       
   19::167     5e-04  23%  426 aa  CIPK4_ARATH RecName: Full=CBL-interacting serine/threonine-protein
  165::218     5e-04  33%  520 aa  CDPKN_ARATH RecName: Full=Calcium-dependent protein kinase 23;     
  122::175     5e-04  33%  495 aa  CDPKB_ARATH RecName: Full=Calcium-dependent protein kinase 11;     
   12::171     5e-04  29%  326 aa  CDK6_HUMAN RecName: Full=Cell division protein kinase 6;       
   14::229     5e-04  24%  807 aa  AFSK_STRGR RecName: Full=Serine/threonine-protein kinase afsK;     
  128::388     5e-04  25% 1039 aa  ACK1_BOVIN RecName: Full=Activated CDC42 kinase 1;       
  104::174     7e-04  33%  276 aa  YR436_MIMIV RecName: Full=Putative serine/threonine-protein kinase
   22::275     7e-04  26%  921 aa  Y9851_DICDI RecName: Full=Probable serine/threonine-protein kinase
    8::160     7e-04  33%  273 aa  TSSK6_MOUSE RecName: Full=Testis-specific serine/threonine-protein
   27::169     7e-04  30%  898 aa  TAOK3_HUMAN RecName: Full=Serine/threonine-protein kinase TAO3;    
   95::243     7e-04  26%  444 aa  SUR1_CAEEL RecName: Full=Mitogen-activated protein kinase mpk-1;   
   53::210     7e-04  31%  443 aa  SSN3_PHANO RecName: Full=Serine/threonine-protein kinase SSN3;     
  105::266     7e-04  24%  671 aa  RIPK1_HUMAN RecName: Full=Receptor-interacting
  483::642     7e-04  28%  811 aa  PRP4B_DICDI RecName: Full=Serine/threonine-protein kinase prpf4B;  
   29::175     7e-04  28%  338 aa  PPK33_SCHPO RecName: Full=Serine/threonine-protein kinase ppk33;   
  168::318     7e-04  32% 1192 aa  PAR1_CAEEL RecName: Full=Serine/threonine-protein kinase par-1;    
  126::276     7e-04  32% 1088 aa  PAR1_CAEBR RecName: Full=Serine/threonine-protein kinase par-1;    
  542::720     7e-04  27%  864 aa  NTRK3_RAT RecName: Full=NT-3 growth factor receptor;       
  601::797     7e-04  26%  924 aa  NORK_PEA RecName: Full=Nodulation receptor kinase;       
  374::420     7e-04  40%  657 aa  NLK_CAEBR RecName: Full=Serine/threonine kinase NLK;       
   55::204     7e-04  27%  984 aa  NEK9_MOUSE RecName: Full=Serine/threonine-protein kinase Nek9;     
   55::204     7e-04  27%  979 aa  NEK9_HUMAN RecName: Full=Serine/threonine-protein kinase Nek9;     
  124::179     7e-04  34%  330 aa  MAPK2_RABIT RecName: Full=MAP kinase-activated protein kinase 2;   
  170::358     7e-04  29%  959 aa  M3K13_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
  171::359     7e-04  29%  966 aa  M3K13_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
  171::359     7e-04  29%  966 aa  M3K13_BOVIN RecName: Full=Mitogen-activated protein kinase kinase
  558::701     7e-04  30%  875 aa  KPCD2_RAT RecName: Full=Serine/threonine-protein kinase D2;        
  558::701     7e-04  30%  875 aa  KPCD2_MOUSE RecName: Full=Serine/threonine-protein kinase D2;      
  557::700     7e-04  30%  878 aa  KPCD2_HUMAN RecName: Full=Serine/threonine-protein kinase D2;      
    6::152     7e-04  27%  306 aa  KIN28_YEAST RecName: Full=Serine/threonine-protein kinase KIN28;   
   99::174     7e-04  38%  376 aa  JNK1_ANCCA RecName: Full=Stress-activated protein kinase JNK-1;    
  263::431     7e-04  31% 1207 aa  JIL1_DROME RecName: Full=Chromosomal serine/threonine-protein
   97::167     7e-04  35%  385 aa  HOG1_PICST RecName: Full=Mitogen-activated protein kinase HOG1;    
   40::191     7e-04  23%  359 aa  GSK3_CAEBR RecName: Full=Glycogen synthase kinase-3;       
  287::334     7e-04  40%  593 aa  FHKA_DICDI RecName: Full=Probable serine/threonine-protein kinase
  480::755     7e-04  25%  816 aa  FGFR_HYDAT RecName: Full=Fibroblast growth factor receptor;        
   91::235     7e-04  26%  426 aa  ERKA_DROME RecName: Full=Mitogen-activated protein kinase ERK-A;   
  175::221     7e-04  36%  417 aa  ERK1_CANAL RecName: Full=Extracellular signal-regulated kinase 1;  
  741::800     7e-04  32%  918 aa  DUSTY_XENTR RecName: Full=Dual serine/threonine and tyrosine
  458::535     7e-04  36%  658 aa  CRK14_ARATH RecName: Full=Cysteine-rich receptor-like protein
   42::245     7e-04  28%  488 aa  CIPKP_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   23::236     7e-04  31%  511 aa  CIPKD_ORYSJ RecName: Full=Putative CBL-interacting protein kinase
   19::225     7e-04  27%  435 aa  CIPKB_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   14::231     7e-04  26%  496 aa  CHK1_SCHPO RecName: Full=Serine/threonine-protein kinase chk1;     
  130::183     7e-04  33%  508 aa  CDPK_SOYBN RecName: Full=Calcium-dependent protein kinase SK5;     
   39::185     7e-04  28%  488 aa  CDC5_ENCCU RecName: Full=Probable cell cycle
   68::178     7e-04  30%  421 aa  CAMKV_TAKRU RecName: Full=CaM kinase-like vesicle-associated
   21::194     7e-04  25%  545 aa  BUR1_NEUCR RecName: Full=Serine/threonine-protein kinase bur-1;    
  269::409     9e-04  29%  545 aa  YL673_MIMIV RecName: Full=Putative serine/threonine-protein kinase
  204::356     9e-04  25% 1458 aa  YAKA_DICDI RecName: Full=Probable serine/threonine-protein kinase
  200::412     9e-04  26%  695 aa  Y0010_DICDI RecName: Full=Probable serine/threonine-protein kinase
  511::639     9e-04  28%  998 aa  Y0004_DICDI RecName: Full=Probable serine/threonine-protein kinase
  352::544     9e-04  27%  708 aa  WAKLO_ARATH RecName: Full=Wall-associated receptor kinase-like 14; 
  457::661     9e-04  23%  788 aa  WAKLK_ARATH RecName: Full=Putative wall-associated receptor
  997::1077    9e-04  28% 1357 aa  VGFR2_DANRE RecName: Full=Vascular endothelial growth factor receptor
   16::220     9e-04  24%  472 aa  ULK3_HUMAN RecName: Full=Serine/threonine-protein kinase ULK3;     
   27::169     9e-04  30%  898 aa  TAOK3_PONAB RecName: Full=Serine/threonine-protein kinase TAO3;    
   78::148     9e-04  36%  484 aa  SMKTR_MOUSE RecName: Full=Sperm motility kinase Tcr mutant form;   
   98::168     9e-04  34%  504 aa  SMK2A_MOUSE RecName: Full=Sperm motility kinase 2a;       
   47::236     9e-04  28%  367 aa  SGK2_MOUSE RecName: Full=Serine/threonine-protein kinase Sgk2;     
  103::309     9e-04  27%  433 aa  SGK1_DANRE RecName: Full=Serine/threonine-protein kinase Sgk1;     
  370::511     9e-04  27%  741 aa  RN5A_HUMAN RecName: Full=2-5A-dependent ribonuclease;       
 1059::1250    9e-04  32% 1338 aa  PYK3_DICDI RecName: Full=Dual specificity protein kinase pyk3;       
   41::180     9e-04  36%  615 aa  PLK3_CAEEL RecName: Full=Serine/threonine-protein kinase plk-3;    
  168::309     9e-04  29%  496 aa  PCTK1_MOUSE RecName: Full=Serine/threonine-protein kinase
  141::187     9e-04  40%  372 aa  NTF3_TOBAC RecName: Full=Mitogen-activated protein kinase homolog
    3::151     9e-04  32% 1258 aa  NEK1_HUMAN RecName: Full=Serine/threonine-protein kinase Nek1;     
  578::858     9e-04  26%  869 aa  MUSK_HUMAN RecName: Full=Muscle, skeletal receptor tyrosine protein
  193::324     9e-04  26%  419 aa  MP2K7_RAT RecName: Full=Dual specificity mitogen-activated protein
  209::340     9e-04  26%  535 aa  MP2K7_MOUSE RecName: Full=Dual specificity mitogen-activated
  193::324     9e-04  26%  419 aa  MP2K7_HUMAN RecName: Full=Dual specificity mitogen-activated
  172::212     9e-04  46%  464 aa  MK10_MOUSE RecName: Full=Mitogen-activated protein kinase 10;      
  172::212     9e-04  46%  464 aa  MK10_HUMAN RecName: Full=Mitogen-activated protein kinase 10;      
  134::174     9e-04  46%  423 aa  MK09_RAT RecName: Full=Mitogen-activated protein kinase 9;       
  134::174     9e-04  46%  423 aa  MK09_MOUSE RecName: Full=Mitogen-activated protein kinase 9;       
  134::174     9e-04  46%  424 aa  MK09_HUMAN RecName: Full=Mitogen-activated protein kinase 9;       
  134::174     9e-04  46%  382 aa  MK09_CHICK RecName: Full=Mitogen-activated protein kinase 9;       
  134::174     9e-04  46%  426 aa  MK08_XENLA RecName: Full=Mitogen-activated protein kinase 8;       
  134::174     9e-04  46%  411 aa  MK08_RAT RecName: Full=Mitogen-activated protein kinase 8;       
  134::174     9e-04  46%  384 aa  MK08_MOUSE RecName: Full=Mitogen-activated protein kinase 8;       
  134::174     9e-04  46%  427 aa  MK08_HUMAN RecName: Full=Mitogen-activated protein kinase 8;       
   23::176     9e-04  28%  721 aa  MK06_CHICK RecName: Full=Mitogen-activated protein kinase 6;       
  141::187     9e-04  40%  384 aa  MAPK_PETHY RecName: Full=Mitogen-activated protein kinase homolog
  241::347     9e-04  30% 1036 aa  M3KL4_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
  455::532     9e-04  40%  650 aa  LIMK_DICDI RecName: Full=Probable LIM domain-containing
  581::724     9e-04  32%  889 aa  KPCD3_MOUSE RecName: Full=Serine/threonine-protein kinase D3;      
  582::725     9e-04  32%  890 aa  KPCD3_HUMAN RecName: Full=Serine/threonine-protein kinase D3;      
  103::172     9e-04  38%  372 aa  JNK_DROME RecName: Full=Stress-activated protein kinase JNK;       
  559::665     9e-04  24%  967 aa  IRE1_CAEEL RecName: Full=Serine/threonine-protein
  217::392     9e-04  31%  712 aa  IRAK1_HUMAN RecName: Full=Interleukin-1 receptor-associated kinase
   97::167     9e-04  34%  377 aa  HOG1_CANAL RecName: Full=Mitogen-activated protein kinase HOG1;    
  191::409     9e-04  25%  553 aa  GRK7_HUMAN RecName: Full=G protein-coupled receptor kinase 7;      
  458::745     9e-04  22%  796 aa  FGFR3_PLEWA RecName: Full=Fibroblast growth factor receptor 3;     
  879::941     9e-04  34% 1115 aa  E2AK3_HUMAN RecName: Full=Eukaryotic translation initiation factor
  265::424     9e-04  24%  828 aa  DYRK3_DROME RecName: Full=Putative dual specificity
  739::798     9e-04  32%  916 aa  DUSTY_XENLA RecName: Full=Dual serine/threonine and tyrosine
  478::646     9e-04  29%  832 aa  DOA_DROME RecName: Full=Serine/threonine-protein kinase Doa;       
  140::190     9e-04  38%  360 aa  CSK2A_CAEEL RecName: Full=Casein kinase II subunit alpha;       
  415::512     9e-04  28%  651 aa  CRK42_ARATH RecName: Full=Cysteine-rich receptor-like protein
   11::225     9e-04  26%  439 aa  CIPKQ_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   10::151     9e-04  28%  593 aa  CDR1_SCHPO RecName: Full=Mitosis inducer protein kinase cdr1;      
  128::179     9e-04  33%  485 aa  CDPKR_ARATH RecName: Full=Calcium-dependent protein kinase 27;     
   18::159     9e-04  28%  391 aa  CDKD3_ARATH RecName: Full=Cyclin-dependent kinase D-3;       
  180::398     9e-04  25%  689 aa  ARBK1_MESAU RecName: Full=Beta-adrenergic receptor kinase 1;       
  269::466     9e-04  29%  611 aa  AKT1_DROME RecName: Full=RAC serine/threonine-protein kinase;      
    1::305

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MATICELVQLPVGSECGKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEV
TTBK1_MOUSE     -----------------RWKVLKKIGGGGFGEIY-EAMDLLTRENVALKVESAQQPKQVLKMEVAVL---
TTBK1_HUMAN     -----------------RWKVLKKIGGGGFGEIY-EAMDLLTRENVALKVESAQQPKQVLKMEVAVL---
TTBK2_HUMAN     -----------------RWKVLRKIGGGGFGEIYDALDM-LTRENVALKVESAQQPKQVLKMEVAVL---
TTBK2_MOUSE     -----------------RWKVLRKIGGGGFGEIYDALDM-LTRENVALKVESAQQPKQVLKMEVAVL---
Y2354_DICDI     ----------------GRWTVVKKIGQGAFGEIFS-GKNIINNEQIAIKVEKVDTKKQVLRLEVAVLKKL
YMX8_CAEEL      ---------LEIGAVVGKYKVVQKLGEGGCGSVFKVEDTSEKGQHYALKVEFKSQDAGILKMEVQIL---
YKL2_CAEEL      -----------------RWSIEGVIGNGGYGQIFMVMDVKKND-ERAMKIEPK------LRAEVITKRMI
YOO1_CAEEL      --------------------------------------------EYAMKTELKSKHSSRLKIERNVMESY
CKI2_SCHPO      ----------------------RKIGEGSFGVIF--------------------DGMNLLNNQIAIKFEP
KC1_DICDI       ----------------GKYRISRKIGGGSFGEIYLISTNE----EVAIKLEPAK------AIHPQLLFES
KC1E_MOUSE      -------MELRVGN---KYRLGRKIGSGSFGDIYLGANIASGE-------------------EVAIKLEC
KC1E_HUMAN      -------MELRVGN---KYRLGRKIGSGSFGDIYLGANIASGE-------------------EVAIKLEC
KC1_PLAF7       -----------------KYALGKKLGSGSFGDIY-VAKDIVTMEEFAVKLESTRSK------HPQLLYES
KC1E_CHICK      -------MELRVGN---KYRLGRKIGSGSFGDIYLGANIATGE-------------------EVAIKLEC
KC1D_XENTR      -------MELRVGN---RYRLGRKIGSGSFGDIYLGTDIAAAE-EVAIKLECVKTKHPQLHIESKIYKMM
KC1D_XENLA      -------MELRVGN---RYRLGRKIGSGSFGDIYLGTDIAASE-EVAIKLECVKTKHPQLHIESKIYKMM
KC1_PLAYO       -----------------KYALGKKLGSGSFGDIY-VAKDIVTMEEFAVKLESTRSK------HPQLLYES
KC1DB_DANRE     -------MELRVGN---RYRLGRKIGSGSFGDIYLGTDISVGE-EVAIKLECVKTKHPQLHIESKIYKMM
KC1DA_DANRE     -------MELRVGN---RYRLGRKIGSGSFGDIYLGTDITTGE-EVAIKLECVKTKHPQLHIESKIYKMM
KC1D_RAT        -------MELRVGN---RYRLGRKIGSGSFGDIYLGTDIAAGE-EVAIKLECVKTKHPQLHIESKIYKMM
KC1D_MOUSE      -------MELRVGN---RYRLGRKIGSGSFGDIYLGTDIAAGE-EVAIKLECVKTKHPQLHIESKIYKMM
KC1D_HUMAN      -------MELRVGN---RYRLGRKIGSGSFGDIYLGTDIAAGE-EVAIKLECVKTKHPQLHIESKIYKMM
KC1D_BOVIN      -------MELRVGN---RYRLGRKIGSGSFGDIYLGTDIAAGE-EVAIKLECVKTKHPQLHIESKIYKMM
KC1A_RAT        ----------------GKYKLVRKIGSGSFGDIYLAINITNGE-EVAVKLESQK------ARHPQLLYES
KC1D_PONAB      -------MELRVGN---RYRLGRKIGSGSFGDIYLGTDIAAGE-EVAIKLECVKTKPPQLHIESKIYKMM
KC1A_DROME      ----------------GKYRVIRKIGSGSFGDIYLGMSIQSGE-EVAIKMESAH------ARHPQLLYEA
KC12_YEAST      ------------------YKIGKKIGEGSFGVLF-----EGTNMINGLPVAIKFEPRKT---------EA
KC1_TOXGO       ----------------GKYRLGRKIGSGSFGDIY-IGANILTGDEVAIKLES------IKSKHPQLLYES
KC1_PLAF4       -----------------KYALGKKLGSGSFGDIY-VAKDIVTMEEFAVKLESTRSK------HPQLLYES
HHP1_SCHPO      -----------------KYRIGRKIGSGSFGDIYLGTNVVSGE-EVAIKLESTRAKHPQLEYEYRVYRIL
KC1A_XENLA      ----------------GKYKLVRKIGSGSFGDIYLAINITNGE-EVAVKLESQK------ARHPQLLYES
KC1A_SHEEP      ----------------GKYKLVRKIGSGSFGDIYLAINITNGE-EVAVKLESQK------ARHPQLLYES
KC1A_RABIT      ----------------GKYKLVRKIGSGSFGDIYLAINITNGE-EVAVKLESQK------ARHPQLLYES
KC1A_MOUSE      ----------------GKYKLVRKIGSGSFGDIYLAINITNGE-EVAVKLESQK------ARHPQLLYES
KC1A_HUMAN      ----------------GKYKLVRKIGSGSFGDIYLAINITNGE-EVAVKLESQK------ARHPQLLYES
KC1A_CHICK      ----------------GKYKLVRKIGSGSFGDIYLAINITNGE-EVAVKLESQK------ARHPQLLYES
KC1A_BOVIN      ----------------GKYKLVRKIGSGSFGDIYLAINITNGE-EVAVKLESQK------ARHPQLLYES
KC1D_ARATH      -----------------KFRLGRKIGSGSFGEIYLGTNIHTNE-ELAIKLE------NVKTKHPQLLYES
KC1A_CAEEL      -----------------KYKLIRKIGSGSFGDIY-VSINVTNGEEVAIKLESNR------ARHPQLLYES
KC11_YEAST      ------------------YKIGKKIGEGSFGVLFEGTNMING-VPVAIKFEPRKTEAPQLRDEY------
DCO_DROME       -------MELRVGN---KYRLGRKIGSGSFGDIYLGTTINTGE-EVAIKLECIRTKHPQLHIE-SKFYKT
YOO3_CAEEL      ------------------WKVIVELGKGGYGTVNKVIKVNEEGFEYAMKTEQKSKHSSRLKIERNVMASY
RAG8_KLULA      ------------------YKIGKKIGEGSFGVLF-EGVNMINNVPVAIKFEPRKTDAPQLKDEY------
KC1AL_HUMAN     ----------------GKYKLVRKIGSGSFGDVYLITTTNGEDVAVKLESQKVKHPQLLYESKLYTIL--
KIN20_CAEEL     -------MELRVGN---RFRLGRKIGSGSFGDIYL-GQNIQTNEEVAVKLECVKSKHPQLHIESRLY---
KC1_EIMTE       ----------------GKYRLGRKIGSGSFGDIYLGTNISTGD-EVAIKLES------VRSRHPQLIYES
CKI3_SCHPO      ----------------------KKIGEGSFGMLFLINNQP-----IALKFESRKSEVPQLRDEYLTY---
HRR25_YEAST     -----------------KFRIGRKIGSGSFGDIYLISGEE-----VAIKLESIRSRHPQLDYESRVYRYL
HHP2_SCHPO      ------VVDIKIGN---KYRIGRKIGSGSFGQIYLGLNTVNGE-QVAVKLEPLKARHHQLEYEFRVYNIL
KC1B_BOVIN      ----------------GRYKLVREIGFGSFGHVYLAIDLTNHE-QVAVKLESENQPRLLHEKELYNFLQG
KC1G1_MACFA     ----------------------KKIGCGNFGELRL--GKNLYTNEYAIKLEPIKSRAPQLHLEY------
KC1G1_HUMAN     ----------------------KKIGCGNFGELRL--GKNLYTNEYAIKLEPIKSRAPQLHLEY------
KC1G1_DANRE     ----------------------KKIGCGNFGELKL--GKNLYTNEYAIKLEPVKSRAPQLHLEY------
YQI1_CAEEL      ----------------------------------------------------------------------
KC1G3_RAT       ----------------------KKIGCGNFGELRL--GKNLYTNEYAIKLEPMKSRAPQLHLEY------
KC1G3_MOUSE     ----------------------KKIGCGNFGELRL--GKNLYTNEYAIKLEPMKSRAPQLHLEY------
KC1G1_MOUSE     ----------------------KKIGCGNFGELRL--GKNLYTNEYAIKLEPIKSRAPQLHLEY------
KC11_ENCCU      --------------------LVQKIASGAFGDIF-IGQNTVTNQTVAVKLEKKAH-YGQLKHEYGVY---
KC1G1_BOVIN     ----------------------KKIGCGNFGELRL--GKNLYTNEYAIKLEPIKSRAPQLHLEY------
KC1G1_RAT       ----------------------KKIGCGNFGELRL--GKNLYTNEYAIKLEPIKSRAPQLHLEY------
KC1G3_PONAB     ----------------------KKIGCGNFGELRL--GKNLYTNEYAIKLEPMKSRAPQLHLEY------
KC1G1_CHICK     ----------------------------------------------------------------------
KC1G2_RAT       ----------------------KKIGCGNFGELRL--GKNLYTNEYAIKLEPIKSRAPQLHLEY------
KC1G2_MOUSE     ----------------------KKIGCGNFGELRL--GKNLYTNEYAIKLEPIKSRAPQLHLEY------
KC1G2_HUMAN     ----------------------KKIGCGNFGELRL--GKNLYTNEYAIKLEPIKSRAPQLHLEY------
CKI1_SCHPO      ----------------------------------------------------------------------
KC1G3_HUMAN     ----------------------KKIGCGNFGELRL--GKNLYTNEYAIKLEPMKSRAPQLHLEY------
KC1G1_XENLA     ----------------------------------------------------------------------
KC13_YEAST      ----------------------------------------------------------------------
KC1G3_BOVIN     ----------------------KKIGCGNFGELRL--GKNLYTNEYAIKLEPMKSRAPQLHLEY------
VRK2_HUMAN      --------------EGNQWVLGKKIGSGGFGLIYLAFPTNKPEKDARHVVKVEYQENGPLFSELKFYQRV
KC12_ENCCU      ------------------YTICREIGKGGFGKVYEVKKKADQK-SYALKIETNAPKAGRNSIEIQAYSEL
389L_IIV6       ------------------WFIGTSIGKGGFGEIYSAAKYKDDDFSFAIKIEPKSNGPLFVEMHVIVEKEI
VPK1_VARV       -----------------QWVVGPLIGKGGFGSIYTTNDNN-----YVVKIEPKAN--GSLFTEQAFYTRV
VPK1_VACCW      -----------------QWVVGPLIGKGGFGSIYTTNDNN-----YVVKIEPKAN--GSLFTEQAFYTRV
VPK1_VACCA      -----------------QWVVGPLIGKGGFGSIYTTNDNN-----YVVKIEPKAN--GSLFTEQAFYTRV
VPK1_VACCC      -----------------QWVVGPLIGKGGFGSIYTTNDNN-----YVVKIEPKAN--GSLFTEQAFYTRV
VRK2_MOUSE      -------VPLPEGKEGNRWALGKMIGSGGFGLIYLAFPTNKPNKDARHVIKLEYQENGPLFSELKFYQRA
VRK1_DANRE      -----------------KWKLGSAVGQGGFGLLYLANEDSSGPVTYVIKVEPSDN--GPLFSELKFYMRA
VRK1_BOVIN      -----------------EWKLGSPIGQGGFGCIYLADMNSSKSVDAPCVVKVEPSDNGPLFTELKFYQRA
V212_FOWPV      -----------------KWILGKQLGSGGFGLVYQVSCKSK-EIDCVAKIEKESGGLRVMKNKTSLDTWM
ZYG1_CAEEL      ------------GSRLSAYSHLKEIGKGGFGVVYAAQRENGEKV--AIKRIDKKVPKNRVWTEIQTMKEL
MDE3_SCHPO      -----------------RYLVKQKLGDGSFGTVYLAQRKEKNGLYETVAVXXXXXXXXXXXXELLKLRES
VRK1_MOUSE      -----------------EWKLGLPIGQGGFGCIYLADTNSSKPVDAPCVVKVEPSDNGPLFTELKFYQRA
MYLKA_DICDI     ----------------------EELGRGAFSIVYLGENKQT-KQRYAIKVINKSE-LGKLKMEVDILKKV
VRK1_HUMAN      -----------------EWKVGLPIGQGGFGCIYLADMNSSESVDAPCVVKVEPSDNGPLFTELKFYQRA
NHK1_DROME      ----------------GQWRIGPSIGVGGFGEIYAACKVGEKNYDAVVKCEPHGN--GPLFVEMHFYLRN
BCK1_YEAST      ------------------WMKGEMIGKGSFGAVYLVKQVEVPK--YSSQNEAILSTVEALRSEVSTLKDL
Y8H9_ENCCU      -----------------KYENIKQVGEGAFGQVYK-SRRTSDGAVFAIKKMPVDRETGF---PFTAIREI
KC1A_PIG        ----------------------------------------------------------------------
ORB6_SCHPO      ------------------FSTIKVIGKGAFGEVRLVQKLDTGKI-YAMKSLLKTDQLAHVKAERDLLVES
CHK1_CAEBR      -------------NEC--YRVIRTLGEGAFGEVLLIVNNKNPDMAVAMKKMQITTQANTNNIRKEFLIQQ
CDK9_SCHPO      --------------------LMEKLGEGTFGEVY-KSQRRKDGKVYALKTEKEGFPITAIR-EIKILKSI
PIT1_SCHPO      ------------------YNVVRKVGDGTFGSVYLATTKTPSKEVVAIKS---------MKKKLAKVSDA
MYLKD_DICDI     ----------------GDYELHKEIGKGAFSVVFLVTEK-KTKKQWAMKIDXXXXXXAALETEIEIMKKV
CDK5_DICDI      -----------------KYSKIEKLGEGTYGIVYKAKNRETGEIVALKRIRLDSEDEGVAIREISLLKEL
BYR2_SCHPO      -----------------KWIRGALIGSGSFGQVYLASSGELMAVKQVISKDRHAKLLDALAGEIALLQEL
PKN2_MYXXA      ----------------GRFRVLRPLGSGGMGEVYLGEQVSLGR-KVAIKVHAQAGMAERFKREARLLSAV
KCC1G_RAT       ---------------------MEVLGSGAFSEVFLVKQRVTGKL-FALKCIKKSPAFSSLENEIAVLKRI
KCC1G_MOUSE     ---------------------MEVLGSGAFSEVFLVKQRVTGKL-FALKCIKKSPAFSSLENEIAVLKRI
STE20_PENMA     ------------GDPTKKYYNLNKIGQGASGGVFTAYETNTNKCVAIKQMNLDLQPKDLIINEILVMKDS
PKH1_YEAST      ----------------------EQLGDGSYSSVVLATARDSGK-KYAVKVLSKEYLIRQKKVKYVTVEKL
MKKA_DICDI      -----------------KWQKGQILGRGGYGSVYLGLNKDTGEL-FAVKVDINSDPILSFSKEIEVMRSL
KCC1G_HUMAN     ---------------------MEVLGSGAFSEVFLVKQRLTGKL-FALKCIKKSPAFSSLENEIAVLKKI
CDK3_HUMAN      ---------------------VEKIGEGTYGVVYKAKNRETGQLKIRLDLEMEGVPSTAIR-EISLLKEL
CD2L7_CAEEL     ------------------YTMLDQIGEGTYGQVYKLTGEQVALKRVRLENEKEGFPITAIR-EIKILRQL
CDK3_MOUSE      ---------------------VEKIGEGTYGVVYKARNKVTGQLKIRLDLEAEGVPSTAVR-EISLLKEL
Y1558_DICDI     ------------------FTLIEKIGEGGFGQVFLAKKKDTGEIVAIKRMSKEKNKVSHIKNERDILAQG
ST38L_DROPS     ---------------------LKVIGRGAFGEVRLVQKKDTGHV-YAMKVLRKADMLAHVRAERDVLVEA
ERN2_HUMAN      ------------------------LGRGAGGTFVFRGQFEGRAVAVKRLLR---ECFGLVRREVQLLQES
CDPKW_ARATH     ----------PTGREISKYTLGRELGRGEFGVTYLCTDKETDDV-FACKSILKK------KLRTAVDIEV
STK38_PONAB     ---------------------LKVIGRGAFGEVRLVQKKDTGHV-YAMKILRKADMLGHIRAERDILVEA
STK38_MOUSE     ---------------------LKVIGRGAFGEVRLVQKKDTGHV-YAMKILRKADMLGHIRAERDILVEA
STK38_HUMAN     ---------------------LKVIGRGAFGEVRLVQKKDTGHV-YAMKILRKADMLGHIRAERDILVEA
STK38_BOVIN     ---------------------LKVIGRGAFGEVRLVQKKDTGHV-YAMKILRKADMLGHIRAERDILVEA
RAF_MSV36       --------------EASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQLQAFRNEVAVLRKT
RAF1_MOUSE      --------------EASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQLQAFRNEVAVLRKT
YRK_CHICK       --------------------LLQKLGNGQFGEVWMGTWNGTTKVAVKTLKPGTMSPEAFLE-EAQIMKRL
STE20_NEUCR     -----------------------KIGQGASGGVYTGHERGSNRLVAIKQMNLEQQPKDLIINEILVMKES
CDPKG_ARATH     -----------------RYTIGKLLGHGQFGYTYVATDKKTGDRVAVKKIDKAKMTIPIVKREVKILQAL
ST38L_HUMAN     ---------------------LKVIGRGAFGEVRLVQKKDTGHI-YAMKILRKSDMLAHIRAERDILVEA
ST38L_DROME     ---------------------LKVIGRGAFGEVRLVQKKDTGHV-YAMKVLRKADMLAHVRAERDVLVEA
KS6AA_XENLA     ------------------FVLLKVLGQGSFGKVFLVRKITPPDANYAMKVLKKATDRVRTKMERDILADV
KS6A1_HUMAN     --------------------LLKVLGQGSFGKVFLVRKVTRPDSGYAMKVLKKATDRVRTKMERDILADV
KCC1D_MOUSE     ------------------------LGTGAFSEVVLAEEKATGKL-FAVKCKALKGKESSIENEIAVLRKI
KCC1D_HUMAN     ------------------------LGTGAFSEVVLAEEKATGKL-FAVKCKALKGKESSIENEIAVLRKI
DMPK_HUMAN      --------------------ILKVIGRGAFSEVAVVKMKQTGQV-YAMKIMNKWDMLK--RGEVSCFREE
RAF1_RAT        --------------EASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQLQAFRNEVAVLRKT
KS6AB_XENLA     ------------------FVLLKVLGQGSFGKVFLVRKITPPDANYAMKVLKKATDRVRTKMERDILADV
YES_XIPHE       -----------------------RLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMSPEAFLE-EAQIMKKL
PKNH_MYCTU      -----------VGSMFGPYHLKRLLGRGGMGEVYEAEHKEWTVAVKLMTAEFSKDPVFRERMK-------
PKNH_MYCBO      -----------VGSMFGPYHLKRLLGRGGMGEVYEAEHKEWTVAVKLMTAEFSKDPVFRERMK-------
KS6A1_RAT       --------------------LLKVLGQGSFGKVFLVRKVTRPDNGYAMKVLKKATDRVRTKMERDILADV
CBK1_YARLI      ---------------------VKVIGKGAFGEVRLVQKRDNGKI-YAMKTMLKKEQWAHVKAERDVLADS
YES_CHICK       -----------------------KLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQ-EAQIMKKL
FHKC_DICDI      -----EQKEMEQGGPQQKYDLREVLGTGNFASVRLGVEKETGN-KYAIKISMTSKRKDSLMDEVNVLTKV
STE20_ASPFU     ---------------------LNKIGQGASGGVYTAYQHGTNNCVAIKQMNLDLQPKKLIINEILVMKDS
RAF1_PONAB      --------------EASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKT
RAF1_HUMAN      --------------EASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKT
ERN2_MOUSE      -----EPAQPPHDPEAGQPTVVGKLGRGAGGTFVFRGQFEGRAVAVKRLLR---ECFGLVRREVQLLQES
CDPK2_PLAFK     -----------------KYIIDEKLGQGTYGCVYKGIDKVTNQL-YAIKEEKKDRLKNINRFEIEIMKKL
CDPK2_PLAF7     -----------------KYIIDEKLGQGTYGCVYKGIDKVTNQL-YAIKEEKKDRLKNINRFEIEIMKKL
CAMK1_ORYSJ     -----------------KYELGREVGRGHFGYTCAATCKELKGDDVAVKVIPKA------KMTTAIAIED
YES_MOUSE       -----------------------KLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQ-EAQIMKKL
YES_HUMAN       -----------------------KLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQ-EAQIMKKL
VRK3_BOVIN      ----------------------------------------------------------------------
RAF1_XENLA      -----------------------RIGSGSFGTVY----KGKWHGDVAVKILKVTDPLQAFRNEVAVLRKT
RAF1_BOVIN      --------------EASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKT
LCK_AOTNA       --------------------LVERLGAGQFGEVWMGYYNDHTKVAVKSLKQGSMSPDAFLA-EANLMKQL
KS6AA_CHICK     -----------------QFELLKVLGQGSFGKVFLVRKITPPDSNYAMKVLKKATDRVRTKIERDILADV
KCC4_RAT        -----------------------ELGRGATSIVYRCKQKGTQK-PYALKVLKKTVDKKIVRTEIGVLLRL
KCC4_HUMAN      -----------------------ELGRGATSIVYRCKQKGTQK-PYALKVLKKTVDKKIVRTEIGVLLRL
KCC1_EMENI      ----------------------RTLGAGTYG---IVREADCSSGKVAVKIILKRNVRGNERMELDLL---
CDC2_BOVIN      ------------------YTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSREISLLKEL
TTK_MOUSE       ------------------YSILKQIGSGGSSKVFQVLNEKKQAIKYVNLEDADSQTIESYRNEIAFLLQQ
TTK_HUMAN       ------------------YSILKQIGSGGSSKVFQVLNEKKQAIKYVNLEEADNQTLDSYRNEIAYLLQQ
RAF1_CHICK      --------------EASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKT
PRKX_MOUSE      ------------GHSLQDWDTIATVGTGTFGRVNLV--KEKTGRQYALKIMSIPDVIRL-KQEQHVQNEK
PKH3_ASHGO      ----------------------EELGHGSYSTVYRVVERSSQH-QYAIKICSKRHIIGENKVKY-VTIEK
KCC1_METAN      -----------------KYKFGRTLGAGTYG---VVREADGPSGKVAIKIILKKNVKGNEKMVYAELDML
CDK9_CHICK      MAKQYDMVECPFCDEVSKYEKLAKIGQGTFGEVFKAKHRQTGKKVALKKVEKEGFPITALR-EIKILQLL
CDK9B_XENLA     -------VEFPYCDEVSKYERLAKIGQGTFGEVFKAKHRQTGKKVALKKVEKEGFPITALR-EIKILQLL
CDK5_RAT        -----------------KYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVALREICLLKEL
CDC2_ORYLU      ---------------------IEKIGEGTYGVVYKGRHKSTGQVVAMKKIRLESEEEGVAVREVSLLQEL
CDC2_ORYLA      ---------------------IEKIGEGTYGVVYKGRHKSTGQVVAMKKIRLESEEEGVAVREVSLLQEL
CDC2_ORYJA      ---------------------IEKIGEGTYGVVYKGRHKSTGQVVAMKKIRLESEEEGVAVREVSLLQEL
CD2L5_MOUSE     ------------GKRCDKFDIIGIIGEGTYGQVYKARDKDTGEMVALKKVEKEGFPITAIR-EIKILRQL
CD2L5_HUMAN     ------------GKRCDKFDIIGIIGEGTYGQVYKARDKDTGEMVALKKVEKEGFPITAIR-EIKILRQL
CBK1_PNECA      ---------------------VKVIGKGAFGEVRLVQKIDTGKI-YAMKTLLKSDQLAHVKAERDVLAES
YES_CANFA       -----------------------KLGQGCFGEVWMGTWNGTTKVAIKTLKLGTMMPEAFLQ-EAQIMKKL
SPKF_SYNY3      ----------------GRYLPVKLLGQGGFGAAYLALDRFTPTMRFVVKQFQPSGNLNQEQLDLALSLAV
SNF1_CANGA      ------------GSRVGNYQIVKTLGEGSFGKVYHVTTGQKVALKIIKKVLAKSDMQGRIEREISYLRLL
SNF1_CANAL      ----------------GRYQILKTLGEGSFGKVKLTGQKVALKI-INRKTLAKSDMQGRVEREISYLRLL
PDPKB_DICDI     ---------------------IRTIGKGAYGKVKLVIEKETQLIXXXXXXXXXXXXXXYVNTEKTILDSL
LCK_HUMAN       --------------------LVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLA-EANLMKQL
KCC4_MOUSE      -----------------------ELGRGATSIVYRCKQKGTQK-PYALKVLKKTVDKKIVRTEIGVLLRL
HCK_HUMAN       ----------------------KKLGAGQFGEVWMATYNKHTKV--AVKMKPGSMSVEAFLAEANVMKTL
CDPK_DAUCA      ----------------GKYTLGKELGRGQFGCVYQCTENSSGQL-YACKLVSKNDKEDI-KREIQILQHL
CDC2_AJECA      ---------------------IEKIGEGTYGVVYKARDLTHPNRIVALKLEAEDEGVPSTAIEISLLKEM
TTK_MACFA       ------------------YSILKQIGSGGSSKVFQVLNEKKQI--YAIKFEADNQTLDSYRNEIAYLLQQ
STE20_ASPOR     ---------------------LNKIGQGASGGVFTAYHNGTGSCVAIKQMNLDLQPKDLIINEIIVMKDS
PRKX_HUMAN      ---------------------LATVGTGTFGRVHLVKEKTA-KHFFALKVMSIPDVIRL-KQEQHVHNEK
HCK_MACFA       ----------------------KKLGAGQFGEVWMATYNKHTKV--AVKMKPGSMSVEAFLAEANLMKTL
CDK5_MOUSE      -----------------KYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVALREICLLKEL
CDK5_HUMAN      -----------------KYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVALREICLLKEL
CDK5_BOVIN      -----------------KYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVALREICLLKEL
CDK11_DICDI     -------------SACRSVDCFKKLNEGAFGVVYCAQDKETEEIVALKKIKMEREREGISVREIKVLMEL
CDC2_PONAB      ------------------YTKIEKIGEGTYGVVYKGRHKTTGQVVTMKKIRLESEEEGVPSREISLLKEL
CDC2_HUMAN      ------------------YTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSREISLLKEL
ZYG1_CAEBR      ------------GTKLSSFQNLQQIGQGGFGVVYSAQRENGEKV--AIKKIGNAASQTRIKEEIKTMKLL
STK4_XENTR      --------------------VLEKLGEGSYGSVYKASHKETSQIVAIKQIPVESDLQEIIK-EIAIMQQC
STE20_MAGGR     -----------------------KIGQGASGGVYTGHERGSNRLVAIKQMNLEQQPKDLIINEILVMKDS
M3K3_ARATH      -----------------RWRKGELIGCGAFGRVYM-------------GMNLDSGELLAIKQVLIAPSSA
DMPK_MOUSE      --------------------ILKVIGRGAFSEVAVVKMKQTGQV-YAMKIMNKWDMLK--RGEVSCFREE
CDPKS_ARATH     ------------------YTIGKLLGHGQFGYTYVVAVKRLDKSKMVLPIAVED-----VKREVQILIAL
CDK9_XENTR      MAKNYDSVEFPYCDEVSKYERLAKIGQGTFGEVFKAKHRQTGKKVALKKVEKEGFPITALR-EIKILQLL
CDK9A_XENLA     MAKNYDSVEFPYCDEVSKYERLAKIGQGTFGEVFKAKHRQTGKKVALKKVEKEGFPITALR-EIKILQLL
CDK5_XENLA      -----------------KYEKLEKIGEGTYGTVFKAKNRDTHEIVALKRVRLDDDDEGVALREICLLKEL
CDC2_ORYCU      ---------------------IEKIGEGTYGVVYKGRHKSTGQVVAMKKIRLESEEEGVAVREVSLLQEL
CDC2_CHICK      ------------------YTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSREISLLKEL
ARK1_SCHPO      ----------------GMFEIGKPLGKGKFGRVYLAKEKKTGFI-VALKTLHKSE-LVQSKIEKQVRREI
YP62_CAEEL      -----------------EYECVNRVDEGTFGVVYRGKDKRTDEIVALKRLKMEKEKEGF---PITALREI
YES_AVISY       -----------------------KLGQGCFGEVWMGTWNGTTKVAIKTLKLGTMMPEAFLQ-EAQIMKKL
ST38L_MOUSE     ---------------------LKVIARGAFGEVRLVQKKDTGHI-YAMKILRKADMLAHIRAERDILVEA
RMIL_AVII1      ----------------GQITVGQRIGSGSFGTVY----KGKWHGDVAVKMLNVTAPLQAFKNEVGVLRKT
RMIL_AVEVR      ----------------GQITVGQRIGSGSFGTVY----KGKWHGDVAVKMLNVTAPLQAFKNEVGVLRKT
PDPK1_MOUSE     ----------------------KILGEGSFSTVVLARELATSR-EYAIKILEKRHIIKENKVPYVTRERD
PDPK1_HUMAN     ----------------------KILGEGSFSTVVLARELATSR-EYAIKILEKRHIIKENKVPYVTRERD
PAK2_RAT        -----------IGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKLIINEILVMKEL
PAK2_RABIT      -----------IGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKLIINEILVMKEL
PAK2_MOUSE      -----------IGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKLIINEILVMKEL
PAK2_HUMAN      -----------IGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKLIINEILVMKEL
PAK1_RAT        -----------VGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKLIINEILVMREN
PAK1_MOUSE      -----------VGDPKKKYTPFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKLIINEILVMREN
PAK1_HUMAN      -----------VGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKLIINEILVMREN
PAK1_BOVIN      -----------VGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKLIINEILVMREN
NEK2_DICDI      -----------------QYEILGALGKGSFGVVSKIKRKEDGRVLVWKEINMQEKEKQLLVNEVNILQKL
LYN_MOUSE       --------------------LVKKLGAGQFGEVWMGYYNNSTKV--AVKTLKPGTMSVQAFLEEANLMKT
LCK_SAISC       --------------------LVERLGAGQFGEVWMGYYNEHTKVAVKSLKQGSMSPDAFLA-EANLMKQL
KCC2_SCHPO      -----------------KYQLIENLGDGAFSQVYSIDRKEHVAVKVIRKYEMNKKQRQGVFKEVNIMRRV
KCC1A_HUMAN     ------------------------LGTGAFSEVILAEDKRTQKL-VAIKCEALEGKEGSMENEIAVLHKI
ERN1_HUMAN      --------------------------------------------------------------EVQLLRES
CDKL4_MOUSE     -----------------KYEKLAKIGEGSYGVVFKCRNKSSGQVVAIKKVESEDDRVKIALREIRMLKQL
CDK8_DICDI      -----------------KYTFSYEIGSGTYGMVYKADDKKRPNNKVAVKKTKEGEGLSLTAYEIGLLKEL
BRAF1_MOUSE     ----------------GQITVGQRIGSGSFGTVY----KGKWHGDVAVKMLNVTAPLQAFKNEVGVLRKT
BRAF1_HUMAN     ----------------GQITVGQRIGSGSFGTVY----KGKWHGDVAVKMLNVTAPLQAFKNEVGVLRKT
BRAF1_COTJA     ----------------GQITVGQRIGSGSFGTVY----KGKWHGDVAVKMLNVTAPLQAFKNEVGVLRKT
BRAF1_CHICK     ----------------GQITVGQRIGSGSFGTVY----KGKWHGDVAVKMLNVTAPLQAFKNEVGVLRKT
STE20_USTMA     ---------------------LQKIGQGASGGVFTAYQVGT-NVSVAIKMNLEQQPKDLIINEILVMKES
STE20_EMENI     ---------------------LNKIGQGASGGVFTAYEQHTNNCVAIKQMNLDLQPKDLIINEILVMKDS
PKH3_YEAST      ----------------------EELGHGSYSTVFKALDKKSPNKIYAIKVCSKKHIIKEAKVKYVTIEKN
NAK1_SCHPO      ------------------YTKLELVGRGSYGAVYICNLTKETVAIKILNLDTDEDEVSDIQKEVAVLSEL
LATS1_MOUSE     ---------------------IKTLGIGAFGEVCL-ARKVDTKALYATKTLRKKDVLAHVKAERDILAEA
LATS1_HUMAN     ---------------------IKTLGIGAFGEVCL-ARKVDTKALYATKTLRKKDVLAHVKAERDILAEA
KAPCA_RAT       ---------------------IKTLGTGSFGRVMLVKHKESGN-HYAMKILDKQKVVKLKQIE-HTLNEK
KAPCA_MOUSE     ---------------------IKTLGTGSFGRVMLVKHKESGN-HYAMKILDKQKVVKLKQIE-HTLNEK
CIPKI_ARATH     ----------------GKYELGKLLGHGTFAKVYL-AQNIKSGDKVAIKVIMKSGLVAHIKREISILRRV
CDK2_XENLA      ---------------------VEKIGEGTYGVVYKARNRETGEIVALKKIRLDTETEGVPSTEISLLKEL
CD2L7_RAT       ------------GKRCDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVEKEGFPITAIR-EIKILRQL
CD2L7_MOUSE     ------------GKRCDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVEKEGFPITAIR-EIKILRQL
VRK3_HUMAN      ----------------------------------------------------------------------
STK33_BOVIN     ------------------YTFGRILGQGSFGMVIEAIDKERETIKKVNKEKAGSSAVKLLEREVDILKSV
STE20_CANGA     ------------GDPKSKYRDLIKIGQGASGGVYIAHDTESEDSVAIKQMNLEKQPKKLILNEILVMRES
MK12_DANRE      ---------------------LKQVGTGAYGTVYALDRRTGAKVAIKLHRPFQSDLFAKRAYELRLLKHM
KCC2_YEAST      ----------------------RTLGAGSFGVVRQLSTNEDVAIKILLKLQGNNVQLQMLYEELSIL---
KAPCA_HUMAN     ---------------------IKTLGTGSFGRVMLVKHKETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
KAPCA_CRIGR     ---------------------IKTLGTGSFGRVMLVKHKETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
FYN_XENLA       --------------------LIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLE-EAQIMKKL
FYN_MOUSE       --------------------LIKRLGNGQFGEVWLGTWNGNTKVAIKTLKPGTMSPESFLE-EAQIMKKL
CDK8_DROME      -----------------------KVGRGTYGHVYKAKWKETSDKEYALK---QIDGTGLSMSEIALLREL
CDC2_MOUSE      ---------------------IEKIGEGTYGVVYKGRHRVTGQIVAMKKIRLESEEEGVPSREISLLKEL
CDC2_CARAU      ---------------------IEKIGEGTYGVVYKGRNKTTGQVVAMKKIRLESEEEGVAVREISLLKEL
Y7597_DROME     --------------------MIAQIGEGTYGQVYKARDHHTNDMVALKKVRLEHEKEGFAVREIKILRQL
VRK3_MOUSE      ----------------------------------------------------------------------
STK33_MOUSE     ------------------YTFGRILGQGSFGMVFEAIDKEKWAIKKVNKEKAGSSAMKLLEREVSILKTV
PPK11_SCHPO     ---------------------LQLIGQGSFGSVFRAQDVESSKI-VALKVDATKDQIETLTQEINFLIDL
PDPK1_RAT       ----------------------KILGEGSFSTVVLARELATSR-EYAIKILEKRHIIKENKVPYVTRERD
PAKC_DICDI      ---------------------MTKIGEGAAGEVFVATSSKNNKRVAIKKIEINNDNAKLLVTEIAIMKTS
PAK1_CAEEL      -----------IGNPDRKYRKVDKIGSGASGSVYTAIEIST-EAEVAIKMNLKDQPKKLIINEILVMREN
MIL_AVIMH       --------------EASEVLLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKT
LYN_RAT         --------------------LVKKLGAGQFGEVWMGYYNNSTKV--AVKTLKPGTMSAQAFLEEANLMKT
KP58_DROME      ---------------------LNRIEEGTYGVVYRAKDKRTNEIVALLKMEKEKEGFPITSLEINTLLKG
KAPCG_MACMU     ---------------------LKTLGTGSYGRVMLVRHRETGN-HYAMKILDKQKVVRLKQVE-HTLNEK
CHK1_XENLA      ------------------WDLVQTLGEGAYGEVQLAVNR---KTEEAVAVKIAADCPENIKKEICINRML
CDKL5_MOUSE     -----------IGNVMNKFEILGVVGEGAYGVVLKCRHKETHEI-VAIKKFKDSEENEEVKRELKMLRTL
CDKL5_HUMAN     -----------IGNVMNKFEILGVVGEGAYGVVLKCRHKETHEI-VAIKKFKDSEENEEVKRELKMLRTL
CDC2_RAT        ---------------------IEKIGEGTYGVVYKGRHRTTGQIVAMKKIRLESEEEGVPSREISLLKEL
STK4_XENLA      --------------------VLEKLGEGSYGSVYKASHKETSQIVAIKQIPVESDLQEIIK-EISIMQQC
PAK3_RAT        -----------VGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKLIINEILVMREN
PAK3_PONPY      -----------VGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKLIINEILVMREN
PAK3_PANTR      -----------VGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKLIINEILVMREN
PAK3_MOUSE      -----------VGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKLIINEILVMREN
PAK3_HUMAN      -----------VGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKLIINEILVMREN
KS6A6_MOUSE     -----------------QFDLLKVLGQGSFGKVFLVRKKTGPDAGYAMKVLRKASDRVRTKMERDILVEV
KS6A5_CHICK     ----------------------KPLGEGSFSICRKCLHK-KTSQEYAVKIISK-------RMEANTQREI
KPK1_ARATH      --------------------VMKVVGKGAFGKVYQVRKKETSEI-YAMKVMMEKNHAEYMKAERDILTKI
KPK19_ARATH     --------------------VLKVVGQGAFGKVYQVRKKDTSEI-YAMKVMVEKNHAEYMKAERDILTKI
KCC1A_RAT       ------------------------LGTGAFSEVILAEDKRTQKL-VAIKCIAKKGKEGSMENEIAVLHKI
KCC1A_MOUSE     ------------------------LGTGAFSEVILAEDKRTQKL-VAIKCIAKKGKEGSMENEIAVLHKI
HCK_MOUSE       ----------------------KKLGAGQFGEVWMATYNKHTKV--AVKMKPGSMSVEAFLAEANLMKSL
FYN_XIPHE       --------------------LIKRLGNGQFGEVWMGTWNGTTKVAVKTLKPGTMSPESFLE-EAQIMKKL
FYN_RAT         --------------------LIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLE-EAQIMKKL
FYN_PIG         --------------------LIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLE-EAQIMKKL
FYN_HUMAN       --------------------LIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLE-EAQIMKKL
FYN_BOVIN       --------------------LIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLE-EAQIMKKL
ERN1_MOUSE      --------------------------------------------------------------EVQLLRES
CDPK1_PLAFK     ---------------------VRKLGSGAYGEVLLCREKDKMKYSITNKIECDDKIHEEIYNEISLLKSL
CDPK1_PLAF7     ---------------------VRKLGSGAYGEVLLCREKDKMKYSITNKIECDDKIHEEIYNEISLLKSL
CDKL1_DANRE     -----------------KYEKISKIGEGSYGVVFKCRNKDTGQIVAIKKVESEDDPIKIALREIRMLKQL
CDK8_AEDAE      -----------------------KVGRGTYGHVYKAHRKESNDTDYALK-QIEGTGLSMSACEIALLREL
CDC28_ENCCU     ---------------------LEKIGEGTYGVVYKARERNTNRVVALKKIRLENENEGIPATTIREILLL
CD2L7_HUMAN     ------------GKRCDKFDIIGIIGEGTYGQVYKARDKDTGELVALKKVEKEGFPITAIR-EIKILRQL
CC2H1_TRYCO     ---------------------LEKIGEGSYGVVYRARDITTDVIVALKRIRLESVEEGVAIREISILKEL
CBK1_YEAST      ---------------------VKVIGKGAFGEVRLVQKKDTGKI-YAMKTLLKSDQLAHVKAERDVLAGS
ARAF_RAT        --------------------LLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQPTAEQAQAFKNEMQVLRKT
ARAF_MOUSE      --------------------LLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQPTAEQAQAFKNEMQVLRKT
AFC1_ARATH      -----------------RYQILSKMGEGTFGQV-LECFDNKNKEVVAIKVIRSIN-----KYREAAMIEI
STK_HYDAT       ----------------------RKLGAGQFGEVWAGVWNNTTQVAVKTLKPGTMSPASFLD-EAGVMKKL
RIM15_YEAST     ------------------YDILKPISKGAYGSVYL-ARKKLTGDYFAIKVLRKSDMIAKVKSERAIMMVQ
PKNB_BIFLO      ----------------------------------------------------------------------
NEKL4_CAEEL     --------------EVGEYELLDQLGAGAFGCVYTVRKKENPAKLLALKEDRESDSFGDMISEVKIIKQQ
LCK_RAT         --------------------LVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLA-EANLMKQL
KS6A5_PONAB     ----------------------KPLGEGSFSICRKCVHK-KSNQAFAVKIISK-------RMEANTQKEI
KDC2_DROME      ------------------YQIIKTVGTGTFGRVCLCRDRISEKY-CAMKILAMTEVIRLVKNERNILREI
KAPCG_HUMAN     ---------------------LRTLGMGSFGRVMLVRHQETGG-HYAMKILNKQKVVKMKQVE-HILNEK
HCK_RAT         ----------------------KKLGAGQFGEVWMATYNKHTKV--AVKMKPGSMSVEAFLAEANLMKTL
DCLK1_HUMAN     -----------------RYKVGRTIGDGNFAVVKECVERSTAR-EYALKIIKKSKCRGMIQNEVSILRRV
COT1_NEUCR      ---------------------IKIIGKGAFGEVKLVQKKADGKV-YAMKIKTEKDQLAHVRAERDILAES
CDC2D_ANTMA     ---------------------LEKVGEGTYGKVYRAMEKSTGKIVALKKTRLHEDEEGV---PPTTLREV
CBK1_CANGA      ------------------------IGKGAFGEVRLVQKKDTGKI-YAMKTLLKSDQLAHVKAERDVLAGT
YES_XENLA       -----------------------KLGQGCFGEVWIGTWNGTTKVAIKTLKPGTMMPEAFLQ-EAQIMKKL
STT7_ARATH      ----------------------KKLGEGSFGVVYKVSLSKKEEGEYVLKKATEYGAVEIWMNEVYGFLDK
SNF1_YEAST      ------------GAHIGNYQIVKTLGEGSFGKVKLTGQKVALKI-INKKVLAKSDMQGRIEREISYLRLL
PDPK2_HUMAN     ----------------------KILGEGSFSTVVLARELATSR-EYAIKILEKRHIIKENKVPYVTRERD
NDRA_DICDI      --------------------VIRIIGRGAFGEVSLVRHRESNDL-YAMKRLKKSE---MLKKEQAAHVRA
KS6A5_HUMAN     ----------------------KPLGEGSFSICRKCVHK-KSNQAFAVKIISK-------RMEANTQKEI
KS6A1_MOUSE     -----------------QFELLKVLGQGSFGKVFLVRKVTRPDSGYAMKVLKKATDRVRTKMERDILADV
KAPCA_PIG       ---------------------IKTLGTGSFGRVMLVKHKETGN-HFAMKILDKQKVVKLKQIE-HTLNEK
KAPCA_CANFA     ---------------------IKTLGTGSFGRVMLVKHKETGN-HFAMKILDKQKVVKLKQIE-HTLNEK
FHKE_DICDI      ------------GGPSNKYFIGEMLGQGNFATVKLAVERTTG-VKYAVKISARKDSLGLSHPNIIQIIEV
CHK1_DROME      ------------------WTLAQTLGEGAYGEVKLLINRQTGEAVAMKMVDLKKHPANSVRKEVCI----
CEK1_SCHPO      ------------------YKILKPISKGAFGSVYL-AQKRTTGDYFAIKILKKSNMIAKVRAERAILMSQ
CDK2_MESAU      ---------------------VEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
CDK2_CARAU      ---------------------VEKIGEGTYGVVYKAKNKVTGETVALKKIRLDTETEGVPSTEISLLKEL
CDC2_DROME      ---------------------IEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSREISLLKEL
CDC2B_XENLA     -----------------EYTKIEKIGEGTYGVVYKGRHKATGQVVAMKKIRLENEEEGVPSREISLLKEL
CBK1_KLULA      ---------------------VKVIGKGAFGEVRLVQKKDTGKI-YAMKTLLKSDQLAHVKAERDVLAGS
CBK1_ASHGO      ---------------------VKVIGKGAFGEVRLVQKKDTGKI-YAMKTLLKSDQLAHVKAERDVLAGS
BLK_MOUSE       --------------------LVRKLGSGQFGEVWMGYYKNNMKVAIKTLKEGTMSPEAFLG-EANVMKTL
AFC2_ARATH      -----------------RYKIYSKMGEGTFGQVLECWDRERKEM-VAVKIVR-----GVKKYREAAMIEI
V226_FOWPV      -----------------QWKIDKLIGCGGFGCVYSTQCASNTR-QAVIKVESLNNTTMVSEVLVYNNIYD
STK4_PAPAN      --------------------VLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVESDLQEIIK-EISIMQQC
STK3_XENLA      --------------------VLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIK-EISIMQQC
PRKY_HUMAN      ---------------------LVTMGTGTFGRVHLVKEKTA-KHFFALKVMSIPDVIRR-KQEQHVHNEK
MYLKF_DICDI     -------VEIKYLEENHKYQIFDRLGSGTFSDVYLCINKENGK-QYAMKIIDKSLVTMIAQMKVETEVNI
KS6A6_HUMAN     -----------------QFELLKVLGQGSFGKVFLVRKKTGPDAGYAMKVLKKASDRVRTKMERDILVEV
IPL1_YARLI      ----------------------KALGKGKFGKVYLVKDKKTGFVSALKCMEKKELVEGNVEKQFRREVEI
CLA4_YEAST      -------------SQCFK--VIEKAGQGASGSVYLAERTHIPKVAIKQMVLSKQPRKELIVNEILVMKDS
CDPKX_ARATH     ------------------YTLSKELGRGQFGVTYLCTEKSTGK-RFACKSISKKKLVTKMRREIQIMQHL
CDKL4_HUMAN     -----------------KYEKLAKTGEGSYGVVFKCRNKTSGQVVAVKKVESEDDPVKIALREIRMLKQL
CDK9_RAT        MAKQYDSVECPFCDEVTKYEKLAKIGQGTFGEVFKAKHRQTGQKVALKKVEKEGFPITALR-EIKILQLL
CDK9_MOUSE      MAKQYDSVECPFCDEVTKYEKLAKIGQGTFGEVFKAKHRQTGQKVALKKVEKEGFPITALR-EIKILQLL
CDK9_HUMAN      MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVEKEGFPITALR-EIKILQLL
CDC2A_XENLA     -----------------EYTKIEKIGEGTYGVVYKGRHKATGQVVAMKKIRLENEEEGVPSREISLLKEL
CDC28_CANAL     ----------------------EKVGEGTYGVVYALDTKHNNRVVALKKIRLESEDEGVPSTEISLLKEM
STK4_SQUAC      --------------------VLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIK-EISIMQQC
STK4_COLGU      --------------------VLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVESDLQEIIK-EISIMQQC
STK4_AOTNA      --------------------VLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVESDLQEIIK-EISIMQQC
MASTL_MOUSE     -------IPVPRPPSIEEFTIVKPISRGAFGKVYLGQKGGKL---YAVKVVKKADMVNKMTHQVQAALAL
LYN_HUMAN       --------------------LVKRLGAGQFGEVWMGYYNNSTKV--AVKTLKPGTMSVQAFLEEANLMKT
LCK_MOUSE       --------------------LVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLA-EANLMKQL
KAPCB_RAT       ----------------------KTLGTGSFGRVMLVKHKATEQY-YAMKILDKQKVVKLKQIEHTLILQA
KAPCB_PIG       ----------------------KTLGTGSFGRVMLVKHKATEQY-YAMKILDKQKVVKLKQIEHTLILQA
KAPCB_MOUSE     ----------------------KTLGTGSFGRVMLVKHKATEQY-YAMKILDKQKVVKLKQIEHTLILQA
KAPCB_CRIGR     ----------------------KTLGTGSFGRVMLVKHKATEQY-YAMKILDKQKVVKLKQIEHTLILQA
KAPCA_SHEEP     ---------------------IKTLGTGSFGRVMLVKHTETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
KAPCA_BOVIN     ---------------------IKTLGTGSFGRVMLVKHMETGN-HYAMKILDKQKVVKLKQIE-HTLNEK
CKB21_ORYSJ     ---------------------LEKVGEGTYGKVYKAREKATGRIVALKKTRLPEDDEGV---PPTALREV
CDKC1_ORYSJ     ---------------------LEQIGEGTYGQVYMARETETQEIVALKKIEREGFPITAIR-EIKILKKL
CDK9_BOVIN      MAKQYDSVECPFCDEVTKYEKLAKIGQGTFGEVFKAKHRKTGQKVALKKVEKEGFPITALR-EIKILQLL
CDK5_GLOMM      -----------------KYEKLEKIGEGTYGTVFKGRNRETLEIVALKRVRLDEDDEGVALREICLLKEL
CDC2_MAIZE      ---------------------VEKIGEGTYGVVYKALDKATNETIALKKIRLEQEDEGVPSTEISLLKEM
CDC2H_THEPA     ---------------------MEKIGEGTYGVVYK-AQNNHGEICALKKIRVEEEDEGIPSTEISLLKEL
CDC2H_THEAN     ---------------------MEKIGEGTYGVVYK-AQNNHGEICALKKIRVEEEDEGIPSTEISLLKEL
CD2L6_MOUSE     -----------------------KVGRGTYGHVYKARRKDKDEKEYALKIEGTGISMSACR-EIALLREL
CD2L6_HUMAN     -----------------------KVGRGTYGHVYKARRKDKDEKEYALKIEGTGISMSACR-EIALLREL
BUR1_CANGA      ----------------GNYKEEEKLGQGTFGEVYLHLQTQRKVAMKRIIVNQENDLFPITQREITILKRL
STK4_OTOGA      --------------------VLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVESDLQEIIK-EISIMQQC
STK4_MOUSE      --------------------VLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVESDLQEIIK-EISIMQQC
STK4_MACMU      --------------------VLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVESDLQEIIK-EISIMQQC
STK4_LEMCA      --------------------VLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVESDLQEIIK-EISIMQQC
STK4_HUMAN      --------------------VLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVESDLQEIIK-EISIMQQC
STK4_CERAE      --------------------VLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVESDLQEIIK-EISIMQQC
STK4_BOVIN      --------------------VLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVESDLQEIIK-EISIMQQC
SRC_RSVPA       -----------------------KLGQGYFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
SRC_RSVP        -----------------------KLGQGCFGEVWMGTWNDTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
PPK18_SCHPO     ------------------YEIIKPISKGTFGTVYL-SRKNTTGEIYAIKVLRKVDMISKVKAERAVLMAQ
OXSR1_PONAB     ---------LPWSINRDDYELQEVIGSGATAVVYCAPKKEKVAIKRINLEKCQTSMDELLK-EIQAMSQC
OXSR1_PIG       ---------LPWSINKDDYELQEVIGSGATAVVYCTPKKEKVAIKRINLEKCQTSMDELLK-EIQAMSQC
OXSR1_HUMAN     ---------LPWSINRDDYELQEVIGSGATAVVYCAPKKEKVAIKRINLEKCQTSMDELLK-EIQAMSQC
NTRK1_CHICK     -----------------KW----ELGEGAFGKVFLAEEQEKTLVAVALKEVTENARLDFQRE--AELLTV
KRAF1_CAEEL     -----------------EFIIQYKVGSGSFGTVYRGEFFGTVAIKKLNVVDPTPSQMAAFKNEVAVLKKT
KCC1B_RAT       ------------------YEIREKLGSGAFSEVMLAQERGSAHL-VALKCIPKKALRGLVENEIAVLRRI
KCC1B_MOUSE     ------------------YEIREKLGSGAFSEVMLAQERGSAHL-VALKCIPKKALRGLVENEIAVLRRI
FHKD_DICDI      ----------------GNFSVVKRCIRRDTGEVFAVKIIDKKKFWSQTKTRRQ------MESEVEILQKI
CHK1_RAT        ------------------WDLVQTLGEGAYGEVQLAVNREEAVAVKIVDMKRAIDCPENIKKEICINKML
CDKC2_ORYSJ     ---------------------LEQIGEGTYGQVYMAKETETNEIVALKKIEREGFPITAIR-EIKILKKL
CDK5_DROME      -----------------KYDKMEKIGEGTYGTVFKGRNRDTMEIVALKRVRLDEDDEGVPSSEICLLKEL
CDK2_RAT        ---------------------VEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSREISLLKEL
CDK2_MOUSE      ---------------------VEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSREISLLKEL
CC2H2_TRYBB     -----------------RYSRIEKVGEGSYGIVYKCHDNFTGRTVAMKRIPLIVNDGGVPSTEVSLLREL
BUB1_HUMAN      ------------------------LGEGAFAQVYEATQGDKNKQKFVLKVQKPANPIGTQLME---RLKP
ARAF_PIG        --------------------LLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQPTAEQAQAFKNEMQVLRKT
STK3_RAT        --------------------VLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDVQEIIK-EISIMQQC
STK3_DANRE      --------------------VLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIK-EISIMQQC
SNF1_CANTR      ----------------GRYQIIKTLGEGSFGKVKLTGQKVALKI-INRKTLAKSDMQGRVEREISYLRLL
LCK_CHICK       --------------------LVEKLGAGQFGEVWMGFYNGHTKVAIKNLKQGSMSPSAFLA-EANLMKNL
KCC2A_RAT       -----------------EYQLFEELGKGAFSVVVLAGQEYAAKIINTKKLSARDHQK--LEREARICRLL
KCC2A_PONAB     -----------------EYQLFEELGKGAFSVVVLAGQEYAAKIINTKKLSARDHQK--LEREARICRLL
KCC2A_MOUSE     -----------------EYQLFEELGKGAFSVVVLAGQEYAAKIINTKKLSARDHQK--LEREARICRLL
KCC2A_HUMAN     -----------------EYQLFEELGKGAFSVVVLAGQEYAAKIINTKKLSARDHQK--LEREARICRLL
KAPCB_HUMAN     ----------------------KTLGTGSFGRVMLVKHKATEQY-YAMKILDKQKVVKLKQIEHTLILQA
KAPCB_BOVIN     ----------------------KTLGTGSFGRVMLVKHKATEQY-YAMKILDKQKVVKLKQIEHTLILQA
IPL1_CANGA      ----------------------RKLGKGKFGKVYCVRHKKSGFI-CALKAIEKNEILQFLKREVDIQLGM
DCLK1_RAT       -----------------RYKVGRTIGDGNFAVVKECIERSTAR-EYALKIIKKSKCRGMIQNEVSILRRV
DCLK1_MOUSE     -----------------RYKVGRTIGDGNFAVVKECIERSTAR-EYALKIIKKSKCRGMIQNEVSILRRV
CKB21_ARATH     ---------------------LEKVGEGTYGKVYRAREKATGKIVALKKTRLHEDEEG---VPSTTLREI
CDKL1_HUMAN     -----------------KYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKLESEDDPVKIALREIRMLKQL
CDK2_ENTHI      ----------------------QQLGEGTYGVVYVALKK--------IKQEREDDGIPVTSVEIAVLLEL
CDK2_CRIGR      ---------------------VEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSREISLLKEL
CDC2_EMENI      ---------------------IEKIGEGTYGVVYKARELTHPNRIVALKLEAEDEGVPSTAIEISLLKEM
CC2H1_TRYBB     ---------------------LQKIGEGSYGVVFRARDVTTGTIVAVKRIRLEKEEEGVAIREISILKEL
ANKK1_MOUSE     ----------PLAQQLGSLTVFTRVASGGFSKVFQARHK-RWRTQYAIKLQKETT-----SSEVTCLFEV
TOS3_YEAST      ----------------GKVKLARDLGTGALVAIKILNRFEK-RSGYSLQLKVENPRVN---QEIEVMKRC
TOS3_YEAS7      ----------------GKVKLARDLGTGALVAIKILNRFEK-RSGYSLQLKVENPRVN---QEIEVMKRC
STK3_MOUSE      --------------------VLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIK-EISIMQQC
STK3_HUMAN      --------------------VLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIK-EISIMQQC
PPK23_SCHPO     ------------------YEILEKIEEGSYGIVYRGLDKSTNTLVALKKIKFDPNGIGFSLREIESLSSI
PKNK_MYCTU      ---------------------VEEIGRGGFGVVYRCVQ---PSLDRAVAVKVLSTDLDRDNLERFL----
PKNK_MYCBO      ---------------------VEEIGRGGFGVVYRCVQ---PSLDRAVAVKVLSTDLDRDNLERFL----
MK11_HUMAN      ---------------------LRPVGSGAYGSVYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHL
KCC2G_RAT       ------------------YQLFEELGKGAFSVVRRCVKKTSTQ-EYAAKIKLSARDHQKLEREARICRLL
KCC2G_MOUSE     ------------------YQLFEELGKGAFSVVRRCVKKTSTQ-EYAAKIKLSARDHQKLEREARICRLL
KCC2G_HUMAN     ------------------YQLFEELGKGAFSVVRRCVKKTSTQ-EYAAKIKLSARDHQKLEREARICRLL
KCC2D_CHICK     -----------------EYQLFEELGKGAFSVVRRC-MKITTGQEYAAKIKLSARDHQKLEREARICRLL
FUS3_YEAST      ------------------------LGEGAYGVVCSATHKPTGEIVAIKKIEPFDKPLFALRTEIKILKHF
E2AK3_CAEEL     ----------------------------------------------------------------AMIVET
CLA4_CANAL      --------------------IVEKAGQGASGNVYLAEMIKDNNRKIAIKMDLDAQPRKLIINEILVMKDS
CHK1_MOUSE      ------------------WDLVQTLGEGAYGEVQLAVNREEAVAVKIVDMKRAIDCPENIKKEICINKML
CDKA1_ORYSJ     ----------------------EKIGEGTYGVVYRARDKVTNETIALKKIRLEQEDEGVPSTEISLLKEM
CDK9_CAEEL      ---------------------LNKIGQGTFGEVFKARCKNTGRMVALKKIEKEGFPITALR-EVKMLEQL
CDK2_HUMAN      ---------------------VEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTEISLLKEL
CDK2_BOVIN      ---------------------VEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSREISLLKEL
CDC2H_PLAYO     -----------------KYHGLEKIGEGTYGVVYKAQNSDGESFKIRLEKEDEGIPSTVSIREISILKEL
CDC2H_PLAFK     -----------------KYHGLEKIGEGTYGVVYK-AQNNYGETFALKKIRLEKEDEGIPSTEISILKEL
CDC2H_PLAF7     -----------------KYHGLEKIGEGTYGVVYK-AQNNYGETFALKKIRLEKEDEGIPSTEISILKEL
CD2L2_HUMAN     ---------------------LNRIEEGTYGVVYRAKDKKTDEIVALLKMEKEKEGFPITSLEINTILKA
CD2L1_MOUSE     ---------------------LNRIEEGTYGVVYRAKDKKTDEIVALLKMEKEKEGFPITSLEINTILKA
CD2L1_HUMAN     ---------------------LNRIEEGTYGVVYRAKDKKTDEIVALLKMEKEKEGFPITSLEINTILKA
CBK1_DEBHA      ---------------------VKVIGKGAFGEVRLVQKRDTGKI-YAMKTLLKSDQLAHVKAERDVLAGS
BUR1_CANAL      ------------------YEVIEKLGQGTFGVVQKAKSKKKQLINHSAK---EGFPITAMR-EITILKQL
STK4_CHICK      --------------------VLEKLGEGSYGSVFKAIHKETGQVVAIKQVPVESDLQEIIK-EISIMQQC
PKNF_MYCTU      ---------LAEGSTFAGFTIVRQLGSGGMGEVYLARHPRLPRQD-ALKVSADGEYRARFNREADAAASL
PKNF_MYCBO      ---------LAEGSTFAGFTIVRQLGSGGMGEVYLARHPRLPRQD-ALKVSADGEYRARFNREADAAASL
PKN2_CORGL      ------------------------IGHGGMSTVWLADDVVNDR-EVAIKVSDNQEFLNRFRNEAQAAENI
OXSR1_MOUSE     ----------------------------------------------------------------------
MASTL_HUMAN     -------IAVPKPPSIEEFSIVKPISRGAFGKVYLGQKGGKL---YAVKVVKKADMINKMTHQVQAALAL
KSG1_SCHPO      ------------------------LGEGSYSTV-LTATENSTKREYAIKV---LDKRHIIKEKKEKYVNI
KS6A5_MOUSE     ----------------------------------------------------------------------
KCC1B_HUMAN     ------------------YEIRERLGSGAFSEVVLAQERGSAHL-VALKCIPKKALRGLVENEIAVLRRI
KAPC_DICDI      ---------------------IRVIGTGTFGKVYLI-QNTKDGCYYAMKCLNKAYVVQLLNSEKSILSSI
G11A_ORYSJ      --------------------LLKKLGCGDIGSVYL-SELSGTKSYFAMKV---MDKASLASRKKLLRAQT
G11A_ORYSI      --------------------LLKKLGCGDIGSVYL-SELNGTKSYFAMKV---MDKASLASRKKLLRAQT
FRK_HUMAN       --------------------LLKRLGSGQFGEVWEGLWNNTTPVAVKTLKPGSMDPNDFLR-EAQIMKNL
CIPKM_ARATH     ----------------GKYDLGKLLGSGAFAKVYQAEDLQNGGESVAIKVVQKKDGLTAVKREISVMRRL
CIPKL_ORYSJ     ----------------GKYEMGRALGEGHFGKVKLARHADTGAA-FAIKILDRQRILAMIKREIATLKLL
CIPKC_ARATH     ----------------GRYEMGKLLGHGTFAKVYL-ARNVKTNESVAIKVIDKEKVLGLIKREISILRRV
CHK1_HUMAN      ------------------WDLVQTLGEGAYGEVQLAVNREEAVAVKIVDMKRAVDCPENIKKEICINKML
CDKA1_ARATH     ---------------------VEKIGEGTYGVVYKARDKVTNETIALKKIRLEQEDEGVPSTEISLLKEM
CD2L1_RAT       ---------------------LNRIEEGTYGVVYRAKDKKTDEIVALLKMEKEKEGFPLTSIEINTILKA
AURK_DICDI      ----------------------KLLGMGRFGHVYLAREK-KSQFIVALKVLFKNQ-LQTHNIEHQLRREI
Y1199_DICDI     --------------------ILQFLGEGALAEVHKGIWKGK---EVAVKIFNESFRLEDFLKEVAILGLI
SSK2_YEAST      -----------------RWQKRNFIGGGTFGRVYSAVDLDNGEILAVKEINIQDSKFPLIKEEMSVLEIL
SRC_RSVH1       -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
SRC1_XENLA      -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
PKNJ_MYCTU      --------ELSAGSVFAGYRIERMLGAGGMGTVYLARNPDLPRSE-ALKVLADLDFRARFVREADVAAGL
PKNJ_MYCBO      --------ELSAGSVFAGYRIERMLGAGGMGTVYLARNPDLPRSE-ALKVLADLDFRARFVREADVAAGL
PKNB_LACLA      -----------------RYRIIKEIGRGGMANVYQGEDTFLGDRLVAIKVNFENDDIAIARFEAFAMAEL
PHO85_KLULA     ---------------------LEKVGNGTYATVYKGLNKTTG-VYVALKLDSEEGTPSTAIREISLMKEL
PAR4_CAEBR      ------------------------IGTGSYGKVYTITRRAAKIMKYE-KLRKIPNGWDNIRSEMSILRRL
MYLKC_DICDI     -----------------------EIGRGAFSIV-----REATSRATGTKVAIKSINTRFIKNKL-LMREI
MYLKB_DICDI     -----------------------EIGRGAFSIVRQGTHKDQVAIKAISKQHVSEADMKRFTREIEIMKKL
MRCKA_RAT       --------------------ILKVIGRGAFGEVAVVKLKNADKV-FAMKILNKWEMLACFREERDVLVNG
MRCKA_MOUSE     --------------------ILKVIGRGAFGEVAVVKLKNADKV-FAMKILNKWEMLACFREERDVLVNG
MRCKA_HUMAN     --------------------ILKVIGRGAFGEVAVVKLKNADKV-FAMKILNKWEMLACFREERDVLVNG
M3K7_DROME      -------------------TLREKVGHGSYGVVCKAVWRDKLVAVKEFFASAEQKDI---EKEVKQLSRV
CTK1_SCHPO      ---------------------IDQIGEGTYGKVYLVALKR-------IRLEQEKDGFPITTVREVKILQR
CRK1_SCHPO      -----------------KWTYVKKVGEGTYAVVFLGRQKETNRRVAIKKIKVGQFKDGI---DISALREI
CHK1_YEAST      ------------------------VGQGAFACVKNAHLQMDPSIILAVKFVPTCKKMGLSDKDITK--EV
CHK1_CHICK      ------------------WDLVQTLGEGAYGEVQLAVNREEAVAVKIVDMKRAADCPENIKKEICINKML
CDPKI_ARATH     -----------------RYTIGKLLGHGQFGFTYVVAVKRIDKAKMTQPIEVED-----VKREVKILQAL
CDPK7_ARATH     ----------PTGHDISQYDLGREVGRGEFGITYLCTDKETGE-KYACKSISKK------KLRTAVDIEV
CDPK2_ORYSJ     ------------------YSLGKELGRGQFGVTYLCTEIASGK-QYACKSISKRKLVSKIRREIQIMQHL
CDPK1_PLAYO     ---------------------VRKLGSGAYGEVLLCKEKNGHS-EKAIKVIKKSDNKNIEKFHEEIYNEI
CDKG2_ORYSJ     ---------------------LNKINEGTYGVVYRARDKKTGEIVALKKVKMEKEPLTSLR-EINILLSF
CDKG2_ORYSI     ---------------------LNKINEGTYGVVYRARDKKTGEIVALKKVKMEKEPLTSLR-EINILLSF
CDKD2_ARATH     ------------------------LGEGTYGVVYKATDTKTGKTVAVKKIRLGNQKEGV---NFTALREI
CDC28_YEAST     -----------MSGELANYKRLEKVGEGTYGVVYKLRPGQGQRVVALKKIRLESEDEGVPSREISLLKEL
BUR1_ASPFU      ---------------------LGKLGEGTFGEVYKARSKKDGSIVALKKILMHNEKDG---FPITALREI
ARAF_HUMAN      --------------------LLKRIGTGSFGTVF----RGRWHGDVAVKVLKVSQPTAAFKNEMQVLRKT
SRC_HUMAN       -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
SPKA_SYNY3      -----------------RYQLVELVGSGAMGQVYRAEDKLLGGVTVAVKFLSQA--LLNPRMKERFEREA
SLK_RAT         ------------------WEIIGELGDGAFGKVYKAQNKETNVLAAAKVIDTKSEELEDYMVEIDILASC
SLK_MOUSE       ------------------WEIIGELGDGAFGKVYKAQNKETNVLAAAKVIDTKSEELEDYMVEIDILASC
SBK1_DANRE      ----------------------------------------------------------------------
NPR1_YEAST      ------------------------LGAGAGGSVKLAQRISDNKIEFRTKFENESDYVKKITSEYCIGTTL
MPS1_DICDI      ------------------------IGKGGSGKVYKVLSGDL-KI-YALKYVCLSDPNEIEAQEIEMLKRL
MPKC_ASPTN      -----------------RYANVRPVGLGAFGLVYDQITQQSVAIKKMMSPFASSAIAKRTYREVKLLKKL
LOK_DROME       ----------------------RKLGSGAYGLVRLVYDTRTCQ-QFAMKIVKKSDPDRVLN-EAKIMKNL
KRAF1_CAEBR     -----------------EFVIHYKVGSGSFGTVYRGEFFGTVAIKKLNVVDPTPSQMAAFKNEVAVLKKT
KPSH1_PINFU     -----------------KYDIKALIGRGNFSKVVRVEHRVT-KQPYAIKMIDRVQGKEVFESEVAVLRRV
KCC2D_RAT       -----------------EYQLFEELGKGAFSVVRRC-MKIPTGQEYAAKIKLSARDHQKLEREARICRLL
KCC2D_RABIT     -----------------EYQLFEELGKGAFSVVRRC-MKIPTGQEYAAKIKLSARDHQKLEREARICRLL
KCC2D_PIG       -----------------EYQLFEELGKGAFSVVRRC-MKIPTGQEYAAKIKLSARDHQKLEREARICRLL
KCC2D_MOUSE     -----------------EYQLFEELGKGAFSVVRRC-MKIPTGQEYAAKIKLSARDHQKLEREARICRLL
KCC2D_HUMAN     -----------------EYQLFEELGKGAFSVVRRC-MKIPTGQEYAAKIKLSARDHQKLEREARICRLL
KCC2D_BOVIN     -----------------EYQLFEELGKGAFSVVRRC-MKIPTGQEYAAKIKLSARDHQKLEREARICRLL
IKKA_DANRE      ---------------CGSWVMKERLGTGGFGHVYLYNQETSEKIAVKLRLELNSKSRGIQIMKKLKHLNV
DKF2_CAEEL      ------------------------LGSGQFGTVYGGIHRRNGQVKLIDKLKFPPNKEDLLRAEVQILEKV
CDPK9_ARATH     ------------------YTLGKELGRGQFGVTYLCTENSTXXXXXXLVTKADKDDM---RREIQIMQHL
CDC2_CAEBR      ------------------FTKLEKIGEGTYGVVYKGRNRRTQAMVAMKKIRLESEDEGVAVREISLLKEL
CDC2H_PLAVI     -----------------KYHGLEKIGEGTYGVVYK-AQNNYGETFALKKIRLEKEDEGIPSTEISILKEL
CDC2H_PLAKH     -----------------KYHGLEKIGEGTYGVVYK-AQNNYGETFALKKIRLEKEDEGIPSTEISILKEL
SRC_RSVSE       -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
SRC_CHICK       -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
SRC_AVIST       -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
SRC_AVISS       -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
SRC_AVIS2       -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
SRC2_XENLA      -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
RLK6_ARATH      ------------------------LGKGGFGMVYHGTVNNTEQVAVKMLSHSSSQGYKEFKAEVELLLRV
PHO85_ASHGO     ---------------------LERLGNGTYATVYYVALKE-------VKLDSEEGTPSTAIREISLMKEL
PCK2_SCHPO      ------------------FTFLSVLGKGNFGKVMLAELKSEKQL-YAIKVILENDEVESTKSEKRVFLVA
MRCKB_HUMAN     --------------------IIKVIGRGAFGEVAVVKMKNTERI-YAMKILNKWEMLACFREERDVLVNG
MKH1_SCHPO      -----------------KWMKGELIGNGTYGKVFLVKQVEIPQTINGRHDQLRKDIVDSINAEISMIADL
KKCC2_RAT       --------------QLNQYTLKDEIGKGSYGVVKL-AYNENDNTYYAMKVLSKKKPIEQVYQEIAILKKL
KKCC2_MOUSE     --------------QLNQYTLKDEIGKGSYGVVKL-AYNENDNTYYAMKVLSKKKPIEQVYQEIAILKKL
KKCC2_HUMAN     --------------QLNQYTLKDEIGKGSYGVVKL-AYNENDNTYYAMKVLSKKKPIEQVYQEIAILKKL
KDC1_DROME      ------------------------LGNGSFGTVMLVREKSG-KNYYAAKMMSKED---LVRLKQVAHVHN
IRE1_YEAST      -------------------------------------------------------------MEIKLLTES
IKKB_BOVIN      ---------------CGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERLEIQIMRRL
FUSED_DROME     -----------------RYAVSSLVGQGSFGCVYKATRKDDSKV-VAIKVISKTKELKNLRRECDIQARL
CDPKY_ARATH     --------QGPIGPVLGRYTLGKELGRGQFGVTHLCTQKATG-LQFACKTIAKKEDIEDVRREVQIMHHL
CDK10_RAT       ---------------------LNRIGEGTYGIVYRARDTQTDEIVALKKVRMDKEPISSLR-EITLLLRL
CDK10_HUMAN     ---------------------LNRIGEGTYGIVYRARDTQTDEIVALKKVRMDKEPISSLR-EITLLLRL
CDC2_RANDY      ---------------------IEKIGEGTYGVVYKGVHKATGQIVAMKKIRLENEEEGVPSREISLLKEL
CDC2_DICDI      ---------------------LEKLGEGTYGKVYKAKEKATGRMVALKKIRLEDDPSTALR-EISLLKEV
CDC2H_PLACH     -----------------KYHGLEKIGEGTYGVVYKAQNSDGESFKIRLEKEDEGIPSTAIR-EISILKEL
CDC2H_PLABA     -----------------KYHGLEKIGEGTYGVVYKAQNSDGESFKIRLEKEDEGIPSTAIR-EISILKEL
BLK_HUMAN       --------------------LVRKLGSGQFGEVWMGYYKNNMKVAIKTLKEGTMSPEAFLG-EANVMKAL
Y8078_DICDI     -----------------KYQFIKQVGDGAYGDVIKAIDVKTGEIVAIKRMKKKSDWKECIQLEIKALKKL
SRC_RSVSA       -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
SRC_AVISR       -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
SRC42_DROME     ---------------------VRKLGSGQFGDVWEGLWNNTTPVAIKTLKSGTMDPKDFLA-EAQIMKKL
SLK_HUMAN       ------------------WEIIGELGDGAFGKVYKAQNKETSVLAAAKVIDTKSEELEDYMVEIDILASC
NEK3_MOUSE      ------------------YTVLRVIGQGSFGRALLVLQESSNQTFAMKEIRLLKSDTQTSRKEAVLLAKM
MYLKG_DICDI     ------------------YVVGKELGRGAFSVVREGTRKDKVALKYIEKKFVKKKHIEQLRREIDIMKKV
MPKC_ASPNC      -----------------RYSDLQPVGLGAFGLVYDMITRQPVAIKKMMKPFSNATLAKRTYREVKLLKHL
KCC2D_XENLA     -----------------EYQLFEELGKGAFSVVRRIGQEYAAKIINTKKLSARDHQK--LEREAKICRLL
KCC2B_RAT       -----------------EYQLYEDIGKGAFSVVRRCV-KLCTGHEYAAKIKLSARDHQKLEREARICRLL
KCC2B_MOUSE     -----------------EYQLYEDIGKGAFSVVRRCV-KLCTGHEYAAKIKLSARDHQKLEREARICRLL
KCC2B_HUMAN     -----------------EYQLYEDIGKGAFSVVRRCV-KLCTGHEYAAKIKLSARDHQKLEREARICRLL
KCC2B_BOVIN     -----------------EYQLYEDIGKGAFSVVRRCV-KLCTGHEYAAKIKLSARDHQKLEREARICRLL
KC2D1_DANRE     -----------------EYQLYEELGKGAFSVVRRC-MKISTGQEYAAKIKLSARDHQKLEREARICRLL
IKKE_MOUSE      ------------------WHTDDLLGQGATASVYKARNKKSGEV-VAVKVFNSASPPEVQVREFEVLRRL
IKKB_HUMAN      ---------------CGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERLEIQIMRRL
GEK_DROME       --------------------ILKIIGRGAFGEVCVVQMISTEKV-YAMKILNKWEMLACFREERDVLVFG
CTK1_ENCCU      ---------------------IRIIGEGTFGQVILA---RKGRARYALKVSKEKEGLSVTTIEVQVLRAM
CHK1_CAEEL      ------------------YRVVQTLGEGAFGEVLLIVNTKNPEVXXXXXXXXXXDFIDNIRKE--YLLQK
CDPKU_ARATH     -----------------KYILGRELGRGEFGITYLCTDREKRKLRTAVDVED-------VRREVTIMSTL
CDKL2_RAT       -----------------KYENLGLVGEGSYGMVMKCRNKDSGRI-VAIKKFLESDDDKMVKKEIKLLKQL
CDKL2_MOUSE     -----------------KYENLGLVGEGSYGMVMKCRNKDSGRI-VAIKKFLESDDDKMVKKEIKLLKQL
CDKA2_ORYSJ     ---------------------VEKIGEGTYGVVYKGKHRHTNETIALKKIRLEQEDEGVPSTEISLLKEM
CDK10_MOUSE     ---------------------LNRIGEGTYGIVYRARDTQTDEIVALKKVRMDKEPISSLR-EITLLLRL
AKT2B_XENLA     ---------------------LKLLGKGTFGKVILVREK-ATGLYYAMKILRKKDEVAHTLTESRVLQNT
Y8901_DICDI     ---------------CGDYLLIDIIGKGGFGVVYKGLHKTKGYFSAXXXXXXXXXXXLQSESQISLMAEI
STK33_HUMAN     ------------------YTFGRILGKGSFGIVIEATDKEKWAIKKVNKEKAGSSAVKLLEREVNILKSV
STK11_MOUSE     ----------------GKYLMGDLLGEGSYGKVKEVLDSERRAVXXXXXXXXXXXPNGEVKKEIQLLRRL
STE20_YARLI     ---------------------LVKIGQGASGGVFTAYEVGSNLSVAIKQMNLEHQPKKELIINEILVMKD
SRC_MOUSE       -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
RAD53_YEAST     ------------------------VGQGAFATVKKAIERTTGKT-FAVKIISKRKVIGNMDRELEVLQKL
PKSC_STRCO      ----------------------------------------------------------------------
PKN3_MYXXA      -----------------KYRVEALIGEGGMGKVFRARQXXXXXXXXXXXXRHT-----LLSDERTVARFQ
PK2_DICDI       --------------------LLNVIGKGSFGKVMQVKKKGEDKI-FAMKVLRKDKQVNHTKSEKTILQCI
PIM1_MOUSE      ------------------------LGSGGFGSVYS-GIRVADNLPVAIK-HVEKDRIGELPNGTRVPMEV
MRCKB_RAT       --------------------IIKVIGRGAFGEVAVVKMKNTERI-YAMKILNKWEMLACFREERDVLVNG
MPKC_ASPOR      -----------------RYANVQPVGLGAFGLVYDQITQQHVAVKKMMNPFANASIAKRTYREVKLLKQL
M3K2_HUMAN      ------------------WRLGKLLGQGAFGRVYLCYDVDTGR-ELAVK-QVQFDPVNALECEIQLLKNL
KS6A2_CAEEL     ------------------------LGKGAFSVVRRC-ERVVDGAQFAVKIVSQ-------KFASQAQREA
KPK1_PHAVU      --------------EMRHFRLLKKLGCGDIGSVYL-AELSGTRTSFAMKVMNKTELANRKK-----LLRA
KOK0_YEAST      ------------------------IGDGAYSTVMLATSIDTKK-RYAAKV-----------LNKEYLIRQ
KNS1_YEAST      ----------------GRFVVKDLLGQGTFGKVLCIDNKYEPNYVAVKVIRAVDRYREAAKTELRILQTI
KCC1_YEAST      -----------------KYVFGKTLGAGTFGVVRQAKNTETGE-DVAVKIKGNKVQLEALYDELDILQRL
KC2D2_DANRE     -----------------EYQLFEELGKGAFSVVRRCVKISSGQ-EYAAKIKLSARDHQKLEREARICRLL
KC1D_RABIT      ----------------------------------------------------------------------
HOG1_COCHE      -----------------RYTDLQPVGMGAFG---LVCSAKDQLTNQAVAVKKIMKPFSTPVLSKRTYREL
FRK_RAT         --------------------LLKRLGSGQFGEVWEGLWNNTTPVAVKTLKPGSMDPNDFLR-EAQIMKSL
FRK_MOUSE       --------------------LLKRLGSGQFGEVWEGLWNNTTPVAVKTLKPGSMDPNDFLR-EAQIMKSL
CKB22_ARATH     ---------------------LEKVGEGTYGKVYRAREKATGMIVALKKTRLHEDEEGV---PPTTLREI
CDPK3_ARATH     ----------------------RELGRGQFGVTYLVTHKETKQQVACKSIPTRKDDIEDVRREVQIMHHL
CDK10_BOVIN     ---------------------LNRIGEGTYGIVYRARDTHTDEIVALKKVRMDKEPISSLR-EITLLLRL
CC2H3_TRYBB     ------------------------LGEGTYGVVYRAVDRATGQIVALKKVRLDRTDEGIPQTEVSILQEI
STE20_CANAL     ---------------------LVKIGQGASGGVFLAHDRDKSNIVAIKQMNLEQQPKKELIINEILVMKG
SRC_RAT         -----------------------KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ-EAQVMKKL
PKN2_CLOAB      ----------------------------------------------------------------------
PAKF_DICDI      -----------------KWTLDEKLGDGAYGSVYKGTHKDLGFTLAIKVIEMKESESVSLQNEINILKNC
OXI1_ARATH      --------------------VLSLLGRGAKGVVFLVRDDDAKLL--ALKVESEDDEYKRVSFEQGVLSRF
NRC2_NEUCR      ---------------------IKLIGKGDVGKVYLVKEKKSGRL-YAMKVLSKKEMIKRNKIKRA-LAEQ
MK11_MOUSE      ---------------------LRPVGSGAYGSVYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHL
MHK_ARATH       -----------------RYKILEELGDGTCGSVYKAVNLETYEVVAVKKMKRKF----YYWEECVNLREV
LATS2_HUMAN     ---------------------IKTLGIGAFGEVCLACKVDTHAL-YAMKTLRKKDVLNRVKAERDILAEA
HOG1_PHANO      -----------------RYTDLQPVGMGAFG---LVCSAKDQLTSQAVAIKKIMKPFSTPVLSKRTYREL
HOG1_HORWE      -----------------RYTDLQPVGMGAFG---LVCSAKDQLTSQAVAVKKIMKPFSTPVLSKRTYREL
HOG1_COCMI      -----------------RYTDLQLVGMGAFG---LVCSAKDQLTNQAVAVKKIMKPFSTPVLSKRTYREL
HOG1_ALTBR      -----------------RYTDLQPVGMGAFG---LVCSAKDQLTSQAVAIKKIMKPFSTPVLSKRTYREL
DKF2_CAEBR      ------------------------LGSGQFGTVYGGIHRRNGQVKLIDKLKFPPNKEDLLRAEVQILEQV
CIPKR_ORYSJ     ----------------GRYEMGRVLGHGNFGRVHAARDVRTGRA-VAMKVVSKDERAGMIKREIAVMKMV
CHK2_HUMAN      -----------------EYIMSKTLGSGACGEVKLAFERKTSKRKFAIGSAREADPALNVETEIEILKKL
CDC22_MEDSA     ---------------------VEKIGEGTYGVVYKARDRATNETIALKKIRLEQEDEGVPSREISLLKEM
BYR1_SCHPO      --------------------VVRHLGEGNGGAVSLVKHRNIFMARKTVYVGSDSKLQKQILRELGVLHHC
BUR1_YEAST      ----------------------EKLGQGTFGEVYLETQRQVAMKKIIVSVEKDLFPI-TAQREITILKRL
BUR1_EMENI      -----------------EFEFLGKLGEGTFGEVYKARAKRDGSIVALKKILMHNERDGF---PITALREI
YAK1_YEAST      -----------------KYLVLDILGQGTFGQV-VKCQNLLTKEILAVKVVKSRTEYLTQSITEAKILEL
STK4_DICDI      ------------------FTIVEKLGEGSYGSVYKAINISTGIVVAIKKVSVDND-LEDMEKEISFMKQC
STK36_PONAB     -----------------KYHVLEMIGEGSFGRVYKGRRKYSAQVKFIPKLGRSEKELRNLQREIEIMRGL
SRK1_SCHPO      --------QFPVYKGLEQYTLLQKMGDGAFSNVYKAIHNEKVAIKVVQRAQPNTDPRDPRKRQGVILKEV
SLK_CAVPO       ------------------WETIGELGDGAFGKVYKAQNKETNVLAAAKVIDTKSEELEDYMVEIDILASC
PKN2_CLOPE      -----------------RYELLQCVGEGGMSFVYKARCRKLNRF-VAVKIKNNEEIVRRFKKEATAIANL
PKN1_THETN      -----------------RYEILEKIGEGGMAKVYKAKCHLLNRI-VAIKIAADENFVKKFKRESQAAASL
NDRC_DICDI      ------------GMKLKEFKILTQIGKGGFGQVFLAQKKDTGDIVTLKRLKKQTVEWANQRNQVS---QE
M3K3_HUMAN      ------------------WRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDEVSALECEIQLLKNL
HOG1_COCIM      -----------------RYTDLQPVGMGAFG---LVCSARDQLTNQAVAVKKIMKPFSTPVLAKRTYREL
FGR_FSVGR       -------------------TLQRRLGTGCFGDVWLGMWNGSTKVAVKTLKPGTMSPKASLE-EAQIMKLL
CDPKF_ARATH     ------------------YTLGKELGRGQFGITYTCKENSTGNT-YACKSILKKQDIDDVKREIQIMQYL
CDPKE_ARATH     ----------PTGHEIKKYKLGRELGRGEFGVTYLCTEIETGEI-FACXXXXXXXXXXXXDIE-----DV
CDKG1_ORYSJ     ---------------------LNTINEGTYGVVFRVRDKRTGEIVALKKVKMEKEPLTSLR-EMNILLSF
CDKG1_ORYSI     ---------------------LNTINEGTYGVVFRVRDKRTGEIVALKKVKMEKEPLTSLR-EMNILLSF
CDKD1_ARATH     ------------------------LGQGTYGVVFKATDTKNGETVAIKKIRLGKEKEGV---NVTALREI
CDKC2_ARATH     ---------------------LEQIGEGTYGQVYMAKEIKTGEIVALKKIEREGFPITAIR-EIKILKKL
STE11_YEAST     -----------------------------------------------------------LQHEMNLLKEL
STE11_YEAS7     -----------------------------------------------------------LQHEMNLLKEL
SHKB_DICDI      -----------------------KLGSGAFGSVYKIVRGKEVAIKKLTQTVFEENTMNEFKKEVSLMAKL
PPK21_SCHPO     ------------------------IGDGSFSKVRRATDKKSWK-EYAIKVLVKENKVKYVNIERDSMMRL
PKNA2_BIFLO     ----------------GRYRIVRNIAEGGMATVYEAIDERLGRT-VAIKVMHTQLAKGPHREQFVERFRR
MRCKB_MOUSE     --------------------IIKVIGRGAFGEVAVVKMRNTERI-YAMKILNKWEMLACFREERDVLVNG
MPH1_SCHPO      ------------------------VGKGGSSMVYRIFSPDNSRL-YALKINADQTTIQGYKNEIALLRKL
MK12_HUMAN      ---------------------LQPVGSGAYGAVCAVDGRTGAKVAIKKLYRPFQSELFAKRAELRLLKHM
LATS2_MOUSE     ---------------------IKTLGIGAFGEVCLACKLDTHAL-YAMKTLRKKDVLNRVKAERDILAEA
KS6A2_HUMAN     ------------------YEIKEDIGVGSYSVCKRCVHKATD-TEYAVKIKSKRDP----SEEIEILLRY
KRAF1_DROME     -----------------------RIGSGSFGTVYR-AHWHGPVAVKTLNVKTPSPALQAFKNEVAMLKKT
KCC2A_DROME     ------------------YDIKEELGKGAFSIVKRCVQKSTG-FEFAAKIKLTARDFQKLEREARICRKL
KAPL_APLCA      ------------------YTLIRTLGSGSFGRVMLSQHGDNPQKCYAIKILNKEKVVKMKQVEHTILLSI
CTR1_ARATH      --------------------IKEKIGAGSFGTVH---RAEWHGSDVAVKILMEQDRVNEFLREVAIMKRL
CDPKH_ARATH     ----------PMEDVKASYSLGKELGRGQFGVTHLCTQKATGH-QFACKTIAKKEDIEDVRREVQIMHHL
CDKL2_PONAB     -----------------KYENLGLVGEGSYGMVMKCRNKDTGRI-VAIKKFLESDDDKMVKKEIKLLKQL
CDKL1_MOUSE     -----------------KYEKIGKIGEGSYGVVFKCRNRDTGQI-VAIKLETEDDPVKIALREIRMLKQL
CDK7_XENLA      -----------VRSRAKQYEKLDFLGEGQFATVYKARDKNTDKIKLGHRAEANDGINRTALREIKLLQEL
ANP1_ARATH      ----------------------------------------------------------------------
AKT2A_XENLA     ---------------------LKLLGKGTFGKVILVREKATGRY-YAMKILRKKDEVAHTLTESRVLQNT
YPK1_YEAST      --------------------LLKVIGKGSFGKVMQVRKKDTQKV-YALKAIRKSYIVSKSEVTHTLAERT
Y8642_DICDI     ----------------------------------------------------------------------
Y1461_ARATH     ---------------------IDKIGQGTYSNVYKAKDMLTGKIVALKKVRLEPESVKFMAREILVLRRL
Y0701_DICDI     --------------------IIKPISRGAFGRVYL-AQKKKTGDLYAIKVLKKLDTIRKNMVNHVIILAM
TEC_HUMAN       -------------------TFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIE-EAKVMMKL
SRC64_DROME     --------------------LLRKLGRGNFGEVFY--GKWRNSIDVAVKTLREGTSTAAFLQEAAIMKKF
ROCK1_RAT       ------------------YEVVKVIGRGAFGEVQLVRHKSTRKV-YAMKLLSKFEMISAFFWEERDIMAF
ROCK1_RABIT     ------------------YEVVKVIGRGAFGEVQLVRHKSTRKV-YAMKLLSKFEMISAFFWEERDIMAF
ROCK1_MOUSE     ------------------YEVVKVIGRGAFGEVQLVRHKSTRKV-YAMKLLSKFEMISAFFWEERDIMAF
ROCK1_HUMAN     ------------------YEVVKVIGRGAFGEVQLVRHKSTRKV-YAMKLLSKFEMISAFFWEERDIMAF
RCK1_YEAST      --------QYPEQLELHNYKLLNKIGEGAFSRVFKINTDDQAPVXXXXXXXXXXXXXXXLKSRKKVLNEV
PIM1_HUMAN      ------------------------LGSGGFGSVYS-GIRVSDNLPVAIK-HVEKDRIGELPNGTRVPMEV
PHO85_YARLI     ---------------------LEKLGEGTYATVYLVALKE-------INLDSEEGTPSTAIREISLMKEL
PDPK1_DROME     ------------------------IGEGSYSIVYLAVDIHSRR-EYAIKV-----------CEKRLILRE
MKNK1_RAT       ------------------------LGEGAYGAVSLQSGKE-----YAVKIIEKQ--AGHSRSRVFREVET
MK14_XENLA      ---------------------LTPVGSGAYGSV---CSSFDTRTALRIAVKKLSRPFQSIYRELRLLKHM
MK13_BOVIN      ---------------------LTHIGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRELLLLKHM
MK12_RAT        ---------------------LQPVGSGAYGAVCAVDSRTGNKVAIKKLYRPFQSELFAKRAELRLLKHM
MK12_MOUSE      ---------------------LQPVGSGAYGAVCAVDSRTGNKVAIKKLYRPFQSELFAKRAELRLLKHM
M3K2_MOUSE      ------------------WRLGKLLGQGAFGRVYLCYDVDTKQVQFNPESPETSKEVNALECEIQLLKNL
KS6A2_MOUSE     ------------------YEIKEDIGVGSYSVCKRCVHKATD-AEYAVKIKSKRDP----SEEIEILLRY
KS6A1_CAEEL     ------------------YEILEKIGNGAHSVVHKCQMKATRR-KYAVKIVKKA--VFDATEEVDILLRH
KIN28_ENCCU     ----------------------RRLGEGTYAVIYLALPQDKPLVSSGTRIE--DVPVAIKKIEISAIREI
IRAK4_MOUSE     -----------------------RMGEGGFGVVYCVNNTIVAVKKLGAMVEISTEELKQFDQEIKVMATC
IPL1_ENCCU      -----------------RFEIGRLLGRGKFGQVWLAREREKGFI-VALKIEIQTETARQIRREIEIHSNL
CST1_CAEEL      --------------------IVGKLGEGSYGSVHKAIHRESGHVLAIKKVPVDTDLQEIIK-------EI
CSK2A_ENCCU     -----------------KYQIYQRMGRGKYSEVFEGRKDREKIVIKALKPVRKAK----ICREVLILRNL
CRK32_ARATH     -----------------KFSRNNKLGKGGFGEVYKGMLPNETEVAVKRLSSNSGQGTQEFKNEVVIVAKL
CIPKN_ORYSJ     ----------------GRYELGRTLGEGTFAKVKFARNADSGE-NVAIKI-LDKDKVLKHKMIAQIKREI
CDPK8_ARATH     ----------------------REVGRGEFGITYLCTDI-KTGEKYACKSISKK------KLRTAVDIEV
CDPK1_ARATH     ------------------YSLGRKLGQGQFGTTFLCVEKTTGK-EFACKSIAKRKLLTDEDVE-DVRREI
CDKL2_MACFA     -----------------KYENLGLVGEGSYGMVVKCRNKDTGRI-VAIKKFLESDDDKMVKKEIKLLKQL
CDKL2_HUMAN     -----------------KYENLGLVGEGSYGMVMKCRNKDTGRI-VAIKKFLESDDDKMVKKEIKLLKQL
CDKL1_RAT       -----------------KYEKIGKIGEGSYGVVFKCRNRDTGQI-VAIKLETEDDPVKIALREIRMLKQL
ATG1_CANGA      ----------------GKYVVEKEIGKGSFATVYRGHVTTDPKSHIAVKAVARSXXXXXXXXXXXXXXXX
YAK1_ENCCU      -----------------KYMIIDMLGTGTFGQVVRCVGSDGEEV--AIKVVKNQPKYYNYEMNEVRILHK
Y4251_DICDI     ----------------GEYTLGEKIGRGAFGQVFKGLNGKTGEFVAIKQIDSDESSLQSVKGEVEILHKL
STE11_YEAS6     -----------------------------------------------------------LQHEMNLLKEL
SMKY_MOUSE      ------------GELYSQYKVVRTLGHGTYAKV-LLAKHWLTGTPVAVKVLLKNKPCFQPAMKEAIMKKI
RAN1_SCHPO      ----------------------------------------------------------------------
PPK25_SCHPO     ------------GRQVGNWIIKKTIGAGSMGKVKLV-------VNILTGEKAALKMIPFTPNNTSQTVRV
PKN2_COREF      ------------------YTLQWIVGHGGMSTVWLADDNVNDR-EVAVKVSDNTEFLSRFRNEARAAENI
PIM1_FELCA      ------------------------LGSGGFGSVYS-GIRVADNLPVAIK-HVEKDRIGELPNGTRVPMEV
NEK5_HUMAN      -----------------KYDVIKAIGQGAFGKAYLAKGKSDSKHCVIKEINFEKMPIEASKKEVILLEKM
NDRD_DICDI      ---------------------LTAIGKGGFGKVYLARKKDSNEI-VTLKVIRKSNQMTSVTKEKEVMMIP
MKCB_DICDI      -----------------------QVGKGGFGTVYFASTKEKRLVAIKKMPHVTKRQQQQNFREAAILAKC
MKCA_DICDI      ------------------YTFREKVGKGGFGTVYLVNNMDKSKSRIAIKKLPH------------VRKKE
MK13_MOUSE      ------------------------VGSGAYGAVCSAIDKRTGEKVAIKKLSRPFQSEIFAKRELLLLKHM
KRB2_VACCW      ----------------------------------------------------------------------
KRB2_VACCC      ----------------------------------------------------------------------
KPSH1_DANRE     -----------------KYDIKALIGRGSFSRVVRVEHRST-RQPYAIKMIETRYREGVCESELCVLRRV
IPL1_CANAL      ----------------------KILGKGKLGRVYCVKHKQSGLI-FALKVMSKSEIMNL-KLEKSLRREI
IKKE_HUMAN      ------------------WHTDDLLGQGATASVYKARNKKSGEL-VAVKVFNTTSPREVQVREFEVLRKL
HOG1_YARLI      -----------------RYVDLNPVGMGAFG---LVCSAKDQLTDQNVAIKKIMKPFGTPVLSKRTYREL
CIPKC_ORYSJ     -----------------KYELGRVLGQ