[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cele0:CAB01696.1

[Show Plain Result]


## Summary of Sequence Search
    1::245
    1::245     e-152 100%  245 aa  DERL1_CAEEL RecName: Full=Derlin-1;AltName: Full=DER1-like protein
    3::219     2e-64  50%  251 aa  DERL1_PONAB RecName: Full=Derlin-1;AltName: Full=Der1-like protein
    3::219     2e-64  50%  251 aa  DERL1_HUMAN RecName: Full=Derlin-1;AltName: Full=Der1-like protein
    3::219     3e-64  50%  251 aa  DERL1_BOVIN RecName: Full=Derlin-1;AltName: Full=Der1-like protein
    3::219     5e-64  50%  251 aa  DERL1_MOUSE RecName: Full=Derlin-1;AltName: Full=Der1-like protein
    1::245     3e-52  41%  245 aa  DERL1_DROME RecName: Full=Derlin-1;AltName: Full=DER1-like protein
    6::218     4e-29  34%  254 aa  DERL2_DICDI RecName: Full=Probable derlin-2 homolog;
    5::221     4e-26  32%  244 aa  DER22_ARATH RecName: Full=Derlin-2.2;AltName: Full=AtDerlin2-2;
    5::221     8e-26  31%  244 aa  DER21_ARATH RecName: Full=Derlin-2.1;AltName: Full=AtDerlin2-1;
   11::239     3e-25  32%  239 aa  DERL2_PONAB RecName: Full=Derlin-2;AltName: Full=Der1-like protein
   11::239     3e-25  32%  239 aa  DERL2_MOUSE RecName: Full=Derlin-2;AltName: Full=Der1-like protein
   11::239     3e-25  32%  239 aa  DERL2_HUMAN RecName: Full=Derlin-2;AltName: Full=Der1-like protein
    5::240     8e-24  31%  249 aa  DERL2_ORYSJ RecName: Full=Derlin-2;AltName: Full=OsDerlin 2-1;
    5::222     1e-23  29%  249 aa  DER22_MAIZE RecName: Full=Derlin-2.2;AltName: Full=ZmDerlin2-2;
    5::222     5e-23  29%  249 aa  DER21_MAIZE RecName: Full=Derlin-2.1;AltName: Full=ZmDerlin2-1;
   11::208     1e-22  30%  242 aa  DERL1_ORYSJ RecName: Full=Derlin-1;AltName: Full=DER1-like protein
   11::208     3e-21  28%  243 aa  DER11_MAIZE RecName: Full=Derlin-1.1;AltName: Full=ZmDerlin1-1;
   11::208     4e-21  28%  243 aa  DER12_MAIZE RecName: Full=Derlin-1.2;AltName: Full=ZmDerlin1-2;
   11::194     2e-19  27%  228 aa  DERL3_MOUSE RecName: Full=Derlin-3;AltName: Full=Der1-like protein
   11::203     4e-19  26%  237 aa  DERL2_CAEEL RecName: Full=Derlin-2;AltName: Full=DER1-like protein
   11::204     4e-19  29%  242 aa  DERL1_DICDI RecName: Full=Probable derlin-1 homolog;
   11::215     2e-18  28%  235 aa  DERL3_HUMAN RecName: Full=Derlin-3;AltName: Full=Der1-like protein
    7::208     7e-17  26%  266 aa  DERL1_ARATH RecName: Full=Derlin-1;AltName: Full=AtDerlin1-1;
   11::194     1e-15  25%  231 aa  DERL3_BOVIN RecName: Full=Derlin-3;AltName: Full=Der1-like protein
    9::170     7e-14  31%  224 aa  YGR8_SCHPO RecName: Full=Uncharacterized derlin-like protein
   21::213     5e-09  27%  341 aa  DFM1_YEAST RecName: Full=DER1-like family member protein 1;
   30::162     7e-07  31%  168 aa  YFFH_SCHPO RecName: Full=Uncharacterized derlin-like protein
   64::195     7e-04  31%  339 aa  SRG7_CAEEL RecName: Full=Serpentine receptor class gamma-7;        
    1::245

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDLENFLLGIPIVTRYWFLASTIIPLLGRFGFINVQWMFLQWDLVVNKFQFWRPLTALIYYPVTPQTGFH
DERL1_CAEEL     MDLENFLLGIPIVTRYWFLASTIIPLLGRFGFINVQWMFLQWDLVVNKFQFWRPLTALIYYPVTPQTGFH
DERL1_PONAB     -DIGDWFRSIPAITRYWFAATVAVPLVGKLGLISPAYLFLWPEAFLYRFQIWRPITATFYFPVGPGTGFL
DERL1_HUMAN     -DIGDWFRSIPAITRYWFAATVAVPLVGKLGLISPAYLFLWPEAFLYRFQIWRPITATFYFPVGPGTGFL
DERL1_BOVIN     -DIGDWFRSIPTITRYWFAATVAVPLVGKLGLISPAYFFLWPEAFLYRFQIWRPITATFYFPVGPGTGFL
DERL1_MOUSE     -DIGDWFRSIPAITRYWFAATVAVPLIGKLGIISPAYFFLWPEAFLYRFQIWRPFTATFYFPVGPGTGFL
DERL1_DROME     MDAGVWYRSLPRFTRYWLTATVVLSMLCRFDVIPLHWLHLDRSAVFSKLQLWRCMTSLFVFPISSNTAFH
DERL2_DICDI     ---EDWYKNLPIVTKIYMTGCVVTSVSVYLGLVGPLRLYLNFPLVFGKYEFWRLFTNFFFYD---EIGMN
DER22_ARATH     --VEEWYKQMPIITRSYLTAAVITTVGCSLDIISPYNLYLNPTLVVKQYQYWRLVTNFLYFR---KXXXX
DER21_ARATH     --VEEWYKQMPIITRSYLTAAVVTTVGCSLEIISPYNLYLNPTLVVKQYQFWRLVTNFLYFR---KXXXX
DERL2_PONAB     -------LQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFPV----GFN
DERL2_MOUSE     -------LQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFPV----GFN
DERL2_HUMAN     -------LQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFPV----GFN
DERL2_ORYSJ     --VEEWYRQMPIITRSYLTAAVVTTVGCTLEIISPYHLYLNPKLVVQHYEIWRLVTNFLYFR---KXXXX
DER22_MAIZE     --VEEWYRQMPIITRSYLTAAVVTTVGCTLEIISPYHLYLNPKLVVQHYEIWRLVTNFLYFR---KXXXX
DER21_MAIZE     --VEEWYRQMPIITRSYLTAAVVTTVGCTLEIISPYHLYLNPKLVVQHYEIWRLVTNFLYFR---KXXXX
DERL1_ORYSJ     ---------LPPISKAYGTLCFFATVLCQLQILNPPFLALYYPFVFKKFQIWRLFTSFFFLKFSINFGIR
DER11_MAIZE     ---------LPPISKAYGTLCFFTTVLVQLQILHPLFLYLDYPLVFKKFEIWRLLTSFFFLPFSMKFGIR
DER12_MAIZE     ---------LPPISKAYGTLCFFTTVLVRLHILNPLFLYLYYPRVFKKFEVWRIFTSFFFLPFSINFGIR
DERL3_MOUSE     -------LQVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLITTXXXXXXXXXXXXX
DERL2_CAEEL     ---------MPPVTRFYTGACVLLTTAVHLEFVTPFHLYFNWELIIRKYQFWRLITXXXXXXXXXXXXXX
DERL1_DICDI     ---------IPPVSRYMFAIFLGIPVLAAMHLISFNYLYLDFTFTFKHFHLWRLITAPC---IISSLGPM
DERL3_HUMAN     -------LQVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLVTNXXXXXXXXXXXXX
DERL1_ARATH     -----FYNSLPPITKAYGTLCFFTTVATQLGLVAPVHIALIPELVLKQFQIWRLITNLFFLGFSINFGIR
DERL3_BOVIN     -------LQVPAVTRTYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLITNXXXXXXXXXXXXX
YGR8_SCHPO      --IQELLSRIPPVTRYXXXXXXXXXXXXXCQLLSPSMLVLHYPLVVRQKQWYRLFTNYLY----AGTGFD
DFM1_YEAST      MGPKEFWLNIPPITRTLFTLAIVMTIVGRLNLINPWYFIYVWNLTFKKVQIWRLLTSCV---MLSSRAMP
YFFH_SCHPO      --------------------------------------------------YWRAITTFLY--VGP-FGLE
SRG7_CAEEL      ---------------YWILTSIILILLDLF----VVRLFLYFPQLCSKFS-----TIFINYPIISDIYFP


                         .         .         *         .         .         .         .:140
query           WLMMCYFLYNYSKALESETYRGRSADYLFMLIFNWFFCSGLCMALDIYFLLEPMVISVLYVWCQVNKDTI
DERL1_CAEEL     WLMMCYFLYNYSKALESETYRGRSADYLFMLIFNWFFCSGLCMALDIYFLLEPMVISVLYVWCQVNKDTI
DERL1_PONAB     YLVNLYFLYHYSTRLETGAFDGRPADYLFMLLFNWICIVITGLAMDMQLLMIPLIMSVLYVWAQLNRDMI
DERL1_HUMAN     YLVNLYFLYQYSTRLETGAFDGRPADYLFMLLFNWICIVITGLAMDMQLLMIPLIMSVLYVWAQLNRDMI
DERL1_BOVIN     YLVNLYFLYQYSTRLETGAFDGRPADYLFMLLFNWICIVITGLAMDMQLLMIPLIMSVLYVWAQLNRDMI
DERL1_MOUSE     YLVNLYFLYQYSTRLEAGAFDGRPADYLFMLLFNWICIVITGLAMDMQLLMIPLIMSVLYVWAQLNRDLI
DERL1_DROME     FLINCFFIVQYSSKLEKDQYSRSPADYLYLLIVSAVLANIGGMIFNVYFLMDTLVLAITYIWCQLNKDVT
DERL2_DICDI     FFFHMYFLVRHSRLLEESSFRGRSADYLFM----WIFGSFLLLIMDAFFLAPSIAFMVIYVWSRRNPNMH
DER22_ARATH     XXXXXXXXARYCKLLEENSFRGKTADFLYMLLFGASVLTGIVLIAKIIFLSNSLTFMMVYVWSKQNPYIH
DER21_ARATH     XXXXXXXXARYCKLLEENSFRGKTTDFLYMLLFGATVLTGIVLISKIIFLSNSLTFMMVYVWSKQNPYIH
DERL2_PONAB     FLFNMIFLYRYCRMLEEGSFRGRTADXXXXXXXXXXXXXXXXXXXXXXXXXQAFTIMLVYVWSRRNPYVR
DERL2_MOUSE     FLFNMIFLYRYCRMLEEGSFRGRTADXXXXXXXXXXXXXXXXXXXXXXXXXQAFTIMLVYVWSRRNPYVR
DERL2_HUMAN     FLFNMIFLYRYCRMLEEGSFRGRTADXXXXXXXXXXXXXXXXXXXXXXXXXQAFTIMLVYVWSRRNPYVR
DERL2_ORYSJ     XXXXXXXXARYCKLLEENSFRGRTADFFYMLLFGATVLTGIVLIARILFLSNSLTFMMVYVWSKHNPFIH
DER22_MAIZE     XXXXXXXXARYCKLLEENSFRGRTADFFYMLLFGATVLTGIVLIARILFLSNSLTFMMVYVWSKHNPFIH
DER21_MAIZE     XXXXXXXXARYCKLLEENSFRGRTADFFYMLLFGATVLTSIVLIARILFLSNSLTFMMVYVWSKHNPFIH
DERL1_ORYSJ     LLMIA----RYGVQLEKGAFEKRTADFLWMMIFGAISLLALSAILDIYFLGVPMVSMLLYVWSREYPNSQ
DER11_MAIZE     LLMIA----RYGVMLEKGAFDKRTADFLWMMIFGAISLLVLSIIFNSFFLGIPMVSMLLYVWSRENPNAQ
DER12_MAIZE     LLMIA----RYGVMLEKGAFDKRTADFLWMMIFGAISLLVLSVILNTYVLGLPMVSMLVYVWSRENPNAQ
DERL3_MOUSE     XXXXXX---RYCRMLEEGSFRGRKADFVFMFLFGGVLMTXXXXXXXXXXXXQALMAMLVYVWSRRSPHVR
DERL2_CAEEL     NMI---FTYRYCMMLEEGSFRGRRADFVYMFLFGAVLMILSGIFVQILFLGQAFTIMLVYIWSRRNPMIQ
DERL1_DICDI     FLFNLIFFYQYTTRLESLNYAGKSDDYXXXXXXXXXXXXXXXXXXEYYFLGTMTIMSLIYIYSRMNPTGT
DERL3_HUMAN     NML---FVFRYCRMLEEGSFRGRTADFVXXXXXXXXXXXXXXXXXXXXXXXQALMAMLVYVWSRRSPRVR
DERL1_ARATH     LLMIA----RYGVQLEKGPFERRTADFLWMMIFGSFTLLVLSVIPFFWFLGVSLVFMLLYLWSREFPNAN
DERL3_BOVIN     NML---FVFRYCRMLEEGSFRGRTADFVXXXXXXXXXXXXXXXXXXXXXXXQALTAMLVYVWSRRSPGVR
YGR8_SCHPO      FIMNIYFFYQYSTYLENFVFARNAKKYIILLIDAFSLISGLGSALN-----QSLAAAIAYNWSLFNSFSK
DFM1_YEAST      ALMELYSIYDRSSQLERGHFRGPTVDYAYYLCF--CXXXXXXXXXXXYGSYYPVVLTITYTWSIDNANVQ
YFFH_SCHPO      LILYLSFLLRFMSMLERSSPPPQTQSFLKTVLIVWF-----SLLVTSYFSYMPFAASMLYIWSWKHPLYR
SRG7_CAEEL      -------IYNYARVFKTGSQCGMILSRLFCVLIPFGHDEKLRRHIPL-FLTIICILPILVVWNTVISEKE


                         +         .         .         .         .         *         .:210
query           VSFWFGMRFPARYLPWVLWGFNAVLRGGGTNELVGILVGHAYFFVALKYPDEYGVDLISTPEFLHRLIPD
DERL1_CAEEL     VSFWFGMRFPARYLPWVLWGFNAVLRGGGTNELVGILVGHAYFFVALKYPDEYGVDLISTPEFLHRLIPD
DERL1_PONAB     VSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVGHLYFFLMFRYPDLGGRNFLSTPQFLYRWLPS
DERL1_HUMAN     VSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVGHLYFFLMFRYPDLGGRNFLSTPQFLYRWLPS
DERL1_BOVIN     VSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVGHLYFFLMFRYPDLGGRNFLSTPQFLYRWLPS
DERL1_MOUSE     VSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVGHLYFFLMFRYPDLGGRNFLSTPQFLYRWLPS
DERL1_DROME     VSFWFGTRFKAMYLPWVLAAFEFIFH-FSLASLVGIFVGHVYYFFKFQYSQDLGTPLLETPQFLKRLVPD
DERL2_DICDI     ISFLGLFTFSAPYLPWVILIMGYLFNHDLTTDLLGAVAGHAYYFLEDAYPLISNRRLLKTPGFLKNLMDG
DER22_ARATH     MSFLGLFTFTAAYLPWVLLGFSILVGASAWVDLLGMIAGHAYYFLAEVYPRMTNRRPLKTPSFLKALFAD
DER21_ARATH     MSFLGLFTFTAAYLPWVLLGFSILVGASAWGDFLGMIAGHAYYFLAFVYPRMTDRRPLKTPSFLKALFAD
DERL2_PONAB     MNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLEDVFPNQGGIRILKTPSILKAIFPD
DERL2_MOUSE     MNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLEDIFPNQGGIRILKTPSILRTIFPD
DERL2_HUMAN     MNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLEDVFPNQGGIRILKTPSILKAIFPD
DERL2_ORYSJ     MSFLGLFTFTAAYLPWVLLGFSILVGSSTWVDLLGMIAGHVYYFLEDVYPRMTGRRPLKTPSFIKALFAD
DER22_MAIZE     MSFLGLFTFTAAYLPWVLLGFSILVGSSTWVDLLGMIAGHVYYFLEDVYPRMTGRRPLKTPSFIKALFAD
DER21_MAIZE     MSFLGLFTFTAAYLPWVLLGFSILVGSSTWVDLLGMIAGHVYYFLEDVYPRMTGRRPLKTPSFIKALFAD
DERL1_ORYSJ     ISMYGLVQLRSFYLPWAMLGLDVIFGSEILPGLLGILVGHTYYFLSVLHPLATGKNYLKTPMWVHKIV--
DER11_MAIZE     INIYGLVQLRSFYLPWAMLLLDVIFGSSLMPGLLGIMVGHLYYFFAVLHPLATGKSYLKTPKWVHKIV--
DER12_MAIZE     INIYGILQLKAFYLPWVMLLLDVIFGSPLMPGLLGIMVGHLYYYFAVLHPLATGKNYLKTPKWVHKIV--
DERL3_MOUSE     VNFFGLLNFQAPFLPWALMGFSLLLGNSVVTDLLGILVGHIYYFLEDVFPNQPG----------------
DERL2_CAEEL     MNFFGVLTFTAPYXXXXXXXXXXXXGNNAVVDFMGIACGHIYFFLEDVFPQEHGKRFLKTPQWL------
DERL1_DICDI     SNFYGFFSFKTIYLPWVFLVAHFLQTGHPPSDFLAIVSGHIFFYLTDIYPRANGVPLIKTPKFI------
DERL3_HUMAN     VNFFGLLTFQAPFLPWALMGFSLLLGNSILVDLLGIAVGHIYYFLEDVFPNQGGKRLLQTPGFLKLLLPA
DERL1_ARATH     ISLYGLVTLKAFYLPWAMLALDVIFGSPIMPDLLGIIAGHLYYFLTVLHPLATGKNYLKTPKWVNKIV--
DERL3_BOVIN     VNFFGLLTFQAPFLPWALMGLPMLLGNSILVDLLGIAVGHVYYFLEDVFPNQPG----------------
YGR8_SCHPO      IQFLFGFHVQGKYLPYVLLGFSFLTGG-------------------------------------------
DFM1_YEAST      IMFYGLIPVWGKYFPLIQLFISFVFNEGDVISLIGFTTGYLY----------------------------
YFFH_SCHPO      ISILGLFDVKAPYVPWVM----VLLRWLRTGDLISALIGHVYFFV-------------------------
SRG7_CAEEL      VVFWYGGFFVIRRVGWV-----------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EDGGIHGQDGNIRGARQQPRGHQWPGGVGARLGGN
DERL1_CAEEL     EDGGIHGQDGNIRGARQQPRGHQWPGGVGARLGGN
DERL1_PONAB     RRGGVSG----------------------------
DERL1_HUMAN     RRGGVSG----------------------------
DERL1_BOVIN     RRGGVSG----------------------------
DERL1_MOUSE     RRGGVSG----------------------------
DERL1_DROME     VSGGF-GGFGLPPESRAPPRATESPWGRGMTLGRN
DERL2_DICDI     QE---------------------------------
DER22_ARATH     E----------------------------------
DER21_ARATH     E----------------------------------
DERL2_PONAB     EDPNYNPL------PEERPGGFAW--GEGQRLGG-
DERL2_MOUSE     EDPNYNPL------PEERPGGFAW--GEGQRLGG-
DERL2_HUMAN     EDPNYNPL------PEERPGGFAW--GEGQRLGG-
DERL2_ORYSJ     D---------NVVVARPPNAGL----GAGARFG--
DER22_MAIZE     DN---------------------------------
DER21_MAIZE     DN---------------------------------
DERL1_ORYSJ     -----------------------------------
DER11_MAIZE     -----------------------------------
DER12_MAIZE     -----------------------------------
DERL3_MOUSE     -----------------------------------
DERL2_CAEEL     -----------------------------------
DERL1_DICDI     -----------------------------------
DERL3_HUMAN     ED---------------------------------
DERL1_ARATH     -----------------------------------
DERL3_BOVIN     -----------------------------------
YGR8_SCHPO      -----------------------------------
DFM1_YEAST      -----------------------------------
YFFH_SCHPO      -----------------------------------
SRG7_CAEEL      -----------------------------------