[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cele0:CAB01743.1

[Show Plain Result]


## Summary of Sequence Search
    1::166
   24::144     2e-19  33%  171 aa  CI007_MOUSE RecName: Full=Transmembrane protein C9orf7 homolog;
   25::145     5e-19  33%  172 aa  CI007_HUMAN RecName: Full=Transmembrane protein C9orf7;
    1::166

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxWWVRFLAKGVAIXXXXXXXXXXXXXXITLSATCMVAILLQMTAGALV
CI007_MOUSE     -----------------------WWYRWLCRLAGVLGAVSCAISGLFNCVTIHPLNIAAGVWMIMNAFIL
CI007_HUMAN     -----------------------WWYRWLCRLSGVLGAVSCAISGLFNCITIHPLNIAAGVWMIMNAFIL


                         .         .         *         .         .         .         .:140
query           IALEAPFCCQFVDFIEKIARFSESRALWHKAAIYGAMGLIPIFLCIELNTILGSGTIFASGVIYGFMALG
CI007_MOUSE     LLCEAPFCCQFVEFANTVAEKVDRLRSWQKAVFYCGMAIVPIVMSLTLTTLLGNAIAFATGVLYGLSALG
CI007_HUMAN     LLCEAPFCCQFIEFANTVAEKVDRLRSWQKAVFYCGMAVVPIVISLTLTTLLGNAIAFATGVLYGLSALG


                         +         .         .         .         .         *         .:210
query           KKADxxxxxxxxxxxxxxxxxxxxxx
CI007_MOUSE     KKGD----------------------
CI007_HUMAN     KKGD----------------------