[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cele0:CAB60993.2

[Show Plain Result]


## Summary of Sequence Search
    1::388
    1::260     e-151 100%  388 aa  SF3B4_CAEEL RecName: Full=Splicing factor 3B subunit 4;AltName:
    1::213     e-104  82%  424 aa  SF3B4_RAT RecName: Full=Splicing factor 3B subunit 4;
    1::213     e-104  82%  424 aa  SF3B4_MOUSE RecName: Full=Splicing factor 3B subunit 4;
    1::213     e-104  82%  424 aa  SF3B4_HUMAN RecName: Full=Splicing factor 3B subunit 4;AltName:
    6::186     6e-64  62%  335 aa  SAP49_SCHPO RecName: Full=Spliceosome-associated protein 49;
    8::193     2e-54  54%  359 aa  SF3B4_DICDI RecName: Full=Splicing factor 3B subunit 4;
   10::202     1e-30  38%  213 aa  HSH49_YEAST RecName: Full=Protein HSH49;
   11::188     3e-29  39%  644 aa  PABP4_HUMAN RecName: Full=Polyadenylate-binding protein 4;       
   35::209     3e-29  42%  629 aa  PABP2_ARATH RecName: Full=Polyadenylate-binding protein 2;       
   11::210     2e-28  34%  636 aa  PABP1_HUMAN RecName: Full=Polyadenylate-binding protein 1;       
   11::210     2e-28  34%  636 aa  PABP1_BOVIN RecName: Full=Polyadenylate-binding protein 1;       
   80::246     3e-28  38%  653 aa  PABP_SCHPO RecName: Full=Polyadenylate-binding protein, cytoplasmic
   11::188     4e-28  37%  636 aa  PABP1_RAT RecName: Full=Polyadenylate-binding protein 1;       
   11::210     5e-28  34%  636 aa  PABP1_PONAB RecName: Full=Polyadenylate-binding protein 1;       
   11::180     6e-28  39%  636 aa  PABP1_MOUSE RecName: Full=Polyadenylate-binding protein 1;       
   11::188     8e-28  36%  633 aa  PABPB_XENLA RecName: Full=Polyadenylate-binding protein 1-B;       
   11::188     8e-28  36%  633 aa  PABPA_XENLA RecName: Full=Polyadenylate-binding protein 1-A;       
   11::210     5e-27  33%  631 aa  PABP3_HUMAN RecName: Full=Polyadenylate-binding protein 3;       
   41::206     1e-26  36%  629 aa  PABP_YARLI RecName: Full=Polyadenylate-binding protein, cytoplasmic
   41::221     1e-26  33%  751 aa  PABP_NEOFI RecName: Full=Polyadenylate-binding protein, cytoplasmic
    2::180     1e-26  36%  634 aa  PABP_DROME RecName: Full=Polyadenylate-binding protein;       
   10::188     3e-26  38%  370 aa  PAB4L_HUMAN RecName: Full=Polyadenylate-binding protein 4-like;    
   11::184     3e-26  35%  629 aa  EPAB_XENTR RecName: Full=Embryonic polyadenylate-binding protein;  
   46::223     5e-26  33%  731 aa  PABP_ASPNC RecName: Full=Polyadenylate-binding protein, cytoplasmic
   11::184     5e-26  34%  629 aa  EPABB_XENLA RecName: Full=Embryonic polyadenylate-binding protein
   46::199     6e-26  38%  673 aa  PABP_CRYNE RecName: Full=Polyadenylate-binding protein, cytoplasmic
   38::218     6e-26  32%  765 aa  PABP_ASPOR RecName: Full=Polyadenylate-binding protein, cytoplasmic
   48::210     8e-26  36%  744 aa  PABP_PHANO RecName: Full=Polyadenylate-binding protein, cytoplasmic
   67::254     8e-26  37%  661 aa  PABP_LODEL RecName: Full=Polyadenylate-binding protein, cytoplasmic
   11::184     1e-25  34%  629 aa  EPABA_XENLA RecName: Full=Embryonic polyadenylate-binding protein
   48::217     2e-25  34%  753 aa  PABP_ASPTN RecName: Full=Polyadenylate-binding protein, cytoplasmic
   51::220     2e-25  34%  754 aa  PABP_ASPCL RecName: Full=Polyadenylate-binding protein, cytoplasmic
   11::172     4e-25  37%  614 aa  PAP1L_HUMAN RecName: Full=Polyadenylate-binding protein 1-like;
   44::239     4e-25  31%  660 aa  PABP3_ARATH RecName: Full=Polyadenylate-binding protein 3;       
   39::239     5e-25  32%  668 aa  PABP5_ARATH RecName: Full=Polyadenylate-binding protein 5;       
   62::222     7e-25  36%  764 aa  PABP_NEUCR RecName: Full=Polyadenylate-binding protein, cytoplasmic
   54::221     7e-25  34%  753 aa  PABP_ASPFU RecName: Full=Polyadenylate-binding protein, cytoplasmic
    2::192     1e-24  32%  200 aa  PAP1M_HUMAN RecName: Full=Polyadenylate-binding protein 1-like
   63::223     2e-24  35%  762 aa  PABP_MAGGR RecName: Full=Polyadenylate-binding protein, cytoplasmic
   42::211     3e-24  33%  732 aa  PABP_EMENI RecName: Full=Polyadenylate-binding protein, cytoplasmic
   67::227     3e-24  34%  783 aa  PABP_CHAGB RecName: Full=Polyadenylate-binding protein, cytoplasmic
   40::207     5e-23  36%  577 aa  PABP_YEAST RecName: Full=Polyadenylate-binding protein, cytoplasmic
  181::345     2e-22  35%  814 aa  PAP1B_DICDI RecName: Full=Polyadenylate-binding protein 1-B;       
   28::210     2e-22  33%  585 aa  PABP_ASHGO RecName: Full=Polyadenylate-binding protein, cytoplasmic
   51::226     3e-22  36%  627 aa  PABP_DEBHA RecName: Full=Polyadenylate-binding protein, cytoplasmic
   26::210     3e-22  37%  579 aa  PABP_CANGA RecName: Full=Polyadenylate-binding protein, cytoplasmic
   46::215     4e-22  31%  651 aa  PABP_USTMA RecName: Full=Polyadenylate-binding protein, cytoplasmic
   52::203     4e-22  34%  592 aa  PABP_KLULA RecName: Full=Polyadenylate-binding protein, cytoplasmic
   10::170     9e-22  35%  565 aa  PAP1A_DICDI RecName: Full=Polyadenylate-binding protein 1-A;       
   22::177     9e-22  36%  382 aa  PABP5_PONPY RecName: Full=Polyadenylate-binding protein 5;       
   22::177     9e-22  36%  382 aa  PABP5_PANTR RecName: Full=Polyadenylate-binding protein 5;       
   22::177     9e-22  36%  382 aa  PABP5_MACMU RecName: Full=Polyadenylate-binding protein 5;       
   22::177     9e-22  36%  382 aa  PABP5_HYLLA RecName: Full=Polyadenylate-binding protein 5;       
   22::177     9e-22  36%  382 aa  PABP5_HUMAN RecName: Full=Polyadenylate-binding protein 5;       
   22::177     9e-22  36%  382 aa  PABP5_GORGO RecName: Full=Polyadenylate-binding protein 5;       
    7::176     3e-21  34%  375 aa  TIAR_HUMAN RecName: Full=Nucleolysin TIAR;AltName:
   52::227     1e-20  34%  632 aa  PABP_PICST RecName: Full=Polyadenylate-binding protein, cytoplasmic
    7::193     2e-20  36%  392 aa  TIAR_MOUSE RecName: Full=Nucleolysin TIAR;AltName:
   52::227     2e-20  34%  629 aa  PABP_CANAL RecName: Full=Polyadenylate-binding protein, cytoplasmic
   60::230     3e-20  35%  631 aa  PABP_PICGU RecName: Full=Polyadenylate-binding protein, cytoplasmic
   86::267     5e-20  36%  273 aa  ROC1_NICSY RecName: Full=29 kDa ribonucleoprotein A,
  145::323     4e-19  32%  329 aa  ROC3_ARATH RecName: Full=31 kDa ribonucleoprotein,
   92::270     5e-19  32%  276 aa  ROC3_NICSY RecName: Full=28 kDa ribonucleoprotein, chloroplastic;  
   50::228     5e-19  32%  233 aa  ROC1_SPIOL RecName: Full=28 kDa ribonucleoprotein, chloroplastic;  
   74::242     5e-19  31%  453 aa  PUB1_YEAST RecName: Full=Nuclear and cytoplasmic polyadenylated
   86::273     1e-18  36%  279 aa  ROC1_NICPL RecName: Full=30 kDa ribonucleoprotein,
   84::286     8e-18  34%  291 aa  ROC2_NICSY RecName: Full=29 kDa ribonucleoprotein B,
  135::320     8e-18  29%  768 aa  PABP_COCIM RecName: Full=Polyadenylate-binding protein, cytoplasmic
   41::273     1e-17  25%  359 aa  ELAV2_PONAB RecName: Full=ELAV-like protein 2;
   41::273     1e-17  25%  359 aa  ELAV2_HUMAN RecName: Full=ELAV-like protein 2;AltName:
  132::305     1e-17  35%  637 aa  PUF68_DROME RecName: Full=Poly(U)-binding-splicing factor half
    1::185     2e-17  31%  386 aa  TIA1_MOUSE RecName: Full=Nucleolysin TIA-1;AltName:
    1::185     2e-17  31%  386 aa  TIA1_HUMAN RecName: Full=Nucleolysin TIA-1 isoform p40;AltName:
   46::273     2e-17  25%  359 aa  ELAV2_RAT RecName: Full=ELAV-like protein 2;AltName:
   85::287     4e-17  34%  292 aa  ROC2_NICPL RecName: Full=31 kDa ribonucleoprotein,
   90::283     4e-17  33%  289 aa  ROC1_ARATH RecName: Full=Ribonucleoprotein At2g37220,
   27::193     7e-17  29%  609 aa  PABPX_ARATH RecName: Full=Probable polyadenylate-binding protein
   41::274     7e-17  25%  360 aa  ELAV2_MOUSE RecName: Full=ELAV-like protein 2;AltName:
  116::293     1e-16  34%  324 aa  ROC5_NICSY RecName: Full=33 kDa ribonucleoprotein,
    9::109     2e-16  43%  265 aa  RBM7_MOUSE RecName: Full=RNA-binding protein 7;AltName:
   41::203     2e-16  32%  367 aa  ELAV3_MOUSE RecName: Full=ELAV-like protein 3;AltName:
    9::109     3e-16  44%  266 aa  RBM7_HUMAN RecName: Full=RNA-binding protein 7;AltName:
   41::203     3e-16  32%  367 aa  ELAV3_HUMAN RecName: Full=ELAV-like protein 3;AltName:
  138::312     4e-16  31%  315 aa  ROC4_NICSY RecName: Full=31 kDa ribonucleoprotein,
  113::298     4e-16  32%  747 aa  FCA_ARATH RecName: Full=Flowering time control protein FCA;
   22::169     4e-16  31%  326 aa  ELAV1_HUMAN RecName: Full=ELAV-like protein 1;AltName:
   88::254     7e-16  32%  516 aa  PU60B_DANRE RecName: Full=Poly(U)-binding-splicing factor PUF60-B;
   91::263     1e-15  34%  473 aa  YG41_SCHPO RecName: Full=Uncharacterized RNA-binding protein
  136::302     1e-15  32%  564 aa  PUF60_RAT RecName: Full=Poly(U)-binding-splicing factor
  130::296     1e-15  32%  558 aa  PUF60_PONAB RecName: Full=Poly(U)-binding-splicing factor
  136::302     1e-15  32%  564 aa  PUF60_MOUSE RecName: Full=Poly(U)-binding-splicing factor
  131::297     1e-15  32%  559 aa  PUF60_HUMAN RecName: Full=Poly(U)-binding-splicing factor
  102::268     1e-15  32%  530 aa  PUF60_BOVIN RecName: Full=Poly(U)-binding-splicing factor
  157::298     1e-15  32%  534 aa  HRP1_YEAST RecName: Full=Nuclear polyadenylated RNA-binding protein
    9::82      2e-15  49%  262 aa  RBM7_BOVIN RecName: Full=RNA-binding protein 7;AltName:
   41::189     2e-15  30%  373 aa  ELAV4_RAT RecName: Full=ELAV-like protein 4;AltName:
   53::201     2e-15  30%  385 aa  ELAV4_MOUSE RecName: Full=ELAV-like protein 4;AltName:
   48::196     2e-15  30%  380 aa  ELAV4_HUMAN RecName: Full=ELAV-like protein 4;AltName:
   82::226     2e-15  34%  321 aa  SXL_MEGSC RecName: Full=Sex-lethal homolog;
  148::329     2e-15  32%  524 aa  RBM39_PONAB RecName: Full=RNA-binding protein 39;AltName:
  148::329     2e-15  32%  530 aa  RBM39_HUMAN RecName: Full=RNA-binding protein 39;AltName:
  148::329     3e-15  32%  530 aa  RBM39_MOUSE RecName: Full=RNA-binding protein 39;AltName:
  122::275     5e-15  29%  354 aa  SXL_DROSU RecName: Full=Protein sex-lethal;
    5::82      5e-15  47%  281 aa  RBM11_HUMAN RecName: Full=Putative RNA-binding protein
   22::169     5e-15  30%  326 aa  ELAV1_MOUSE RecName: Full=ELAV-like protein 1;AltName:
  168::346     8e-15  25%  414 aa  NSR1_YEAST RecName: Full=Nuclear localization sequence-binding
  161::342     1e-14  30%  439 aa  RBM23_HUMAN RecName: Full=Probable RNA-binding protein 23;AltName:
   25::174     1e-14  32%  301 aa  HNRDL_MOUSE RecName: Full=Heterogeneous nuclear ribonucleoprotein
  144::293     1e-14  32%  420 aa  HNRDL_HUMAN RecName: Full=Heterogeneous nuclear ribonucleoprotein
  121::273     2e-14  29%  354 aa  SXL_DROME RecName: Full=Protein sex-lethal;
  112::288     2e-14  30%  348 aa  SXL_CERCA RecName: Full=Sex-lethal homolog;AltName: Full=CCSXL;
   15::188     2e-14  35%  502 aa  PABP_ENCCU RecName: Full=Polyadenylate-binding protein, cytoplasmic
   26::175     2e-14  34%  301 aa  HNRDL_CHICK RecName: Full=Heterogeneous nuclear ribonucleoprotein
   87::233     3e-14  31%  307 aa  SXL_CHRRU RecName: Full=Sex-lethal homolog;
  104::250     4e-14  31%  324 aa  SXL_MUSDO RecName: Full=Sex-lethal homolog;
   53::196     7e-14  33%  322 aa  HNRDL_RAT RecName: Full=Heterogeneous nuclear ribonucleoprotein
   17::170     2e-13  32%  385 aa  RB87F_DROME RecName: Full=Heterogeneous nuclear ribonucleoprotein
   49::197     2e-13  32%  486 aa  CELF5_XENTR RecName: Full=CUG-BP- and ETR-3-like factor 5;       
    4::160     3e-13  32%  320 aa  RA1L2_HUMAN RecName: Full=Heterogeneous nuclear ribonucleoprotein
    9::160     3e-13  31%  320 aa  ROA1_RAT RecName: Full=Heterogeneous nuclear ribonucleoprotein
    9::160     3e-13  31%  320 aa  ROA1_PANTR RecName: Full=Heterogeneous nuclear ribonucleoprotein
    9::160     3e-13  31%  320 aa  ROA1_MOUSE RecName: Full=Heterogeneous nuclear ribonucleoprotein
    9::160     3e-13  31%  372 aa  ROA1_HUMAN RecName: Full=Heterogeneous nuclear ribonucleoprotein
    9::160     3e-13  31%  320 aa  ROA1_BOVIN RecName: Full=Heterogeneous nuclear ribonucleoprotein
    9::160     3e-13  31%  320 aa  RA1L3_HUMAN RecName: Full=Putative heterogeneous nuclear
    9::160     4e-13  30%  365 aa  ROA1_XENLA RecName: Full=Heterogeneous nuclear ribonucleoproteins
   34::181     6e-13  33%  471 aa  RB97D_DROME RecName: Full=Ribonucleoprotein RB97D;
   22::171     6e-13  30%  297 aa  HNRDL_XENTR RecName: Full=Heterogeneous nuclear ribonucleoprotein
   22::171     6e-13  30%  293 aa  HNDLA_XENLA RecName: Full=Heterogeneous nuclear ribonucleoprotein
   30::181     8e-13  30%  379 aa  ROA3_RAT RecName: Full=Heterogeneous nuclear ribonucleoprotein A3; 
   30::181     8e-13  30%  379 aa  ROA3_MOUSE RecName: Full=Heterogeneous nuclear ribonucleoprotein
   30::181     8e-13  30%  378 aa  ROA3_HUMAN RecName: Full=Heterogeneous nuclear ribonucleoprotein
   22::173     8e-13  30%  385 aa  RO32_XENLA RecName: Full=Heterogeneous nuclear ribonucleoprotein A3
    9::160     1e-12  31%  320 aa  ROA1_MACMU RecName: Full=Heterogeneous nuclear ribonucleoprotein
   93::256     1e-12  34%  690 aa  HNRPM_RAT RecName: Full=Heterogeneous nuclear ribonucleoprotein M; 
    6::91      2e-12  39%  315 aa  PPIE_RHIOR RecName: Full=Peptidyl-prolyl cis-trans isomerase E;  
    3::82      2e-12  40%  300 aa  PPIE_DROME RecName: Full=Peptidyl-prolyl cis-trans isomerase E;  
  187::408     2e-12  28%  519 aa  ELAV_DROVI RecName: Full=Protein elav;AltName: Full=Embryonic
  151::372     2e-12  28%  483 aa  ELAV_DROME RecName: Full=Protein elav;AltName: Full=Embryonic
    4::155     2e-12  31%  346 aa  RO21_XENLA RecName: Full=Heterogeneous nuclear ribonucleoprotein A2
  233::481     4e-12  28%  582 aa  SHEP_DROYA RecName: Full=Protein alan shepard;
  233::481     4e-12  28%  582 aa  SHEP_DROER RecName: Full=Protein alan shepard;
    4::155     4e-12  29%  341 aa  ROA2_SAGOE RecName: Full=Heterogeneous nuclear ribonucleoproteins
   24::177     4e-12  30%  365 aa  ROA1_DROME RecName: Full=Heterogeneous nuclear ribonucleoprotein
    8::82      4e-12  41%  301 aa  PPIE_PONAB RecName: Full=Peptidyl-prolyl cis-trans isomerase E;  
    8::82      4e-12  41%  301 aa  PPIE_MOUSE RecName: Full=Peptidyl-prolyl cis-trans isomerase E;  
    8::82      4e-12  41%  301 aa  PPIE_HUMAN RecName: Full=Peptidyl-prolyl cis-trans isomerase E;  
    8::82      4e-12  41%  301 aa  PPIE_BOVIN RecName: Full=Peptidyl-prolyl cis-trans isomerase E;  
   91::239     4e-12  33%  353 aa  HNRPD_RAT RecName: Full=Heterogeneous nuclear ribonucleoprotein D0;
   93::241     4e-12  33%  355 aa  HNRPD_MOUSE RecName: Full=Heterogeneous nuclear ribonucleoprotein
   93::241     4e-12  33%  355 aa  HNRPD_HUMAN RecName: Full=Heterogeneous nuclear ribonucleoprotein
   36::179     4e-12  30%  291 aa  HNDLB_XENLA RecName: Full=Heterogeneous nuclear ribonucleoprotein
  233::478     5e-12  28%  579 aa  SHEP_DROSE RecName: Full=Protein alan shepard;
  233::477     5e-12  28%  578 aa  SHEP_DROME RecName: Full=Protein alan shepard;
    4::155     5e-12  29%  341 aa  ROA2_BOVIN RecName: Full=Heterogeneous nuclear ribonucleoproteins
   22::173     5e-12  29%  373 aa  RO31_XENLA RecName: Full=Heterogeneous nuclear ribonucleoprotein A3
    4::155     6e-12  28%  358 aa  RO22_XENLA RecName: Full=Heterogeneous nuclear ribonucleoprotein A2
   58::200     6e-12  30%  407 aa  RBMS2_BOVIN RecName: Full=RNA-binding motif,
   32::239     6e-12  28%  460 aa  CELF6_MOUSE RecName: Full=CUG-BP- and ETR-3-like factor 6;       
    3::177     1e-11  27%  314 aa  TSAP1_DANRE RecName: Full=tRNA selenocysteine 1-associated protein
    9::197     1e-11  26%  462 aa  CEL3B_XENLA RecName: Full=CUG-BP- and ETR-3-like factor 3-B;       
   19::172     1e-11  28%  342 aa  ROA1_SCHAM RecName: Full=Heterogeneous nuclear ribonucleoprotein
   58::200     1e-11  30%  407 aa  RBMS2_HUMAN RecName: Full=RNA-binding motif,
    5::203     1e-11  29%  759 aa  RBM28_HUMAN RecName: Full=RNA-binding protein 28;AltName:
    9::197     1e-11  26%  462 aa  CEL3A_XENLA RecName: Full=CUG-BP- and ETR-3-like factor 3-A;       
    1::84      2e-11  39%  380 aa  RBY1A_MOUSE RecName: Full=RNA-binding motif protein, Y
  110::306     2e-11  29%  444 aa  PRP24_YEAST RecName: Full=U4/U6 snRNA-associated-splicing factor
   32::196     2e-11  31%  481 aa  CELF6_HUMAN RecName: Full=CUG-BP- and ETR-3-like factor 6;       
   35::197     2e-11  30%  520 aa  CELF4_DANRE RecName: Full=CUG-BP- and ETR-3-like factor 4;       
   51::186     2e-11  31%  344 aa  SQD_DROME RecName: Full=RNA-binding protein squid;AltName:
    2::214     3e-11  26%  674 aa  YOCE_SCHPO RecName: Full=Uncharacterized RNA-binding protein
  161::307     3e-11  28%  474 aa  YHKF_SCHPO RecName: Full=Uncharacterized RNA-binding protein
   77::218     3e-11  34%  285 aa  ROAA_MOUSE RecName: Full=Heterogeneous nuclear ribonucleoprotein
   23::167     3e-11  29%  353 aa  ROA2_RAT RecName: Full=Heterogeneous nuclear ribonucleoproteins
   23::167     3e-11  29%  353 aa  ROA2_PONAB RecName: Full=Heterogeneous nuclear ribonucleoproteins
   23::167     3e-11  29%  353 aa  ROA2_MOUSE RecName: Full=Heterogeneous nuclear ribonucleoproteins
   23::167     3e-11  29%  353 aa  ROA2_HUMAN RecName: Full=Heterogeneous nuclear ribonucleoproteins
   60::202     3e-11  29%  383 aa  RBMS2_MOUSE RecName: Full=RNA-binding motif,
  591::810     3e-11  31%  828 aa  MRD1_YARLI RecName: Full=Multiple RNA-binding domain-containing
   56::203     3e-11  30%  474 aa  CELF4_MACFA RecName: Full=CUG-BP- and ETR-3-like factor 4;       
    1::84      4e-11  38%  380 aa  RBY1B_MOUSE RecName: Full=RNA-binding motif protein, Y
   47::196     4e-11  31%  485 aa  CELF5_HUMAN RecName: Full=CUG-BP- and ETR-3-like factor 5;       
  239::468     5e-11  28%  581 aa  SHEP_DROWI RecName: Full=Protein alan shepard;
   18::198     5e-11  31%  489 aa  CEL1B_XENLA RecName: Full=CUG-BP- and ETR-3-like factor 1-B;       
    5::84      7e-11  42%  169 aa  GRP2_SINAL RecName: Full=Glycine-rich RNA-binding protein GRP2A;
  255::444     7e-11  24%  500 aa  GAR2_SCHPO RecName: Full=Protein gar2;
   18::198     7e-11  31%  490 aa  CELF1_XENTR RecName: Full=CUG-BP- and ETR-3-like factor 1;       
    3::179     9e-11  28%  287 aa  TSAP1_BOVIN RecName: Full=tRNA selenocysteine 1-associated protein
   25::169     9e-11  26%  346 aa  ROA1_CAEEL RecName: Full=Heterogeneous nuclear ribonucleoprotein
  459::600     9e-11  34%  694 aa  NUCL_CHICK RecName: Full=Nucleolin;AltName: Full=Protein C23;
    5::84      9e-11  41%  166 aa  GRP1_SINAL RecName: Full=Glycine-rich RNA-binding protein GRP1A;
   12::199     9e-11  30%  406 aa  DAZP1_MOUSE RecName: Full=DAZ-associated protein 1;AltName:
    3::179     1e-10  28%  287 aa  TSAP1_HUMAN RecName: Full=tRNA selenocysteine 1-associated protein
   86::260     1e-10  27%  260 aa  RRP2_SPIOL RecName: Full=30S ribosomal protein 2,
   12::199     1e-10  30%  407 aa  DAZP1_HUMAN RecName: Full=DAZ-associated protein 1;AltName:
   18::195     1e-10  31%  487 aa  CELF1_RAT RecName: Full=CUG-BP- and ETR-3-like factor 1;       
   18::195     1e-10  31%  486 aa  CELF1_MOUSE RecName: Full=CUG-BP- and ETR-3-like factor 1;       
   18::195     1e-10  31%  486 aa  CELF1_HUMAN RecName: Full=CUG-BP- and ETR-3-like factor 1;       
   18::195     1e-10  31%  489 aa  CELF1_CHICK RecName: Full=CUG-BP- and ETR-3-like factor 1;       
   12::200     2e-10  30%  360 aa  DAZP1_XENLA RecName: Full=DAZ-associated protein 1;AltName:
  245::474     2e-10  27%  595 aa  SHEP_DROVI RecName: Full=Protein alan shepard;
   29::107     2e-10  35%  212 aa  RT19_ARATH RecName: Full=40S ribosomal protein S19,
    5::86      2e-10  41%  396 aa  HNRPG_BOVIN RecName: Full=Heterogeneous nuclear ribonucleoprotein
    5::84      2e-10  40%  176 aa  GRP7_ARATH RecName: Full=Glycine-rich RNA-binding protein 7;
    9::196     2e-10  25%  452 aa  CELF3_DANRE RecName: Full=CUG-BP- and ETR-3-like factor 3;       
  259::488     3e-10  27%  609 aa  SHEP_DROGR RecName: Full=Protein alan shepard;
    2::82      3e-10  38%   99 aa  RBPE_ANASP RecName: Full=Putative RNA-binding protein rbpE;
    8::81      3e-10  42%  157 aa  RBM3_HUMAN RecName: Full=Putative RNA-binding protein 3;AltName:
    5::203     3e-10  29%  750 aa  RBM28_MOUSE RecName: Full=RNA-binding protein 28;AltName:
    1::235     3e-10  25%  421 aa  RB27C_DROME RecName: Full=Heterogeneous nuclear ribonucleoprotein
    3::159     4e-10  29%  287 aa  TSAP1_RAT RecName: Full=tRNA selenocysteine 1-associated protein
    3::179     4e-10  27%  287 aa  TSAP1_PONAB RecName: Full=tRNA selenocysteine 1-associated protein
  233::476     4e-10  28%  576 aa  SHEP_DROSI RecName: Full=Protein alan shepard;
  231::471     4e-10  27%  592 aa  SHEP_DROMO RecName: Full=Protein alan shepard;
    8::81      4e-10  42%  153 aa  RBM3_MOUSE RecName: Full=Putative RNA-binding protein 3;AltName:
   56::214     4e-10  30%  486 aa  CELF4_PONAB RecName: Full=CUG-BP- and ETR-3-like factor 4;       
   56::214     4e-10  30%  486 aa  CELF4_MOUSE RecName: Full=CUG-BP- and ETR-3-like factor 4;       
   56::214     4e-10  30%  486 aa  CELF4_HUMAN RecName: Full=CUG-BP- and ETR-3-like factor 4;       
    9::197     4e-10  25%  465 aa  CELF3_HUMAN RecName: Full=CUG-BP- and ETR-3-like factor 3;       
    9::197     4e-10  25%  461 aa  CELF3_BOVIN RecName: Full=CUG-BP- and ETR-3-like factor 3;       
   18::198     4e-10  28%  489 aa  CEL1A_XENLA RecName: Full=CUG-BP- and ETR-3-like factor 1-A;       
    3::159     5e-10  29%  287 aa  TSAP1_MOUSE RecName: Full=tRNA selenocysteine 1-associated protein
    1::83      5e-10  36%  496 aa  RBY1F_HUMAN RecName: Full=RNA-binding motif protein, Y
    2::81      6e-10  39%  103 aa  RBPB_ANASP RecName: Full=Putative RNA-binding protein rbpB;
    6::81      8e-10  41%  116 aa  YHOC_SCHPO RecName: Full=Uncharacterized RNA-binding protein
    1::83      8e-10  36%  496 aa  RBY1E_HUMAN RecName: Full=RNA-binding motif protein, Y
    1::83      8e-10  36%  496 aa  RBY1D_HUMAN RecName: Full=RNA-binding motif protein, Y
    1::83      8e-10  36%  496 aa  RBY1B_HUMAN RecName: Full=RNA-binding motif protein, Y
    1::83      8e-10  36%  496 aa  RBY1A_HUMAN RecName: Full=RNA-binding motif protein, Y
    5::86      8e-10  39%  394 aa  HNRGT_MACFA RecName: Full=RNA-binding motif protein,
    5::86      8e-10  39%  392 aa  HNRGT_HUMAN RecName: Full=RNA-binding motif protein,
   42::216     8e-10  31%  508 aa  CELF2_RAT RecName: Full=CUG-BP- and ETR-3-like factor 2;       
   42::216     8e-10  31%  508 aa  CELF2_PONAB RecName: Full=CUG-BP- and ETR-3-like factor 2;       
   42::216     8e-10  31%  508 aa  CELF2_MOUSE RecName: Full=CUG-BP- and ETR-3-like factor 2;       
   42::216     8e-10  31%  508 aa  CELF2_HUMAN RecName: Full=CUG-BP- and ETR-3-like factor 2;       
  222::435     1e-09  34%  573 aa  U2A2A_ARATH RecName: Full=Splicing factor U2af large subunit
    3::182     1e-09  28%  316 aa  TSP1L_DANRE RecName: Full=tRNA selenocysteine 1-associated protein
   71::202     1e-09  36%  332 aa  ROAA_HUMAN RecName: Full=Heterogeneous nuclear ribonucleoprotein
   64::206     1e-09  28%  403 aa  RBMS1_BOVIN RecName: Full=RNA-binding motif,
  344::476     1e-09  28%  714 aa  NUCL_MESAU RecName: Full=Nucleolin;AltName: Full=Protein C23;
  654::818     1e-09  31%  841 aa  MRD1_CANAL RecName: Full=Multiple RNA-binding domain-containing
    3::82      1e-09  41%  169 aa  GRP8_ARATH RecName: Full=Glycine-rich RNA-binding protein
   19::192     1e-09  31%  484 aa  CELF2_CHICK RecName: Full=CUG-BP- and ETR-3-like factor 2;       
   10::93      1e-09  37% 1067 aa  RMXL3_HUMAN RecName: Full=RNA-binding motif protein,
   64::206     1e-09  27%  403 aa  RBMS1_RAT RecName: Full=RNA-binding motif,
   64::206     1e-09  28%  406 aa  RBMS1_HUMAN RecName: Full=RNA-binding motif,
  230::422     1e-09  25%  651 aa  NUCL_XENLA RecName: Full=Nucleolin;AltName: Full=Protein C23;
  313::479     1e-09  27%  713 aa  NUCL_RAT RecName: Full=Nucleolin;AltName: Full=Protein C23;
   18::195     1e-09  28%  501 aa  CELF1_DANRE RecName: Full=CUG-BP- and ETR-3-like factor 1;       
   90::173     2e-09  36%  342 aa  ROC2_ARATH RecName: Full=29 kDa ribonucleoprotein,
  345::477     2e-09  27%  707 aa  NUCL_MOUSE RecName: Full=Nucleolin;AltName: Full=Protein C23;
  126::274     2e-09  31%  672 aa  NGR1_YEAST RecName: Full=Negative growth regulatory protein
  636::800     2e-09  31%  827 aa  MRD1_NEUCR RecName: Full=Multiple RNA-binding domain-containing
    9::99      2e-09  34%  577 aa  CSTF2_PONAB RecName: Full=Cleavage stimulation factor 64 kDa
    9::99      2e-09  34%  580 aa  CSTF2_MOUSE RecName: Full=Cleavage stimulation factor 64 kDa
    9::99      2e-09  34%  577 aa  CSTF2_HUMAN RecName: Full=Cleavage stimulation factor 64 kDa
    9::99      2e-09  34%  572 aa  CSTF2_BOVIN RecName: Full=Cleavage stimulation factor 64 kDa
    9::196     2e-09  25%  465 aa  CELF3_MOUSE RecName: Full=CUG-BP- and ETR-3-like factor 3;       
   37::211     2e-09  30%  513 aa  CELF2_XENTR RecName: Full=CUG-BP- and ETR-3-like factor 2;       
   60::234     2e-09  30%  536 aa  CELF2_XENLA RecName: Full=CUG-BP- and ETR-3-like factor 2;       
  241::412     2e-09  28%  604 aa  RSD1_SCHPO RecName: Full=RNA-binding protein rsd1;
    1::85      2e-09  35%  391 aa  HNRPG_PANTR RecName: Full=Heterogeneous nuclear ribonucleoprotein
    1::85      2e-09  35%  391 aa  HNRPG_HUMAN RecName: Full=Heterogeneous nuclear ribonucleoprotein
    1::155     3e-09  28%  305 aa  ROA0_HUMAN RecName: Full=Heterogeneous nuclear ribonucleoprotein
  113::188     3e-09  39%  269 aa  PAB1L_HUMAN RecName: Full=Putative protein PABPC1-like;AltName:
   63::237     3e-09  29%  523 aa  NAM8_YEAST RecName: Full=Protein NAM8;
  104::292     3e-09  22%  659 aa  MIP6_YEAST RecName: Full=RNA-binding protein MIP6;AltName:
   46::220     3e-09  31%  514 aa  CELF2_DANRE RecName: Full=CUG-BP- and ETR-3-like factor 2;       
  293::485     4e-09  31%  496 aa  U2AF2_CAEEL RecName: Full=Splicing factor U2AF 65 kDa
   26::177     4e-09  30%  369 aa  MSIR6_DROME RecName: Full=RNA-binding protein Musashi homolog Rbp6;
  207::274     4e-09  40%  294 aa  EIF3G_NEMVE RecName: Full=Eukaryotic translation initiation factor
  287::466     5e-09  31%  699 aa  SFPQ_MOUSE RecName: Full=Splicing factor, proline- and
  295::474     5e-09  31%  707 aa  SFPQ_HUMAN RecName: Full=Splicing factor, proline- and
    2::81      5e-09  38%   94 aa  RBPD_ANASP RecName: Full=Putative RNA-binding protein rbpD;
   79::221     5e-09  32%  522 aa  PSPC1_RAT RecName: Full=Paraspeckle component 1;
   79::221     5e-09  32%  523 aa  PSPC1_MOUSE RecName: Full=Paraspeckle component 1;AltName:
   80::222     5e-09  32%  523 aa  PSPC1_HUMAN RecName: Full=Paraspeckle component 1;AltName:
   77::219     5e-09  32%  520 aa  PSPC1_BOVIN RecName: Full=Paraspeckle component 1;
  389::569     5e-09  31%  712 aa  NUCL_PONAB RecName: Full=Nucleolin;
  388::568     5e-09  31%  711 aa  NUCL_MACFA RecName: Full=Nucleolin;
  387::567     5e-09  31%  710 aa  NUCL_HUMAN RecName: Full=Nucleolin;AltName: Full=Protein C23;
   45::222     5e-09  29%  513 aa  CELF1_PONAB RecName: Full=CUG-BP- and ETR-3-like factor 1;       
   86::177     7e-09  32%  297 aa  YDC1_SCHPO RecName: Full=Uncharacterized RNA-binding protein
   64::206     7e-09  26%  403 aa  RBMS1_MOUSE RecName: Full=RNA-binding motif,
    5::86      7e-09  40%  388 aa  HNRPG_RAT RecName: Full=Heterogeneous nuclear ribonucleoprotein G; 
    5::84      7e-09  39%  157 aa  GRPA_MAIZE RecName: Full=Glycine-rich RNA-binding, abscisic
    5::84      7e-09  38%  168 aa  GRP2_SORBI RecName: Full=Glycine-rich RNA-binding protein 2;
    3::82      7e-09  40%  157 aa  GRP1_DAUCA RecName: Full=Glycine-rich RNA-binding protein;
   10::86      9e-09  38%  992 aa  RMXL3_PANTR RecName: Full=RNA-binding motif protein,
  138::301     1e-08  32%  587 aa  A1CF_PONAB RecName: Full=APOBEC1 complementation factor;AltName:
   55::204     1e-08  25%  436 aa  RBMS3_PONAB RecName: Full=RNA-binding motif,
   51::200     1e-08  25%  431 aa  RBMS3_MOUSE RecName: Full=RNA-binding motif,
   56::205     1e-08  25%  437 aa  RBMS3_HUMAN RecName: Full=RNA-binding motif,
  731::910     1e-08  26%  960 aa  RBM19_HUMAN RecName: Full=Probable RNA-binding protein 19;AltName:
  155::337     1e-08  35%  533 aa  HNRPQ_RAT RecName: Full=Heterogeneous nuclear ribonucleoprotein Q; 
  245::427     1e-08  35%  623 aa  HNRPQ_MOUSE RecName: Full=Heterogeneous nuclear ribonucleoprotein
    1::85      1e-08  33%  388 aa  HNRPG_MOUSE RecName: Full=Heterogeneous nuclear ribonucleoprotein
   86::304     1e-08  26%  632 aa  CSX1_SCHPO RecName: Full=RNA-binding post-transcriptional regulator
   36::118     1e-08  31%  352 aa  C3H42_ARATH RecName: Full=Zinc finger CCCH domain-containing
  138::376     1e-08  28%  594 aa  A1CF_RAT RecName: Full=APOBEC1 complementation factor;AltName:
  242::453     2e-08  31%  589 aa  U2A2B_ARATH RecName: Full=Splicing factor U2af large subunit
  208::417     2e-08  32%  555 aa  U2A2A_NICPL RecName: Full=Splicing factor U2af large subunit
  675::870     2e-08  29%  895 aa  MRD1_DICDI RecName: Full=Multiple RNA-binding domain-containing
  248::397     2e-08  34%  633 aa  HNRPR_HUMAN RecName: Full=Heterogeneous nuclear ribonucleoprotein
  245::427     2e-08  35%  623 aa  HNRPQ_HUMAN RecName: Full=Heterogeneous nuclear ribonucleoprotein
   33::116     2e-08  35%  158 aa  GRP2_ARATH RecName: Full=Glycine-rich RNA-binding protein 2,
    3::82      2e-08  38%  169 aa  GRP10_BRANA RecName: Full=Glycine-rich RNA-binding protein 10;
   17::128     2e-08  30%  632 aa  CSTFT_MOUSE RecName: Full=Cleavage stimulation factor 64 kDa
   17::128     2e-08  30%  616 aa  CSTFT_HUMAN RecName: Full=Cleavage stimulation factor 64 kDa
  261::364     3e-08  33%  475 aa  U2AF2_MOUSE RecName: Full=Splicing factor U2AF 65 kDa
    2::81      3e-08  35%  105 aa  RBPF_ANASP RecName: Full=Putative RNA-binding protein rbpF;
  261::341     3e-08  32%  475 aa  U2AF2_HUMAN RecName: Full=Splicing factor U2AF 65 kDa
  240::434     3e-08  33%  574 aa  U2A2A_ORYSJ RecName: Full=Splicing factor U2af large subunit
   22::113     3e-08  32%  148 aa  IST3_YEAST RecName: Full=U2 snRNP component IST3;AltName: Full=U2
    3::88      3e-08  31%  172 aa  CIRBP_RAT RecName: Full=Cold-inducible RNA-binding
    3::88      3e-08  31%  172 aa  CIRBP_MOUSE RecName: Full=Cold-inducible RNA-binding
    3::88      3e-08  31%  172 aa  CIRBP_CRIGR RecName: Full=Cold-inducible RNA-binding
  209::403     4e-08  32%  543 aa  U2A2B_WHEAT RecName: Full=Splicing factor U2af large subunit
  100::255     4e-08  31%  414 aa  TADBP_PONAB RecName: Full=TAR DNA-binding protein 43;       
  100::255     4e-08  31%  414 aa  TADBP_HUMAN RecName: Full=TAR DNA-binding protein 43;       
   74::208     4e-08  32%  512 aa  PSPC1_DANRE RecName: Full=Paraspeckle component 1;
    2::81      4e-08  31%  163 aa  CIRBP_XENLA RecName: Full=Cold-inducible RNA-binding protein;    
    3::88      4e-08  31%  172 aa  CIRBP_PONAB RecName: Full=Cold-inducible RNA-binding
    3::88      4e-08  31%  172 aa  CIRBP_HUMAN RecName: Full=Cold-inducible RNA-binding
  238::476     6e-08  26%  597 aa  SHEP_DROAN RecName: Full=Protein alan shepard;
   12::104     6e-08  25%  190 aa  RBM18_BOVIN RecName: Full=Probable RNA-binding protein 18;AltName:
   79::221     6e-08  32%  523 aa  PSPC1_CHICK RecName: Full=Paraspeckle component 1;
   77::256     6e-08  31%  476 aa  NONO_RAT RecName: Full=Non-POU domain-containing octamer-binding
   72::251     6e-08  31%  471 aa  NONO_PONAB RecName: Full=Non-POU domain-containing octamer-binding
   74::253     6e-08  31%  473 aa  NONO_MOUSE RecName: Full=Non-POU domain-containing octamer-binding
   72::251     6e-08  31%  471 aa  NONO_HUMAN RecName: Full=Non-POU domain-containing octamer-binding
  649::787     6e-08  29%  838 aa  MRD1_ASHGO RecName: Full=Multiple RNA-binding domain-containing
  216::410     7e-08  32%  548 aa  U2A2B_ORYSJ RecName: Full=Splicing factor U2af large subunit
  723::902     7e-08  24%  952 aa  RBM19_MOUSE RecName: Full=Probable RNA-binding protein 19;AltName:
   12::104     7e-08  25%  190 aa  RBM18_PONAB RecName: Full=Probable RNA-binding protein 18;AltName:
   12::104     7e-08  25%  190 aa  RBM18_MOUSE RecName: Full=Probable RNA-binding protein 18;AltName:
   12::104     7e-08  25%  190 aa  RBM18_HUMAN RecName: Full=Probable RNA-binding protein 18;AltName:
   93::295     7e-08  35%  729 aa  HNRPM_MOUSE RecName: Full=Heterogeneous nuclear ribonucleoprotein
    3::63      7e-08  43%  142 aa  GRP1_SORBI RecName: Full=Glycine-rich RNA-binding protein 1;Flags:
  138::377     7e-08  27%  595 aa  A1CF_MOUSE RecName: Full=APOBEC1 complementation factor;AltName:
  288::374     1e-07  30%  430 aa  RBM34_HUMAN RecName: Full=RNA-binding protein 34;AltName:
  172::249     1e-07  35%  256 aa  EIF3G_CAEEL RecName: Full=Eukaryotic translation initiation factor
   36::113     1e-07  31%  312 aa  C3H25_ORYSJ RecName: Full=Zinc finger CCCH domain-containing
  226::435     1e-07  32%  573 aa  U2A2B_NICPL RecName: Full=Splicing factor U2af large subunit
   48::134     1e-07  32%  272 aa  U1SBP_XENLA RecName: Full=U11/U12 small nuclear ribonucleoprotein
  107::255     1e-07  29%  409 aa  TADBP_XENTR RecName: Full=TAR DNA-binding protein 43;       
  613::796     1e-07  27%  833 aa  MRD1_SCHPO RecName: Full=Multiple RNA-binding domain-containing
   21::106     1e-07  33%  217 aa  IST3_SCHPO RecName: Full=U2 snRNP component ist3;AltName:
   94::296     1e-07  35%  730 aa  HNRPM_HUMAN RecName: Full=Heterogeneous nuclear ribonucleoprotein
  153::230     1e-07  34%  233 aa  EIF3G_DICDI RecName: Full=Eukaryotic translation initiation factor
  138::301     1e-07  32%  594 aa  A1CF_HUMAN RecName: Full=APOBEC1 complementation factor;AltName:
   31::113     2e-07  30%  326 aa  RBMX2_MOUSE RecName: Full=RNA-binding motif protein, X-linked 2;
  200::286     2e-07  37%  396 aa  NOP12_CANGA RecName: Full=Nucleolar protein 12;
  700::837     2e-07  28%  887 aa  MRD1_YEAST RecName: Full=Multiple RNA-binding domain-containing
    9::157     2e-07  26%  352 aa  LARK_DROME RecName: Full=RNA-binding protein lark;
  274::468     2e-07  32%  591 aa  U2A2A_WHEAT RecName: Full=Splicing factor U2af large subunit
  134::286     2e-07  34%  369 aa  RNP24_SCHPO RecName: Full=RNA-binding protein rnp24;
   20::98      2e-07  32%  296 aa  RNA15_YEAST RecName: Full=mRNA 3'-end-processing protein RNA15;
   31::120     2e-07  28%  322 aa  RBMX2_HUMAN RecName: Full=RNA-binding motif protein, X-linked 2;
  143::359     2e-07  30%  533 aa  RBM46_MOUSE RecName: Full=Probable RNA-binding protein 46;AltName:
  116::189     2e-07  38%  593 aa  LARP7_XENTR RecName: Full=La-related protein 7;AltName: Full=La
  312::506     3e-07  27%  517 aa  U2AF2_SCHPO RecName: Full=Splicing factor U2AF 59 kDa
   48::137     3e-07  34%  250 aa  SGN1_YEAST RecName: Full=RNA-binding protein SGN1;
    2::81      3e-07  35%  101 aa  RBPA_SYNY3 RecName: Full=Putative RNA-binding protein rbpA;
    4::130     3e-07  29%  364 aa  RBM4_MACFA RecName: Full=RNA-binding protein 4;AltName:
    4::130     3e-07  29%  364 aa  RBM4_HUMAN RecName: Full=RNA-binding protein 4;AltName:
    4::130     3e-07  29%  362 aa  RBM4_BOVIN RecName: Full=RNA-binding protein 4;AltName:
  377::455     3e-07  33%  474 aa  RBM42_RAT RecName: Full=RNA-binding protein 42;AltName:
  377::455     3e-07  33%  474 aa  RBM42_MOUSE RecName: Full=RNA-binding protein 42;AltName:
  383::461     3e-07  33%  480 aa  RBM42_HUMAN RecName: Full=RNA-binding protein 42;AltName:
  351::429     3e-07  33%  448 aa  RBM42_BOVIN RecName: Full=RNA-binding protein 42;AltName:
  317::411     3e-07  28%  890 aa  RB15B_HUMAN RecName: Full=Putative RNA-binding protein 15B;AltName:
   43::160     3e-07  28%  168 aa  NCBP2_TAEGU RecName: Full=Nuclear cap-binding protein subunit
   35::108     3e-07  34%  257 aa  NCBP2_ARATH RecName: Full=Nuclear cap-binding protein subunit
  123::314     3e-07  35%  600 aa  MYEF2_HUMAN RecName: Full=Myelin expression factor 2;       
   22::168     3e-07  28%  362 aa  MSI1H_HUMAN RecName: Full=RNA-binding protein Musashi homolog 1;   
  284::476     4e-07  30%  488 aa  U2AF2_CAEBR RecName: Full=Splicing factor U2AF 65 kDa
  286::372     4e-07  31%  428 aa  RBM34_RAT RecName: Full=RNA-binding protein 34;AltName:
   29::102     4e-07  36%  152 aa  NCBP2_IXOSC RecName: Full=Nuclear cap-binding protein subunit
   29::129     4e-07  31%  234 aa  NCBP2_DICDI RecName: Full=Nuclear cap-binding protein subunit
   43::160     4e-07  27%  168 aa  NCBP2_CHICK RecName: Full=Nuclear cap-binding protein subunit
  114::305     4e-07  34%  591 aa  MYEF2_MOUSE RecName: Full=Myelin expression factor 2;       
   22::168     4e-07  28%  362 aa  MSI1H_RAT RecName: Full=RNA-binding protein Musashi homolog 1;     
   22::168     4e-07  28%  362 aa  MSI1H_MOUSE RecName: Full=RNA-binding protein Musashi homolog 1;   
   10::94      5e-07  33%  217 aa  ZCRB1_HUMAN RecName: Full=Zinc finger CCHC-type and RNA-binding
   10::94      5e-07  33%  217 aa  ZCRB1_BOVIN RecName: Full=Zinc finger CCHC-type and RNA-binding
  660::835     5e-07  27% 1014 aa  YOW4_SCHPO RecName: Full=Uncharacterized RNA-binding protein
   22::102     5e-07  27%  188 aa  RBM18_DANRE RecName: Full=Probable RNA-binding protein 18;AltName:
  677::810     5e-07  26%  861 aa  MRD1_CANGA RecName: Full=Multiple RNA-binding domain-containing
  160::261     5e-07  32%  279 aa  EIF3G_LODEL RecName: Full=Eukaryotic translation initiation factor
   32::105     6e-07  32%  219 aa  YDB2_SCHPO RecName: Full=Uncharacterized RNA-binding protein
  290::378     6e-07  28%  392 aa  RBM42_XENTR RecName: Full=RNA-binding protein 42;AltName:
  292::371     6e-07  31%  375 aa  RBM34_MOUSE RecName: Full=RNA-binding protein 34;AltName:
   46::144     6e-07  30%  218 aa  NCBP2_ASHGO RecName: Full=Nuclear cap-binding protein subunit
    9::80      6e-07  33%  363 aa  CTF1_SCHPO RecName: Full=Cleavage and termination factor
    2::81      8e-07  32%  102 aa  RBPA_ANASP RecName: Full=Putative RNA-binding protein rbpA;
   75::150     8e-07  30%  174 aa  RBM8A_DANRE RecName: Full=RNA-binding protein 8A;AltName:
    4::130     8e-07  28%  359 aa  RBM4_RABIT RecName: Full=RNA-binding protein 4;AltName:
    4::130     8e-07  28%  361 aa  RBM4_MOUSE RecName: Full=RNA-binding protein 4;AltName:
    4::130     8e-07  28%  357 aa  RBM4B_RAT RecName: Full=RNA-binding protein 4B;AltName:
    4::130     8e-07  28%  359 aa  RBM4B_PIG RecName: Full=RNA-binding protein 4B;AltName:
    4::130     8e-07  28%  357 aa  RBM4B_MOUSE RecName: Full=RNA-binding protein 4B;AltName:
    4::130     8e-07  28%  359 aa  RBM4B_HUMAN RecName: Full=RNA-binding protein 4B;AltName:
  250::317     8e-07  40%  426 aa  NOP12_ASHGO RecName: Full=Nucleolar protein 12;
  218::294     8e-07  35%  294 aa  EIF3G_YARLI RecName: Full=Eukaryotic translation initiation factor
   37::116     8e-07  31%  289 aa  DAZL_CHICK RecName: Full=Deleted in azoospermia-like;       
   10::86      1e-06  31%  218 aa  ZCRB1_XENLA RecName: Full=Zinc finger CCHC-type and RNA-binding
  100::255     1e-06  29%  414 aa  TADBP_CHICK RecName: Full=TAR DNA-binding protein 43;       
    3::72      1e-06  34%  269 aa  SFRS5_RAT RecName: Full=Splicing factor, arginine/serine-rich
    3::72      1e-06  34%  272 aa  SFRS5_HUMAN RecName: Full=Splicing factor, arginine/serine-rich
   75::150     1e-06  29%  175 aa  RBM8A_SALSA RecName: Full=RNA-binding protein 8A;AltName:
  143::306     1e-06  30%  485 aa  RBM46_MACFA RecName: Full=Probable RNA-binding protein 46;AltName:
  143::306     1e-06  30%  533 aa  RBM46_HUMAN RecName: Full=Probable RNA-binding protein 46;AltName:
  305::383     1e-06  32%  402 aa  RBM42_DANRE RecName: Full=RNA-binding protein 42;AltName:
   12::104     1e-06  24%  190 aa  RBM18_XENLA RecName: Full=Probable RNA-binding protein 18;AltName:
   93::230     1e-06  31%  611 aa  PES4_YEAST RecName: Full=Protein PES4;AltName: Full=DNA polymerase
  167::337     1e-06  29%  509 aa  NOP12_YARLI RecName: Full=Nucleolar protein 12;
   35::123     1e-06  28%  153 aa  NCBP2_XENLA RecName: Full=Nuclear cap-binding protein subunit
  289::368     1e-06  32%  819 aa  MRD1_EMENI RecName: Full=Multiple RNA-binding domain-containing
  184::250     1e-06  36%  269 aa  EI3G1_DROYA RecName: Full=Eukaryotic translation initiation factor
  184::250     1e-06  36%  269 aa  EI3G1_DROWI RecName: Full=Eukaryotic translation initiation factor
  184::250     1e-06  36%  269 aa  EI3G1_DROVI RecName: Full=Eukaryotic translation initiation factor
  184::250     1e-06  36%  269 aa  EI3G1_DROSI RecName: Full=Eukaryotic translation initiation factor
  184::250     1e-06  36%  269 aa  EI3G1_DROSE RecName: Full=Eukaryotic translation initiation factor
  184::250     1e-06  36%  269 aa  EI3G1_DROPS RecName: Full=Eukaryotic translation initiation factor
  184::250     1e-06  36%  269 aa  EI3G1_DROPE RecName: Full=Eukaryotic translation initiation factor
  184::250     1e-06  36%  269 aa  EI3G1_DROMO RecName: Full=Eukaryotic translation initiation factor
  184::250     1e-06  36%  269 aa  EI3G1_DROME RecName: Full=Eukaryotic translation initiation factor
  184::250     1e-06  36%  269 aa  EI3G1_DROGR RecName: Full=Eukaryotic translation initiation factor
  184::250     1e-06  36%  269 aa  EI3G1_DROER RecName: Full=Eukaryotic translation initiation factor
  185::251     1e-06  36%  270 aa  EI3G1_DROAN RecName: Full=Eukaryotic translation initiation factor
   10::94      1e-06  33%  217 aa  ZCRB1_RAT RecName: Full=Zinc finger CCHC-type and RNA-binding
   10::94      1e-06  33%  217 aa  ZCRB1_MOUSE RecName: Full=Zinc finger CCHC-type and RNA-binding
   75::150     1e-06  30%  174 aa  RBM8A_XENTR RecName: Full=RNA-binding protein 8A;AltName:
  155::318     1e-06  31%  592 aa  RBM47_CANFA RecName: Full=RNA-binding protein 47;AltName:
  241::324     1e-06  33%  403 aa  NOP13_YEAST RecName: Full=Nucleolar protein 13;
   35::108     1e-06  31%  243 aa  NCBP2_ORYSJ RecName: Full=Nuclear cap-binding protein subunit
   38::116     1e-06  32%  296 aa  MK67I_BOVIN RecName: Full=MKI67 FHA domain-interacting nucleolar
  109::182     1e-06  38%  571 aa  LARP7_RAT RecName: Full=La-related protein 7;AltName: Full=La
  108::181     1e-06  38%  570 aa  LARP7_MOUSE RecName: Full=La-related protein 7;AltName: Full=La
  114::187     1e-06  38%  581 aa  LARP7_MACFA RecName: Full=La-related protein 7;AltName: Full=La
  114::187     1e-06  38%  582 aa  LARP7_HUMAN RecName: Full=La-related protein 7;AltName: Full=La
  184::251     1e-06  32%  269 aa  EI3G2_DROAN RecName: Full=Eukaryotic translation initiation factor
    4::164     2e-06  33%  264 aa  RSP31_ARATH RecName: Full=Arginine/serine-rich-splicing factor
   75::150     2e-06  29%  174 aa  RB8AB_XENLA RecName: Full=RNA-binding protein 8A-B;AltName:
   75::150     2e-06  29%  174 aa  RB8AA_XENLA RecName: Full=RNA-binding protein 8A-A;AltName:
  254::337     2e-06  36%  459 aa  NOP12_YEAST RecName: Full=Nucleolar protein 12;
   41::147     2e-06  30%  208 aa  NCBP2_YEAST RecName: Full=Nuclear cap-binding protein subunit
   37::125     2e-06  28%  155 aa  NCBP2_DANRE RecName: Full=Nuclear cap-binding protein subunit
  223::301     2e-06  35%  303 aa  EIF3G_MAGGR RecName: Full=Eukaryotic translation initiation factor
  188::255     2e-06  31%  273 aa  EI3G2_DROYA RecName: Full=Eukaryotic translation initiation factor
  209::288     2e-06  30%  416 aa  U2AF2_DROME RecName: Full=Splicing factor U2AF 50 kDa
  100::255     2e-06  29%  414 aa  TADBP_MOUSE RecName: Full=TAR DNA-binding protein 43;       
   75::150     2e-06  28%  174 aa  RBM8A_RAT RecName: Full=RNA-binding protein 8A;AltName:
   75::150     2e-06  28%  174 aa  RBM8A_MOUSE RecName: Full=RNA-binding protein 8A;AltName:
   75::150     2e-06  28%  174 aa  RBM8A_HUMAN RecName: Full=RNA-binding protein 8A;AltName:
   75::150     2e-06  28%  174 aa  RBM8A_BOVIN RecName: Full=RNA-binding protein 8A;AltName:
  334::407     2e-06  31%  887 aa  RB15B_MOUSE RecName: Full=Putative RNA-binding protein 15B;AltName:
  289::355     2e-06  39%  462 aa  NOP12_KLULA RecName: Full=Nucleolar protein 12;
   38::114     2e-06  29%  156 aa  NCBP2_RAT RecName: Full=Nuclear cap-binding protein subunit
   38::114     2e-06  29%  156 aa  NCBP2_MOUSE RecName: Full=Nuclear cap-binding protein subunit
   38::114     2e-06  29%  156 aa  NCBP2_HUMAN RecName: Full=Nuclear cap-binding protein subunit
   38::114     2e-06  29%  156 aa  NCBP2_BOVIN RecName: Full=Nuclear cap-binding protein subunit
   43::116     2e-06  27%  276 aa  MK67I_XENTR RecName: Full=MKI67 FHA domain-interacting nucleolar
  194::262     2e-06  37%  279 aa  EIF3G_CANAL RecName: Full=Eukaryotic translation initiation factor
  180::251     2e-06  32%  271 aa  EIF3G_ANOGA RecName: Full=Eukaryotic translation initiation factor
    3::71      3e-06  33%  270 aa  SFRS5_MOUSE RecName: Full=Splicing factor, arginine/serine-rich
  295::364     3e-06  34%  392 aa  RBM42_XENLA RecName: Full=RNA-binding protein 42;AltName:
   38::123     3e-06  28%  153 aa  NCBP2_XENTR RecName: Full=Nuclear cap-binding protein subunit
   30::133     3e-06  26%  182 aa  NCBP2_SCHPO RecName: Full=Nuclear cap-binding protein subunit
   37::125     3e-06  28%  155 aa  NCBP2_ESOLU RecName: Full=Nuclear cap-binding protein subunit
   38::111     3e-06  34%  154 aa  NCBP2_CAEEL RecName: Full=Nuclear cap-binding protein subunit
   38::111     3e-06  34%  157 aa  NCBP2_CAEBR RecName: Full=Nuclear cap-binding protein subunit
  122::195     3e-06  35%  555 aa  LARP7_DANRE RecName: Full=La-related protein 7;AltName: Full=La
  182::249     3e-06  32%  268 aa  EI3G2_DROWI RecName: Full=Eukaryotic translation initiation factor
   10::86      4e-06  31%  218 aa  ZCRB1_DANRE RecName: Full=Zinc finger CCHC-type and RNA-binding
  112::196     4e-06  33%  281 aa  TRA2A_MOUSE RecName: Full=Transformer-2 protein homolog alpha;     
  114::198     4e-06  33%  282 aa  TRA2A_HUMAN RecName: Full=Transformer-2 protein homolog alpha;     
  143::306     4e-06  30%  534 aa  RBM46_XENTR RecName: Full=Probable RNA-binding protein 46;AltName:
  367::448     4e-06  30%  977 aa  RBM15_HUMAN RecName: Full=Putative RNA-binding protein 15;AltName:
  384::469     4e-06  35%  710 aa  PABPX_SCHPO RecName: Full=mRNA export factor crp79;AltName:
  177::280     4e-06  32%  281 aa  EIF3G_PHANO RecName: Full=Eukaryotic translation initiation factor
  174::241     4e-06  31%  259 aa  EI3G2_DROVI RecName: Full=Eukaryotic translation initiation factor
  175::242     4e-06  28%  260 aa  EI3G2_DROGR RecName: Full=Eukaryotic translation initiation factor
  188::255     4e-06  29%  273 aa  EI3G2_DROER RecName: Full=Eukaryotic translation initiation factor
   31::103     4e-06  34%  286 aa  DAZL_XENTR RecName: Full=Deleted in azoospermia-like;       
   35::108     4e-06  34%  283 aa  BOLL_MACFA RecName: Full=Protein boule-like;
   35::108     4e-06  34%  283 aa  BOLL_HUMAN RecName: Full=Protein boule-like;
   37::125     5e-06  28%  155 aa  NCBP2_SALSA RecName: Full=Nuclear cap-binding protein subunit
   34::108     5e-06  28%  160 aa  NCBP2_CULQU RecName: Full=Nuclear cap-binding protein subunit
   23::202     5e-06  26%  346 aa  MSI2H_MOUSE RecName: Full=RNA-binding protein Musashi homolog 2;   
   23::202     5e-06  26%  328 aa  MSI2H_HUMAN RecName: Full=RNA-binding protein Musashi homolog 2;   
   43::116     5e-06  24%  278 aa  MK67I_XENLA RecName: Full=MKI67 FHA domain-interacting nucleolar
    4::153     5e-06  26%  579 aa  IF2B3_HUMAN RecName: Full=Insulin-like growth factor 2 mRNA-binding
  181::253     5e-06  32%  271 aa  EIF3G_PICST RecName: Full=Eukaryotic translation initiation factor
   41::113     5e-06  32%  295 aa  DAZL_MACFA RecName: Full=Deleted in azoospermia-like;AltName:
   41::113     5e-06  32%  295 aa  DAZL_HUMAN RecName: Full=Deleted in azoospermia-like;AltName:
  316::389     7e-06  34%  468 aa  YKX5_SCHPO RecName: Full=Uncharacterized RNA-binding protein
   11::80      7e-06  36%  258 aa  RSP3_CAEEL RecName: Full=Probable splicing factor,
  167::299     7e-06  33%  510 aa  RBM46_DANRE RecName: Full=Probable RNA-binding protein 46;AltName:
   34::108     7e-06  28%  159 aa  NCBP2_AEDAE RecName: Full=Nuclear cap-binding protein subunit
  218::287     7e-06  36%  310 aa  EIF3G_XENTR RecName: Full=Eukaryotic translation initiation factor
  228::297     7e-06  36%  320 aa  EIF3G_RAT RecName: Full=Eukaryotic translation initiation factor 3
  228::297     7e-06  36%  320 aa  EIF3G_MOUSE RecName: Full=Eukaryotic translation initiation factor
  228::297     7e-06  36%  320 aa  EIF3G_HUMAN RecName: Full=Eukaryotic translation initiation factor
  228::297     7e-06  36%  320 aa  EIF3G_BOVIN RecName: Full=Eukaryotic translation initiation factor
  216::285     7e-06  36%  308 aa  EI3GB_XENLA RecName: Full=Eukaryotic translation initiation factor
  216::285     7e-06  36%  308 aa  EI3GA_XENLA RecName: Full=Eukaryotic translation initiation factor
  174::241     7e-06  31%  259 aa  EI3G2_DROMO RecName: Full=Eukaryotic translation initiation factor
   41::113     7e-06  32%  298 aa  DAZL_MOUSE RecName: Full=Deleted in azoospermia-like;AltName:
   84::176     9e-06  33%  276 aa  YQL5_SCHPO RecName: Full=Uncharacterized RNA-binding protein
   39::124     9e-06  28%  271 aa  MK67I_RAT RecName: Full=MKI67 FHA domain-interacting nucleolar
  102::280     9e-06  31%  427 aa  GBP2_YEAST RecName: Full=Single-strand telomeric DNA-binding
  186::252     9e-06  33%  272 aa  EIF3G_CULQU RecName: Full=Eukaryotic translation initiation factor
  186::252     9e-06  33%  272 aa  EIF3G_AEDAE RecName: Full=Eukaryotic translation initiation factor
   41::113     9e-06  32%  296 aa  DAZL_CALJA RecName: Full=Deleted in azoospermia-like;AltName:
   34::106     9e-06  33%  286 aa  DAZLA_XENLA RecName: Full=Deleted in azoospermia-like-A;       
  267::343     1e-05  34% 1029 aa  SR140_MOUSE RecName: Full=U2-associated protein SR140;AltName:
  139::209     1e-05  30%  283 aa  RNPS1_DANRE RecName: Full=RNA-binding protein with serine-rich
  153::316     1e-05  31%  593 aa  RBM47_PONAB RecName: Full=RNA-binding protein 47;AltName:
  153::316     1e-05  31%  593 aa  RBM47_HUMAN RecName: Full=RNA-binding protein 47;AltName:
   47::116     1e-05  30%  293 aa  MK67I_HUMAN RecName: Full=MKI67 FHA domain-interacting nucleolar
  208::286     1e-05  33%  288 aa  EIF3G_SCLS1 RecName: Full=Eukaryotic translation initiation factor
  217::295     1e-05  34%  297 aa  EIF3G_NEUCR RecName: Full=Eukaryotic translation initiation factor
  223::301     1e-05  33%  303 aa  EIF3G_CHAGB RecName: Full=Eukaryotic translation initiation factor
  208::286     1e-05  33%  288 aa  EIF3G_BOTFB RecName: Full=Eukaryotic translation initiation factor
   68::140     1e-05  33%  683 aa  EIF3B_ANOGA RecName: Full=Eukaryotic translation initiation factor
  188::255     1e-05  28%  273 aa  EI3G2_DROSI RecName: Full=Eukaryotic translation initiation factor
  188::255     1e-05  28%  273 aa  EI3G2_DROSE RecName: Full=Eukaryotic translation initiation factor
  188::255     1e-05  28%  273 aa  EI3G2_DROME RecName: Full=Eukaryotic translation initiation factor
   34::106     1e-05  33%  286 aa  DAZLB_XENLA RecName: Full=Deleted in azoospermia-like-B;       
   35::108     1e-05  31%  281 aa  BOLL_MOUSE RecName: Full=Protein boule-like;
   46::124     2e-05  34%  348 aa  TCG1_SCHPO RecName: Full=Single-stranded TG1-3 DNA-binding
  540::727     2e-05  26% 5560 aa  SPEN_DROME RecName: Full=Protein split ends;
  248::322     2e-05  36%  504 aa  PPIL4_CRYNE RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   30::102     2e-05  30%  154 aa  NCBP2_BOMMO RecName: Full=Nuclear cap-binding protein subunit
   38::112     2e-05  31%  163 aa  NCBP2_ANOGA RecName: Full=Nuclear cap-binding protein subunit
  201::270     2e-05  36%  293 aa  EIF3G_DANRE RecName: Full=Eukaryotic translation initiation factor
  122::209     2e-05  31%  399 aa  CAZ_DROME RecName: Full=RNA-binding protein cabeza;AltName:
   93::164     2e-05  32%  220 aa  NOP15_YEAST RecName: Full=Ribosome biogenesis protein 15;AltName:
  230::325     2e-05  34%  454 aa  NOP12_CANAL RecName: Full=Nucleolar protein 12;
  115::245     2e-05  29%  535 aa  HRP65_CHITE RecName: Full=Hrp65 protein;AltName: Full=Ct-Hrp65;
   76::148     2e-05  33%  688 aa  EIF3B_CULQU RecName: Full=Eukaryotic translation initiation factor
  113::197     3e-05  33%  288 aa  TRA2B_RAT RecName: Full=Transformer-2 protein homolog beta;        
  113::197     3e-05  33%  288 aa  TRA2B_MOUSE RecName: Full=Transformer-2 protein homolog beta;      
  113::197     3e-05  33%  288 aa  TRA2B_HUMAN RecName: Full=Transformer-2 protein homolog beta;      
  113::197     3e-05  33%  288 aa  TRA2B_BOVIN RecName: Full=Transformer-2 protein homolog beta;      
  266::342     3e-05  33% 1028 aa  SR140_PONAB RecName: Full=U2-associated protein SR140;AltName:
  267::343     3e-05  33% 1029 aa  SR140_HUMAN RecName: Full=U2-associated protein SR140;AltName:
    4::161     3e-05  25%  419 aa  RBM41_DANRE RecName: Full=RNA-binding protein 4.1;AltName:
    1::96      3e-05  31%  121 aa  PM14_DROME RecName: Full=Pre-mRNA branch site p14-like protein;
  194::256     3e-05  32%  274 aa  EI3G2_DROPS RecName: Full=Eukaryotic translation initiation factor
  196::258     3e-05  32%  276 aa  EI3G2_DROPE RecName: Full=Eukaryotic translation initiation factor
   33::144     3e-05  32%  352 aa  YBKC_SCHPO RecName: Full=Uncharacterized RNA-binding protein
    9::75      3e-05  39%  197 aa  RX21_DROME RecName: Full=RNA-binding protein Rsf1;AltName:
  488::646     3e-05  24%  754 aa  REXON_RAT RecName: Full=Putative RNA exonuclease NEF-sp;       
  250::342     3e-05  32%  461 aa  PPIL4_ASPOR RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
  261::328     3e-05  38%  438 aa  NOP12_SCHPO RecName: Full=Nucleolar protein 12;
  420::506     3e-05  31%  609 aa  MUG28_SCHPO RecName: Full=Meiotically up-regulated gene 28 protein;
  295::374     3e-05  29%  825 aa  MRD1_ASPFU RecName: Full=Multiple RNA-binding domain-containing
    4::153     3e-05  25%  593 aa  IF23B_XENLA RecName: Full=Insulin-like growth factor 2 mRNA-binding
  155::218     3e-05  38%  454 aa  HRB1_YEAST RecName: Full=Protein HRB1;AltName: Full=Protein TOM34;
   76::148     3e-05  33%  688 aa  EIF3B_AEDAE RecName: Full=Eukaryotic translation initiation factor
   41::118     3e-05  29%  579 aa  DAZ4_HUMAN RecName: Full=Deleted in azoospermia protein 4;
   41::118     3e-05  29%  486 aa  DAZ3_HUMAN RecName: Full=Deleted in azoospermia protein 3;
   41::118     3e-05  29%  558 aa  DAZ2_HUMAN RecName: Full=Deleted in azoospermia protein 2;
   41::118     3e-05  29%  744 aa  DAZ1_HUMAN RecName: Full=Deleted in azoospermia protein 1;
    2::85      4e-05  25%  422 aa  YKCG_SCHPO RecName: Full=Uncharacterized RNA-binding protein
  197::314     4e-05  31%  781 aa  YG5B_YEAST RecName: Full=Uncharacterized RNA-binding protein
   75::162     4e-05  30%  165 aa  RBM8A_DROME RecName: Full=RNA-binding protein 8A;AltName:
   37::125     4e-05  27%  165 aa  NCBP2_SINCH RecName: Full=Nuclear cap-binding protein subunit
  582::739     4e-05  28%  769 aa  MRD1_CRYNE RecName: Full=Multiple RNA-binding domain-containing
   47::116     4e-05  31%  269 aa  MK67I_DANRE RecName: Full=MKI67 FHA domain-interacting nucleolar
   13::93      4e-05  38%  158 aa  HNRPC_RAT RecName: Full=Heterogeneous nuclear ribonucleoprotein
    4::70      6e-05  31%  344 aa  SFRS6_HUMAN RecName: Full=Splicing factor, arginine/serine-rich
  212::340     6e-05  29%  446 aa  PPIL4_RHIOR RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
    4::153     6e-05  24%  594 aa  IF23A_XENLA RecName: Full=Insulin-like growth factor 2 mRNA-binding
    8::88      8e-05  31%  303 aa  SFRS1_ARATH RecName: Full=Pre-mRNA-splicing factor SF2;AltName:
   88::188     8e-05  29%  841 aa  RBM25_MOUSE RecName: Full=RNA-binding protein 25;AltName:
   86::168     8e-05  37%  225 aa  PABP2_DROPS RecName: Full=Polyadenylate-binding protein 2;       
   86::168     8e-05  37%  224 aa  PABP2_DROME RecName: Full=Polyadenylate-binding protein 2;       
  201::273     8e-05  38%  290 aa  EIF3G_NEOFI RecName: Full=Eukaryotic translation initiation factor
  201::273     8e-05  38%  290 aa  EIF3G_ASPFU RecName: Full=Eukaryotic translation initiation factor
  201::273     8e-05  38%  290 aa  EIF3G_ASPFC RecName: Full=Eukaryotic translation initiation factor
   48::126     8e-05  34%  229 aa  DAZL_DANRE RecName: Full=Deleted in azoospermia-like;       
  139::212     1e-04  28%  427 aa  RU17_ARATH RecName: Full=U1 small nuclear ribonucleoprotein 70 kDa;
   38::113     1e-04  38%  476 aa  RBM45_HUMAN RecName: Full=RNA-binding protein 45;AltName:
  255::329     1e-04  32%  494 aa  PPIL4_NEUCR RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
  250::345     1e-04  30%  461 aa  PPIL4_EMENI RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
  688::826     1e-04  24%  878 aa  MRD1_KLULA RecName: Full=Multiple RNA-binding domain-containing
    5::154     1e-04  22%  599 aa  IF2B2_HUMAN RecName: Full=Insulin-like growth factor 2 mRNA-binding
   94::175     1e-04  30%  374 aa  FOX1C_MOUSE RecName: Full=Fox-1 homolog C;
   94::175     1e-04  30%  350 aa  FOX1C_HUMAN RecName: Full=Fox-1 homolog C;
  200::272     1e-04  37%  289 aa  EIF3G_EMENI RecName: Full=Eukaryotic translation initiation factor
  189::275     1e-04  25%  276 aa  EIF3G_DEBHA RecName: Full=Eukaryotic translation initiation factor
  208::286     1e-04  33%  288 aa  EIF3G_COCIM RecName: Full=Eukaryotic translation initiation factor
  199::271     1e-04  38%  288 aa  EIF3G_ASPNC RecName: Full=Eukaryotic translation initiation factor
  201::273     1e-04  37%  290 aa  EIF3G_ASPCL RecName: Full=Eukaryotic translation initiation factor
   34::91      1e-04  34%  261 aa  SRR35_HUMAN RecName: Full=35 kDa SR repressor protein;AltName:
   38::113     1e-04  38%  476 aa  RBM45_RAT RecName: Full=RNA-binding protein 45;AltName:
   88::170     1e-04  25%  843 aa  RBM25_HUMAN RecName: Full=RNA-binding protein 25;AltName:
  250::342     1e-04  32%  459 aa  PPIL4_ASPFU RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   43::128     1e-04  31%  166 aa  PAB2_SCHPO RecName: Full=Polyadenylate-binding protein 2;       
  225::316     1e-04  31%  462 aa  NOP12_DEBHA RecName: Full=Nucleolar protein 12;
   49::122     1e-04  26%  317 aa  MK67I_MOUSE RecName: Full=MKI67 FHA domain-interacting nucleolar
  185::256     1e-04  28%  274 aa  EIF3G_PICGU RecName: Full=Eukaryotic translation initiation factor
  177::254     1e-04  29%  261 aa  EIF3G_CAEBR RecName: Full=Probable eukaryotic translation
  207::270     1e-04  38%  287 aa  EIF3G_ASPOR RecName: Full=Eukaryotic translation initiation factor
   99::155     2e-04  40%  300 aa  RU17_YEAST RecName: Full=U1 small nuclear ribonucleoprotein 70 kDa
   32::113     2e-04  35%  476 aa  RBM45_MOUSE RecName: Full=RNA-binding protein 45;AltName:
    7::99      2e-04  25%  115 aa  PM14_SCHPO RecName: Full=Pre-mRNA branch site p14-like protein;
    4::153     2e-04  24%  582 aa  IF2B3_DANRE RecName: Full=Insulin-like growth factor 2 mRNA-binding
    4::153     2e-04  23%  584 aa  IF2B3_CHICK RecName: Full=Insulin-like growth factor 2 mRNA-binding
    5::154     2e-04  22%  556 aa  IF2B2_PONAB RecName: Full=Insulin-like growth factor 2 mRNA-binding
   15::103     2e-04  30%  282 aa  HNRPC_XENLA RecName: Full=Heterogeneous nuclear ribonucleoprotein
  149::224     2e-04  36%  382 aa  FOX1L_DANRE RecName: Full=Fox-1 homolog-like protein 1;AltName:
  185::274     2e-04  27%  274 aa  EIF3G_VANPO RecName: Full=Eukaryotic translation initiation factor
  199::281     2e-04  34%  287 aa  EIF3G_BRUMA RecName: Full=Eukaryotic translation initiation factor
  117::218     2e-04  31%  326 aa  TRA2_DICDI RecName: Full=Transformer-2 protein homolog;
    4::70      2e-04  30%  345 aa  SFRS6_BOVIN RecName: Full=Splicing factor, arginine/serine-rich 6;
   27::100     2e-04  37%  249 aa  RU1A_SCHPO RecName: Full=U1 small nuclear ribonucleoprotein usp102;
   13::108     2e-04  32%  215 aa  RBM38_CHICK RecName: Full=RNA-binding protein 38;AltName:
   16::91      2e-04  26%  138 aa  PM14_CAEEL RecName: Full=Pre-mRNA branch site p14-like protein;
  253::419     2e-04  24%  542 aa  MODU_DROME RecName: Full=DNA-binding protein modulo;
    6::91      2e-04  26%  262 aa  FUSIP_MOUSE RecName: Full=FUS-interacting serine-arginine-rich
    6::91      2e-04  26%  262 aa  FUSIP_HUMAN RecName: Full=FUS-interacting serine-arginine-rich
  166::239     3e-04  27%  309 aa  RNPS1_XENTR RecName: Full=RNA-binding protein with serine-rich
  140::213     3e-04  27%  283 aa  RNP1B_XENLA RecName: Full=RNA-binding protein with serine-rich
  140::213     3e-04  27%  283 aa  RNP1A_XENLA RecName: Full=RNA-binding protein with serine-rich
  304::437     3e-04  29%  700 aa  NONA_DROME RecName: Full=Protein no-on-transient A;AltName:
   83::165     3e-04  36%  218 aa  EPA2B_XENLA RecName: Full=Embryonic polyadenylate-binding protein
  184::254     3e-04  31%  274 aa  EIF3G_BOMMO RecName: Full=Eukaryotic translation initiation factor
  197::269     3e-04  37%  286 aa  EIF3G_ASPTN RecName: Full=Eukaryotic translation initiation factor
   57::111     3e-04  37%  709 aa  EIF3B_LODEL RecName: Full=Eukaryotic translation initiation factor
   49::111     3e-04  32%  424 aa  CELF4_XENTR RecName: Full=CUG-BP- and ETR-3-like factor 4;       
   94::165     4e-04  32%  233 aa  YGR4_SCHPO RecName: Full=Uncharacterized RNA-binding protein
    9::86      4e-04  31%  121 aa  YFH9_SCHPO RecName: Full=Uncharacterized RNA-binding protein
   12::158     4e-04  35%  282 aa  SNRPA_XENLA RecName: Full=U1 small nuclear ribonucleoprotein A;    
    4::70      4e-04  28%  489 aa  SFRS4_MOUSE RecName: Full=Splicing factor, arginine/serine-rich 4;
    4::70      4e-04  28%  494 aa  SFRS4_HUMAN RecName: Full=Splicing factor, arginine/serine-rich
   13::108     4e-04  32%  214 aa  RBM38_XENLA RecName: Full=RNA-binding protein 38;AltName:
    3::90      4e-04  28%  312 aa  RALY_MOUSE RecName: Full=RNA-binding protein Raly;AltName:
  246::320     4e-04  31%  432 aa  PPIL4_SCHPO RecName: Full=Peptidyl-prolyl cis-trans isomerase cyp6;
   20::105     4e-04  26%  154 aa  NCBP2_DROWI RecName: Full=Nuclear cap-binding protein subunit
    4::153     4e-04  24%  579 aa  IF2B3_MOUSE RecName: Full=Insulin-like growth factor 2 mRNA-binding
   20::95      5e-04  24%  196 aa  RSP4_CAEEL RecName: Full=Probable splicing factor,
  163::236     5e-04  24%  305 aa  RNPS1_RAT RecName: Full=RNA-binding protein with serine-rich domain
  163::236     5e-04  24%  305 aa  RNPS1_PONAB RecName: Full=RNA-binding protein with serine-rich
  163::236     5e-04  24%  305 aa  RNPS1_MOUSE RecName: Full=RNA-binding protein with serine-rich
  163::236     5e-04  24%  305 aa  RNPS1_MACFA RecName: Full=RNA-binding protein with serine-rich
  163::236     5e-04  24%  305 aa  RNPS1_HUMAN RecName: Full=RNA-binding protein with serine-rich
  163::236     5e-04  24%  305 aa  RNPS1_BOVIN RecName: Full=RNA-binding protein with serine-rich
   36::136     5e-04  29%  239 aa  RBM38_HUMAN RecName: Full=RNA-binding protein 38;AltName:
   13::108     5e-04  32%  230 aa  RBM24_DANRE RecName: Full=RNA-binding protein 24;AltName:
  253::327     5e-04  31%  605 aa  PPIL4_GIBZE RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
  101::174     6e-04  27%  261 aa  RU17_SCHPO RecName: Full=U1 small nuclear ribonucleoprotein 70 kDa
  311::398     6e-04  26%  413 aa  RBM41_HUMAN RecName: Full=RNA-binding protein 41;AltName:
   10::63      6e-04  40% 1167 aa  NOL8_HUMAN RecName: Full=Nucleolar protein 8;AltName:
   20::105     6e-04  26%  154 aa  NCBP2_DROMO RecName: Full=Nuclear cap-binding protein subunit
   20::105     6e-04  27%  154 aa  NCBP2_DROAN RecName: Full=Nuclear cap-binding protein subunit
  107::194     6e-04  31%  382 aa  FOX1A_PONAB RecName: Full=Fox-1 homolog A;AltName:
  112::192     6e-04  28%  396 aa  FOX1A_MOUSE RecName: Full=Fox-1 homolog A;AltName:
  109::196     6e-04  31%  376 aa  FOX1A_MACFA RecName: Full=Fox-1 homolog A;AltName:
  107::194     6e-04  31%  397 aa  FOX1A_HUMAN RecName: Full=Fox-1 homolog A;AltName:
   53::134     8e-04  30%  246 aa  U1SBP_HUMAN RecName: Full=U11/U12 small nuclear ribonucleoprotein
   18::97      8e-04  38%  287 aa  SNRPA_MOUSE RecName: Full=U1 small nuclear ribonucleoprotein A;    
  107::169     8e-04  37%  221 aa  SFRS9_RAT RecName: Full=Splicing factor, arginine/serine-rich 9;
  108::170     8e-04  37%  222 aa  SFRS9_MOUSE RecName: Full=Splicing factor, arginine/serine-rich 9;
  717::817     8e-04  30%  941 aa  RNP4F_DROME RecName: Full=RNA-binding protein 4F;
  242::316     8e-04  32%  492 aa  PPIL4_MOUSE RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
  242::316     8e-04  32%  492 aa  PPIL4_HUMAN RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   27::125     8e-04  25%  685 aa  NOP4_YEAST RecName: Full=Nucleolar protein 4;AltName:
   20::105     8e-04  26%  154 aa  NCBP2_DROGR RecName: Full=Nuclear cap-binding protein subunit
   20::105     8e-04  26%  154 aa  NCB2B_DROVI RecName: Full=Nuclear cap-binding protein subunit
    2::79      8e-04  31%  858 aa  MRD1_USTMA RecName: Full=Multiple RNA-binding domain-containing
  345::511     8e-04  26% 3644 aa  MINT_MOUSE RecName: Full=Msx2-interacting protein;AltName:
    4::153     8e-04  21%  598 aa  IF2B1_DANRE RecName: Full=Insulin-like growth factor 2 mRNA-binding
  115::195     8e-04  28%  373 aa  FOX1A_DANRE RecName: Full=Fox-1 homolog A;AltName:
   83::151     8e-04  36%  218 aa  EPA2A_XENLA RecName: Full=Embryonic polyadenylate-binding protein
  220::265     8e-04  30%  269 aa  EIF3G_ASHGO RecName: Full=Eukaryotic translation initiation factor
  234::307     8e-04  30%  576 aa  CIP2_SCHPO RecName: Full=RNA-binding post-transcriptional regulator
   12::84      4e-08  40%  262 aa  RBM7_BOVIN RecName: Full=RNA-binding protein 7;AltName:(query 102->176)
   12::93      3e-07  37%  281 aa  RBM11_HUMAN RecName: Full=Putative RNA-binding protein(query 102->185)
    8::82      7e-09  40%  300 aa  PPIE_DROME RecName: Full=Peptidyl-prolyl cis-trans isomerase E;  (query 102->177)
    8::82      1e-07  37%  301 aa  PPIE_PONAB RecName: Full=Peptidyl-prolyl cis-trans isomerase E;  (query 102->177)
    8::82      1e-07  37%  301 aa  PPIE_MOUSE RecName: Full=Peptidyl-prolyl cis-trans isomerase E;  (query 102->177)
    8::82      1e-07  37%  301 aa  PPIE_HUMAN RecName: Full=Peptidyl-prolyl cis-trans isomerase E;  (query 102->177)
    8::82      1e-07  37%  301 aa  PPIE_BOVIN RecName: Full=Peptidyl-prolyl cis-trans isomerase E;  (query 102->177)
   10::89      6e-08  35%  380 aa  RBY1A_MOUSE RecName: Full=RNA-binding motif protein, Y(query 102->182)
    5::89      1e-07  34%  380 aa  RBY1B_MOUSE RecName: Full=RNA-binding motif protein, Y(query 97->182)
   11::84      2e-06  38%  169 aa  GRP2_SINAL RecName: Full=Glycine-rich RNA-binding protein GRP2A;(query 16->89)
   11::84      3e-06  36%  166 aa  GRP1_SINAL RecName: Full=Glycine-rich RNA-binding protein GRP1A;(query 16->89)
   27::107     3e-07  32%  212 aa  RT19_ARATH RecName: Full=40S ribosomal protein S19,(query 9->89)
    1::85      3e-08  33%  396 aa  HNRPG_BOVIN RecName: Full=Heterogeneous nuclear ribonucleoprotein(query 6->90)
   11::84      2e-06  36%  176 aa  GRP7_ARATH RecName: Full=Glycine-rich RNA-binding protein 7;(query 16->89)
    2::83      1e-07  33%   99 aa  RBPE_ANASP RecName: Full=Putative RNA-binding protein rbpE;(query 101->183)
    3::80      9e-09  33%  157 aa  RBM3_HUMAN RecName: Full=Putative RNA-binding protein 3;AltName:(query 10->87)
    3::80      1e-08  33%  153 aa  RBM3_MOUSE RecName: Full=Putative RNA-binding protein 3;AltName:(query 10->87)
    5::85      1e-06  38%  496 aa  RBY1F_HUMAN RecName: Full=RNA-binding motif protein, Y(query 97->179)
    2::81      4e-06  31%  103 aa  RBPB_ANASP RecName: Full=Putative RNA-binding protein rbpB;(query 101->181)
    6::82      2e-06  34%  116 aa  YHOC_SCHPO RecName: Full=Uncharacterized RNA-binding protein(query 13->90)
    5::85      6e-07  38%  496 aa  RBY1E_HUMAN RecName: Full=RNA-binding motif protein, Y(query 97->179)
    5::85      6e-07  38%  496 aa  RBY1D_HUMAN RecName: Full=RNA-binding motif protein, Y(query 97->179)
    5::85      6e-07  38%  496 aa  RBY1B_HUMAN RecName: Full=RNA-binding motif protein, Y(query 97->179)
    5::85      6e-07  38%  496 aa  RBY1A_HUMAN RecName: Full=RNA-binding motif protein, Y(query 97->179)
    1::85      7e-08  34%  394 aa  HNRGT_MACFA RecName: Full=RNA-binding motif protein,(query 6->90)
    1::85      2e-08  35%  392 aa  HNRGT_HUMAN RecName: Full=RNA-binding motif protein,(query 6->90)
    9::84      3e-06  34%  169 aa  GRP8_ARATH RecName: Full=Glycine-rich RNA-binding protein(query 16->91)
    1::81      6e-07  33% 1067 aa  RMXL3_HUMAN RecName: Full=RNA-binding motif protein,(query 6->86)
   17::128     7e-08  29%  577 aa  CSTF2_PONAB RecName: Full=Cleavage stimulation factor 64 kDa(query 101->210)
   17::128     7e-08  29%  580 aa  CSTF2_MOUSE RecName: Full=Cleavage stimulation factor 64 kDa(query 101->210)
   17::128     7e-08  29%  577 aa  CSTF2_HUMAN RecName: Full=Cleavage stimulation factor 64 kDa(query 101->210)
   17::128     7e-08  29%  572 aa  CSTF2_BOVIN RecName: Full=Cleavage stimulation factor 64 kDa(query 101->210)
    5::86      2e-09  38%  391 aa  HNRPG_PANTR RecName: Full=Heterogeneous nuclear ribonucleoprotein(query 97->179)
    5::86      2e-09  38%  391 aa  HNRPG_HUMAN RecName: Full=Heterogeneous nuclear ribonucleoprotein(query 97->179)
  209::275     3e-05  39%  294 aa  EIF3G_NEMVE RecName: Full=Eukaryotic translation initiation factor(query 97->164)
    3::87      3e-04  29%   94 aa  RBPD_ANASP RecName: Full=Putative RNA-binding protein rbpD;(query 102->189)
    1::85      9e-09  33%  388 aa  HNRPG_RAT RecName: Full=Heterogeneous nuclear ribonucleoprotein G; (query 6->90)
   11::86      5e-06  34%  157 aa  GRPA_MAIZE RecName: Full=Glycine-rich RNA-binding, abscisic(query 16->91)
   11::86      1e-06  34%  168 aa  GRP2_SORBI RecName: Full=Glycine-rich RNA-binding protein 2;(query 16->91)
    9::84      1e-06  34%  157 aa  GRP1_DAUCA RecName: Full=Glycine-rich RNA-binding protein;(query 16->91)
    1::81      6e-07  35%  992 aa  RMXL3_PANTR RecName: Full=RNA-binding motif protein,(query 6->86)
    5::86      2e-08  35%  388 aa  HNRPG_MOUSE RecName: Full=Heterogeneous nuclear ribonucleoprotein(query 97->179)
   31::112     5e-07  33%  158 aa  GRP2_ARATH RecName: Full=Glycine-rich RNA-binding protein 2,(query 9->90)
    9::84      8e-07  36%  169 aa  GRP10_BRANA RecName: Full=Glycine-rich RNA-binding protein 10;(query 16->91)
   17::99      3e-08  33%  632 aa  CSTFT_MOUSE RecName: Full=Cleavage stimulation factor 64 kDa(query 14->97)
   17::99      3e-08  33%  616 aa  CSTFT_HUMAN RecName: Full=Cleavage stimulation factor 64 kDa(query 14->97)
    2::77      2e-05  30%  105 aa  RBPF_ANASP RecName: Full=Putative RNA-binding protein rbpF;(query 101->177)
   26::105     2e-06  26%  148 aa  IST3_YEAST RecName: Full=U2 snRNP component IST3;AltName: Full=U2(query 8->87)
    8::84      4e-08  35%  172 aa  CIRBP_RAT RecName: Full=Cold-inducible RNA-binding(query 102->179)
    8::84      4e-08  35%  172 aa  CIRBP_MOUSE RecName: Full=Cold-inducible RNA-binding(query 102->179)
    8::84      4e-08  35%  172 aa  CIRBP_CRIGR RecName: Full=Cold-inducible RNA-binding(query 102->179)
    7::81      2e-07  33%  163 aa  CIRBP_XENLA RecName: Full=Cold-inducible RNA-binding protein;    (query 102->177)
    8::84      6e-08  35%  172 aa  CIRBP_PONAB RecName: Full=Cold-inducible RNA-binding(query 102->179)
    8::84      6e-08  35%  172 aa  CIRBP_HUMAN RecName: Full=Cold-inducible RNA-binding(query 102->179)
   11::65      3e-04  40%  142 aa  GRP1_SORBI RecName: Full=Glycine-rich RNA-binding protein 1;Flags:(query 37->91)
  180::238     1e-04  37%  256 aa  EIF3G_CAEEL RecName: Full=Eukaryotic translation initiation factor(query 104->163)
  153::213     4e-05  36%  233 aa  EIF3G_DICDI RecName: Full=Eukaryotic translation initiation factor(query 14->75)
   20::95      2e-05  28%  296 aa  RNA15_YEAST RecName: Full=mRNA 3'-end-processing protein RNA15;(query 15->90)
  119::189     3e-04  34%  593 aa  LARP7_XENTR RecName: Full=La-related protein 7;AltName: Full=La(query 93->163)
  374::460     2e-06  28%  474 aa  RBM42_RAT RecName: Full=RNA-binding protein 42;AltName:(query 12->98)
  374::460     2e-06  28%  474 aa  RBM42_MOUSE RecName: Full=RNA-binding protein 42;AltName:(query 12->98)
  380::466     2e-06  28%  480 aa  RBM42_HUMAN RecName: Full=RNA-binding protein 42;AltName:(query 12->98)
  348::434     2e-06  28%  448 aa  RBM42_BOVIN RecName: Full=RNA-binding protein 42;AltName:(query 12->98)
   27::109     1e-05  30%  257 aa  NCBP2_ARATH RecName: Full=Nuclear cap-binding protein subunit(query 93->176)
   18::103     8e-05  29%  152 aa  NCBP2_IXOSC RecName: Full=Nuclear cap-binding protein subunit(query 90->176)
   10::86      8e-07  29%  217 aa  ZCRB1_HUMAN RecName: Full=Zinc finger CCHC-type and RNA-binding(query 13->89)
   10::86      8e-07  29%  217 aa  ZCRB1_BOVIN RecName: Full=Zinc finger CCHC-type and RNA-binding(query 13->89)
  295::364     1e-06  34%  392 aa  RBM42_XENTR RecName: Full=RNA-binding protein 42;AltName:(query 102->172)
    2::107     1e-06  27%  363 aa  CTF1_SCHPO RecName: Full=Cleavage and termination factor(query 95->199)
   75::147     6e-05  27%  174 aa  RBM8A_DANRE RecName: Full=RNA-binding protein 8A;AltName:(query 15->87)
   10::86      1e-06  32%  218 aa  ZCRB1_XENLA RecName: Full=Zinc finger CCHC-type and RNA-binding(query 100->177)
   75::147     1e-04  26%  175 aa  RBM8A_SALSA RecName: Full=RNA-binding protein 8A;AltName:(query 15->87)
  302::388     2e-06  26%  402 aa  RBM42_DANRE RecName: Full=RNA-binding protein 42;AltName:(query 12->98)
   10::86      2e-06  29%  217 aa  ZCRB1_RAT RecName: Full=Zinc finger CCHC-type and RNA-binding(query 13->89)
   10::86      2e-06  29%  217 aa  ZCRB1_MOUSE RecName: Full=Zinc finger CCHC-type and RNA-binding(query 13->89)
   75::147     4e-04  27%  174 aa  RBM8A_XENTR RecName: Full=RNA-binding protein 8A;AltName:(query 15->87)
  241::320     4e-05  24%  403 aa  NOP13_YEAST RecName: Full=Nucleolar protein 13;(query 15->94)
   47::107     3e-05  34%  296 aa  MK67I_BOVIN RecName: Full=MKI67 FHA domain-interacting nucleolar(query 15->75)
   75::147     5e-04  26%  174 aa  RB8AB_XENLA RecName: Full=RNA-binding protein 8A-B;AltName:(query 15->87)
   75::147     5e-04  26%  174 aa  RB8AA_XENLA RecName: Full=RNA-binding protein 8A-A;AltName:(query 15->87)
  219::288     2e-04  34%  303 aa  EIF3G_MAGGR RecName: Full=Eukaryotic translation initiation factor(query 9->81)
   75::147     8e-05  27%  174 aa  RBM8A_RAT RecName: Full=RNA-binding protein 8A;AltName:(query 15->87)
   75::147     8e-05  27%  174 aa  RBM8A_MOUSE RecName: Full=RNA-binding protein 8A;AltName:(query 15->87)
   75::147     8e-05  27%  174 aa  RBM8A_HUMAN RecName: Full=RNA-binding protein 8A;AltName:(query 15->87)
   75::147     8e-05  27%  174 aa  RBM8A_BOVIN RecName: Full=RNA-binding protein 8A;AltName:(query 15->87)
   33::115     8e-05  31%  156 aa  NCBP2_RAT RecName: Full=Nuclear cap-binding protein subunit(query 93->176)
   33::115     8e-05  31%  156 aa  NCBP2_MOUSE RecName: Full=Nuclear cap-binding protein subunit(query 93->176)
   33::115     8e-05  31%  156 aa  NCBP2_HUMAN RecName: Full=Nuclear cap-binding protein subunit(query 93->176)
   33::115     8e-05  31%  156 aa  NCBP2_BOVIN RecName: Full=Nuclear cap-binding protein subunit(query 93->176)
   43::103     8e-04  30%  276 aa  MK67I_XENTR RecName: Full=MKI67 FHA domain-interacting nucleolar(query 15->75)
  193::260     1e-04  34%  279 aa  EIF3G_CANAL RecName: Full=Eukaryotic translation initiation factor(query 9->75)
  183::252     4e-04  31%  271 aa  EIF3G_ANOGA RecName: Full=Eukaryotic translation initiation factor(query 94->164)
  292::378     4e-06  28%  392 aa  RBM42_XENLA RecName: Full=RNA-binding protein 42;AltName:(query 12->98)
  121::191     6e-05  34%  281 aa  TRA2A_MOUSE RecName: Full=Transformer-2 protein homolog alpha;     (query 17->87)
  123::193     6e-05  34%  282 aa  TRA2A_HUMAN RecName: Full=Transformer-2 protein homolog alpha;     (query 17->87)
  197::256     2e-04  33%  281 aa  EIF3G_PHANO RecName: Full=Eukaryotic translation initiation factor(query 8->67)
  184::251     3e-05  34%  271 aa  EIF3G_PICST RecName: Full=Eukaryotic translation initiation factor(query 9->75)
   42::87      6e-04  39%  295 aa  DAZL_MACFA RecName: Full=Deleted in azoospermia-like;AltName:(query 102->149)
   42::87      6e-04  39%  295 aa  DAZL_HUMAN RecName: Full=Deleted in azoospermia-like;AltName:(query 102->149)
   20::109     2e-04  26%  159 aa  NCBP2_AEDAE RecName: Full=Nuclear cap-binding protein subunit(query 88->176)
  223::292     3e-05  36%  310 aa  EIF3G_XENTR RecName: Full=Eukaryotic translation initiation factor(query 94->164)
  233::302     3e-05  36%  320 aa  EIF3G_RAT RecName: Full=Eukaryotic translation initiation factor 3(query 94->164)
  233::302     3e-05  36%  320 aa  EIF3G_MOUSE RecName: Full=Eukaryotic translation initiation factor(query 94->164)
  233::302     3e-05  36%  320 aa  EIF3G_HUMAN RecName: Full=Eukaryotic translation initiation factor(query 94->164)
  233::302     3e-05  36%  320 aa  EIF3G_BOVIN RecName: Full=Eukaryotic translation initiation factor(query 94->164)
  221::290     3e-05  36%  308 aa  EI3GB_XENLA RecName: Full=Eukaryotic translation initiation factor(query 94->164)
  221::290     3e-05  36%  308 aa  EI3GA_XENLA RecName: Full=Eukaryotic translation initiation factor(query 94->164)
   42::87      6e-04  39%  298 aa  DAZL_MOUSE RecName: Full=Deleted in azoospermia-like;AltName:(query 102->149)
   42::87      8e-04  39%  296 aa  DAZL_CALJA RecName: Full=Deleted in azoospermia-like;AltName:(query 102->149)
   35::81      1e-04  45%  286 aa  DAZLA_XENLA RecName: Full=Deleted in azoospermia-like-A;       (query 102->150)
  276::339     4e-05  36% 1029 aa  SR140_MOUSE RecName: Full=U2-associated protein SR140;AltName:(query 15->75)
   40::107     8e-04  26%  293 aa  MK67I_HUMAN RecName: Full=MKI67 FHA domain-interacting nucleolar(query 8->75)
  203::262     2e-04  35%  288 aa  EIF3G_SCLS1 RecName: Full=Eukaryotic translation initiation factor(query 8->67)
  212::271     2e-04  35%  297 aa  EIF3G_NEUCR RecName: Full=Eukaryotic translation initiation factor(query 8->67)
  218::288     1e-04  34%  303 aa  EIF3G_CHAGB RecName: Full=Eukaryotic translation initiation factor(query 8->81)
  203::262     2e-04  35%  288 aa  EIF3G_BOTFB RecName: Full=Eukaryotic translation initiation factor(query 8->67)
   35::81      1e-04  45%  286 aa  DAZLB_XENLA RecName: Full=Deleted in azoospermia-like-B;       (query 102->150)
   20::101     5e-04  31%  154 aa  NCBP2_BOMMO RecName: Full=Nuclear cap-binding protein subunit(query 90->172)
   24::113     6e-05  33%  163 aa  NCBP2_ANOGA RecName: Full=Nuclear cap-binding protein subunit(query 88->176)
  206::275     2e-05  36%  293 aa  EIF3G_DANRE RecName: Full=Eukaryotic translation initiation factor(query 94->164)
  122::192     1e-04  32%  288 aa  TRA2B_RAT RecName: Full=Transformer-2 protein homolog beta;        (query 17->87)
  122::192     1e-04  32%  288 aa  TRA2B_MOUSE RecName: Full=Transformer-2 protein homolog beta;      (query 17->87)
  122::192     1e-04  32%  288 aa  TRA2B_HUMAN RecName: Full=Transformer-2 protein homolog beta;      (query 17->87)
  122::192     1e-04  32%  288 aa  TRA2B_BOVIN RecName: Full=Transformer-2 protein homolog beta;      (query 17->87)
  275::338     4e-05  36% 1028 aa  SR140_PONAB RecName: Full=U2-associated protein SR140;AltName:(query 15->75)
  276::339     4e-05  36% 1029 aa  SR140_HUMAN RecName: Full=U2-associated protein SR140;AltName:(query 15->75)
   36::86      5e-04  37%  158 aa  HNRPC_RAT RecName: Full=Heterogeneous nuclear ribonucleoprotein(query 15->65)
  205::264     2e-04  35%  290 aa  EIF3G_NEOFI RecName: Full=Eukaryotic translation initiation factor(query 8->67)
  205::264     2e-04  35%  290 aa  EIF3G_ASPFU RecName: Full=Eukaryotic translation initiation factor(query 8->67)
  205::264     2e-04  35%  290 aa  EIF3G_ASPFC RecName: Full=Eukaryotic translation initiation factor(query 8->67)
  101::184     2e-04  32%  374 aa  FOX1C_MOUSE RecName: Full=Fox-1 homolog C;(query 102->188)
  101::184     2e-04  32%  350 aa  FOX1C_HUMAN RecName: Full=Fox-1 homolog C;(query 102->188)
  204::263     4e-04  33%  289 aa  EIF3G_EMENI RecName: Full=Eukaryotic translation initiation factor(query 8->67)
  183::258     2e-04  31%  276 aa  EIF3G_DEBHA RecName: Full=Eukaryotic translation initiation factor(query 1->75)
  203::262     6e-04  33%  288 aa  EIF3G_COCIM RecName: Full=Eukaryotic translation initiation factor(query 8->67)
  203::262     4e-04  33%  288 aa  EIF3G_ASPNC RecName: Full=Eukaryotic translation initiation factor(query 8->67)
  205::264     2e-04  33%  290 aa  EIF3G_ASPCL RecName: Full=Eukaryotic translation initiation factor(query 8->67)
   56::127     3e-04  31%  166 aa  PAB2_SCHPO RecName: Full=Polyadenylate-binding protein 2;       (query 14->86)
   49::101     2e-04  32%  317 aa  MK67I_MOUSE RecName: Full=MKI67 FHA domain-interacting nucleolar(query 15->67)
  186::254     1e-04  31%  274 aa  EIF3G_PICGU RecName: Full=Eukaryotic translation initiation factor(query 8->75)
  202::261     4e-04  33%  287 aa  EIF3G_ASPOR RecName: Full=Eukaryotic translation initiation factor(query 8->67)
  212::283     2e-04  32%  287 aa  EIF3G_BRUMA RecName: Full=Eukaryotic translation initiation factor(query 104->176)
   11::86      6e-04  25%  262 aa  FUSIP_MOUSE RecName: Full=FUS-interacting serine-arginine-rich(query 101->177)
   11::86      6e-04  25%  262 aa  FUSIP_HUMAN RecName: Full=FUS-interacting serine-arginine-rich(query 101->177)
  166::236     3e-04  27%  309 aa  RNPS1_XENTR RecName: Full=RNA-binding protein with serine-rich(query 15->84)
  140::210     3e-04  27%  283 aa  RNP1B_XENLA RecName: Full=RNA-binding protein with serine-rich(query 15->84)
  140::210     3e-04  27%  283 aa  RNP1A_XENLA RecName: Full=RNA-binding protein with serine-rich(query 15->84)
  201::260     5e-04  33%  286 aa  EIF3G_ASPTN RecName: Full=Eukaryotic translation initiation factor(query 8->67)
   36::131     8e-04  27%  424 aa  CELF4_XENTR RecName: Full=CUG-BP- and ETR-3-like factor 4;       (query 3->94)
  163::233     8e-04  24%  305 aa  RNPS1_RAT RecName: Full=RNA-binding protein with serine-rich domain(query 15->84)
  163::233     8e-04  24%  305 aa  RNPS1_PONAB RecName: Full=RNA-binding protein with serine-rich(query 15->84)
  163::233     8e-04  24%  305 aa  RNPS1_MOUSE RecName: Full=RNA-binding protein with serine-rich(query 15->84)
  163::233     8e-04  24%  305 aa  RNPS1_MACFA RecName: Full=RNA-binding protein with serine-rich(query 15->84)
  163::233     8e-04  24%  305 aa  RNPS1_HUMAN RecName: Full=RNA-binding protein with serine-rich(query 15->84)
  163::233     8e-04  24%  305 aa  RNPS1_BOVIN RecName: Full=RNA-binding protein with serine-rich(query 15->84)
  121::196     8e-04  34%  373 aa  FOX1A_DANRE RecName: Full=Fox-1 homolog A;AltName:(query 102->180)
    1::388

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSAGPIVERNQDATIYVGGLDEKVSESILWELMVQAGPVVSVNMPKDRVTANHQGFGFVEFMGEEDADYA
SF3B4_CAEEL     MSAGPIVERNQDATIYVGGLDEKVSESILWELMVQAGPVVSVNMPKDRVTANHQGFGFVEFMGEEDADYA
SF3B4_RAT       MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYA
SF3B4_MOUSE     MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYA
SF3B4_HUMAN     MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYA
SAP49_SCHPO     -------DRNQDATIYLGNLDEKVTDSILFELCLQAGPVVNIHIPRDRVRNSHNGFGFCEFLHEQDVEYA
SF3B4_DICDI     -------ERNHEACLLIRDLDPMVTESLLMELFIQAAPVVKVFIPKDKLTQQHSGRAYVEFQSSSDAEYA
HSH49_YEAST     -------------TVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYA
PABP4_HUMAN     ------------ASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERA
PABP2_ARATH     -----------NTSLYVGDLDFNVTDSQLFDAFGQMGTVVTVRVCRDLVTRRSLGYGYVNFTNPQDAARA
PABP1_HUMAN     ------------ASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERA
PABP1_BOVIN     ------------ASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERA
PABP_SCHPO      ------------ASLYVGELDPSVTEAMLFELFNSIGPVASIRVCRDAVTRRSLGYAYVNFHNMEDGEKA
PABP1_RAT       ------------ASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERA
PABP1_PONAB     ------------ASLYVGDLHPDATEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERA
PABP1_MOUSE     ------------ASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERA
PABPB_XENLA     ------------ASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERA
PABPA_XENLA     ------------ASLYVGDLHQDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERA
PABP3_HUMAN     ------------ASLYVGDLHPDVTEAMLYEKFSPAGPILSIRICRDLITSGSSNYAYVNFQHTKDAEHA
PABP_YARLI      -------DQGDNASLYVGELDPSVTEAMLFEIFNPIGPVTSVRVCRDAITRRSLGYAYVNFHNQADGIRA
PABP_NEOFI      -SATPSANQPHSASLYVGELDPSVTEAMLYELFSSIGQVASIRVCRDAVTRRSLGYAYVNYNNTADGERA
PABP_DROME      ------------ASLYVGDLPQDVNESGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERA
PAB4L_HUMAN     ------------ASLYVGDLHADVTEDLLFRKFSTVGPVLSIRICRDQVTRRSLGYAYVNFLQLADAQKA
EPAB_XENTR      ------------ASLYVGDLHPDVTEAMLYEKFSPAGPIMSIRVCRDIATRRSLGYAYINFQQPADAERA
PABP_ASPNC      ----PAANQPHSASLYVGELDPSVTEAMLYELFSSIGQVASIRVCRDAVTRRSLGYAYVNYNNTADGERA
EPABB_XENLA     ------------ASLYIGDLHPDVTEAMLYEKFSPAGPIMSIRVCRDIATRRSLGYAYINFQQPADAERA
PABP_CRYNE      ------------ASLYVGELDPSVTEAMLFEIFNMIGPVASIRVCRDAVTRRSLGYAYVNYLNAADGERA
PABP_ASPOR      -TTAPNASQPHSASLYVGELDPSVTEAMLYELFSSIGQVASIRVCRDAVTRRSLGYAYVNYNNTADGERA
PABP_PHANO      ------------ASLYVGELDPSVTEAMLFELFSSIGQVASIRVCRDAVTRRSLGYAYVNYNSSEDGEKA
PABP_LODEL      ------------ASLYVGELNPSVNEATLFEIFSPIGQVASIRVCRDAVSKKSLGYAYVNYHKLEDGEKA
EPABA_XENLA     ------------ASLYIGDLHPDVTEAMLYEKFSPAGPIMSIRVCRDIATRRSLSYAYINFQQPADAERA
PABP_ASPTN      ------------ASLYVGELDPSVTEAMLYELFSSIGQVASIRVCRDAVTRRSLGYAYVNYNNTADGERA
PABP_ASPCL      ------------ASLYVGELDPSVTEAMLYELFSSIGQVASIRVCRDAVTRRSLGYAYVNYNNTADGERA
PAP1L_HUMAN     ------------ASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDVATRRSLGYAYINFQQPADAERA
PABP3_ARATH     -------QTHPNSSLYAGDLDPKVTEAHLFDLFKHVANVVSVRVCRDQ-NRRSLGYAYINFSNPNDAYRA
PABP5_ARATH     ------LQTHPNSSLYVGDLDPSVNESHLLDLFNQVAPVHNLRVCRD-LTHRSLGYAYVNFANPEDASRA
PABP_NEUCR      --------------LYVGELDPSVTEAMLFELFSQIGSVASIRVCRDAVTRRSLGYAYVNYNTTADGEKA
PABP_ASPFU      --------------LYVGELDPSVTEAMLYELFSSIGQVASIRVCRDAVTRRSLGYAYVNYNNTADGERA
PAP1M_HUMAN     ------------ASLYVGDLHPEVTEAMLYEKFSPAGPILSIRICRDKITRRSLGYAYVNYQQPVDAKRA
PABP_MAGGR      --------------LYVGELDPSVTEAMLFELFSQIGSVASIRVCRDAVTRRSLGYAYVNYNTTADGEKA
PABP_EMENI      ------------ASLYVGELDPSVTEAMLYELFSSIGQVASIRVCRDAVTRRSLGYAYVNYNDTAHGERA
PABP_CHAGB      --------------LYVGELDPSVTEAMLFELFSQIGSVASIRVCRDTITRRSLGYAYVNYNSTSDGEKA
PABP_YEAST      --------------LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKA
PAP1B_DICDI     ---------HQLTSLYVGDLAADVNEIILNELFSKVGAIASIHVCRDSNTLRSLGYAYVNFFNNHDAERA
PABP_ASHGO      -SETPKVETS-GASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKA
PABP_DEBHA      ------------ASLYVGELNPSVNEALLFEIFSPIGQVASIRVCRDAVTKKSLGYAYVNFHKFEDGEKA
PABP_CANGA      -------EENQSETVYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTA
PABP_USTMA      -----------NTSLYVGELDPSVTEAMLFEIFSMIGTVASIRVCRDAVTRRSLGYAYVNFLNAADGERA
PABP_KLULA      --------------LYVGELDPNITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGKKA
PAP1A_DICDI     ------------SSLYVGDLLPEVSEQHLFEIFNQVGLVSNIRVCRDTNTRRSLSYAYVNYYNGADAERA
PABP5_PONPY     ----------------VGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLGYGYVNFRFPADAEWA
PABP5_PANTR     ----------------VGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLGYGYVNFRFPADAEWA
PABP5_MACMU     ----------------VGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLGYGYVNFRFPADAEWA
PABP5_HYLLA     ----------------VGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLGYGYVNFRFPADAEWA
PABP5_HUMAN     ----------------VGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLGYGYVNFRFPADAEWA
PABP5_GORGO     ----------------VGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLGYGYVNFRFPADAEWA
TIAR_HUMAN      ----------QPRTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTS--NDPYCFVEFYEHRDAAAA
PABP_PICST      ------------ASLYVGELNTSVNEATLFEIFSPIGQVSSIRVCRDAVSKKSLGYAYVNYHKMEDGEKA
TIAR_MOUSE      ----------QPRTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMPDSRRVNSSVGFSFVEFYEHRDAAAA
PABP_CANAL      ------------ASLYVGELNPSVNEATLFEIFSPIGQVSSIRVCRDAVSKKSLGYAYVNYHKYEDGEKA
PABP_PICGU      --------------LYVGELNPSVNEALLFEIFSPIGQVSSIRVCRDAVTKKSLGYAYVNFHKHADGSRA
ROC1_NICSY      -----------DLKIFVGNLPFSADSAALAELFERAGNVEMVEVIYDKLTGRSRGFGFVTMSSKEEVEAA
ROC3_ARATH      -------EPSEEAKLFVGNLAYDVNSQALAMLFEQAGTVEIAEVIYNRETDQSRGFGFVTMSSVDEAETA
ROC3_NICSY      -------EPSEDAKLFVGNLPYDIDSEGLAQLFQQAGVVEIAEVIYNRETDRSRGFGFVTMSTVEEADKA
ROC1_SPIOL      -------EPPEEAKLFVGNLPYDVDSEKLAGIFDAAGVVEIAEVIYNRETDRSRGFGFVTMSTVEEAEKA
PUB1_YEAST      -----------DRVLYVGNLDKAITEDILKQYFQVGGPI-AXXXXXXXXXXXXXXYAFVEYHQSHDANIA
ROC1_NICPL      -----------DLKIFVGNLLFSADSAALAELFERAGNVEMVEVIYDKLTGRSRGFGFVTMSSKEEVEAA
ROC2_NICSY      ---------SEDLKLFVGNLPFSVDSAALAGLFERAGNVEMVEVIYDKLTGRSRGFGFVTMSTKEEVEAA
PABP_COCIM      ----PALRKTGQGNVFIKNLDTAIDNKALHDTFAAFGNILSCKVAQDEF-GNSKGYGFVHYETAEAAQNA
ELAV2_PONAB     --------------LIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKA
ELAV2_HUMAN     --------------LIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKA
PUF68_DROME     --------------VYVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPEGAQLA
TIA1_MOUSE      ------MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMD--TAGNDPYCFVEFHEHRHXXXX
TIA1_HUMAN      ------MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMD--TAGNDPYCFVEFHEHRHXXXX
ELAV2_RAT       -------------------LPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKA
ROC2_NICPL      ---------SEDLKLFVGNLPFSVDSAALAGLFERAGNVEIVEVIYDKLSGRSRGFGFVTMSTKEEVEAA
ROC1_ARATH      -----------DLKLFVGNLPFNVDSAQLAQLFESAGNVEMVEVIYDKITGRSRGFGFVTMSSVSEVEAA
PABPX_ARATH     ---------------YVGDLHPSVTEGILYDAFAEFKSLTSVRLCKDASSGRSLCYGYANFLSRQDANLA
ELAV2_MOUSE     --------------LIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKA
ROC5_NICSY      --------------LYVGNLPFSMTSSQLSEIFAEAGTVANVEIVYDRVTDRSRGFAFVTMGSVEEAKEA
RBM7_MOUSE      -----------DRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDK-DGKLKQFAFVNFKHEVSVPYA
ELAV3_MOUSE     --------------LIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKA
RBM7_HUMAN      -----------DRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDK-DGKPKQFAFVNFKHEVSVPYA
ELAV3_HUMAN     --------------LIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKA
ROC4_NICSY      --------------LFVGNLPYDVDSEGLARLFEQAGVVEIAEVIYNRDTDQSRGFGFVTMSTVEEAEKA
FCA_ARATH       -----VSDRSSTVKLFVGSVPRTATEEEIRPYFEQHGNVLEVALIKDKRTGQQQGCCFVKYATSKDADRA
ELAV1_HUMAN     --------------LIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERA
PU60B_DANRE     --------------VYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLA
YG41_SCHPO      ----------QKTTLWMGELEPWVTEAFIQQVWNTLGKAVKVKLIRNRYTGMNAGYCFVEFASPHEASSA
PUF60_RAT       --------------VYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLA
PUF60_PONAB     --------------VYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLA
PUF60_MOUSE     --------------VYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLA
PUF60_HUMAN     --------------VYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLA
PUF60_BOVIN     --------------VYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLA
HRP1_YEAST      ----------ESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEV
RBM7_BOVIN      -----------DRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDK-DGKPKQFAFVNFKHEVSVPYA
ELAV4_RAT       --------------LIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKA
ELAV4_MOUSE     --------------LIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKA
ELAV4_HUMAN     --------------LIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKA
SXL_MEGSC       ----------------VNYLPQDMQDRELYSLFRTIGPINTCRIMRDYKTGYSYGYGFVDFGSEADALRA
RBM39_PONAB     -------EERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLA
RBM39_HUMAN     -------EERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLA
RBM39_MOUSE     -------EERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSRGIAYVEFVDVSSVRLA
SXL_DROSU       -------QRSSNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRA
RBM11_HUMAN     -------QEEADRTVFVGNLEARVREEILYELFLQAGPLTKVTICKDR-EGKPKSFGFVCFKHPESVSYA
ELAV1_MOUSE     --------------LIVNYLPQNMTQEELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERA
NSR1_YEAST      ------------ATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKA
RBM23_HUMAN     -------EERDARTVFCMQLAARIRPRDLEDFFSAVGKVRDVRIISDRNSRRSKGIAYVEFCEIQSVPLA
HNRDL_MOUSE     --------QQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKV
HNRDL_HUMAN     --------QQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKV
SXL_DROME       --------RASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRA
SXL_CERCA       --------------LIVNYLPQDMTDRELYALFRTIGPINTCRIMRDYKTGYSFGYAFVDFAAETDSQRA
PABP_ENCCU      -------------TIYVGELSPKTLDSDLFRVFSNVGKVLSVKLIKRAEPVS--SFAFVTFENEEDAERA
HNRDL_CHICK     --------QQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLF---KDAASV
SXL_CHRRU       --------------LIVNYLPQDMTDRELYALFRTCGPINTCRIMKDYKTGYSFGYAFVDFASEIDAQNA
SXL_MUSDO       --------------LIVNYLPQDMTDRELYALFRTCGPINTCRIMKDYKTGYSFGYAFVDFASEIDAQNA
HNRDL_RAT       --------------MFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKV
RB87F_DROME     -----ITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNA
CELF5_XENTR     --------------LFVGQIPRNLEEKDLKPLFEQFGKIYELTVLKDRYTGMHKGCAFLTYCARDSAIKA
RA1L2_HUMAN     -SASP-KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAA
ROA1_RAT        -------EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAA
ROA1_PANTR      -------EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAA
ROA1_MOUSE      -------EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAA
ROA1_HUMAN      -------EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAA
ROA1_BOVIN      -------EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAA
RA1L3_HUMAN     -------EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAA
ROA1_XENLA      -------EPEQLRKLFIGGLSFETTDESLREHFEQWGTLTDCVVMRDPNSKRSRGFGFVTYLSTDEVDAA
RB97D_DROME     --------------LFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRA
HNRDL_XENTR     --------QQDEGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAVSVDKV
HNDLA_XENLA     --------QQDEGKMFIGGLSWDTSKKDLTEYLSRFGEVLDCTIKTDPVTGRSRGFGFVLFKDAVSVDKV
ROA3_RAT        -------EPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAA
ROA3_MOUSE      -------EPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAA
ROA3_HUMAN      -------EPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAA
RO32_XENLA      -------EPEQLRKLFIGGLSFETTDDSLREHFEQWGKLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAS
ROA1_MACMU      -------EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEKVDAA
HNRPM_RAT       ----------------------------------KVGEVTYVELLMD-AEGKSRGCAVVEFKMEESMKKA
PPIE_RHIOR      ------ITKNNKTTLYISGLDQQVNEAVLHAAFIPFGEIIAVQMATDEIDSNHRGFGFVEYELAEDCQAA
PPIE_DROME      ---------NDKRTIYVGGLADEVTERLLNNAFIPFGDIADIQMPADYESQRHRGFAFIEYEQSEDAAAA
ELAV_DROVI      --------------LIVNYLPQTMTEDEIRSLFSSVGEIESVKLIRDKSQVNPQGYGFVNYVRPQDAEQA
ELAV_DROME      --------------LIVNYLPQTMTEDEIRSLFSSVGEIESVKLIRDKSQVNPQGYGFVNYVRPQDAEQA
RO21_XENLA      -------EKEQFRKLFIGGLSFETTEESLRNYYEQWGTLTDCVVMRDPASKRSRGFGFVTFMNEVDAAMA
SHEP_DROYA      --------------LYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECA
SHEP_DROER      --------------LYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECA
ROA2_SAGOE      -------EKEQFRKLFIGGLSFQTTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAA
ROA1_DROME      -----ITEPEHMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEA
PPIE_PONAB      --------------LYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAA
PPIE_MOUSE      --------------LYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAA
PPIE_HUMAN      --------------LYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAA
PPIE_BOVIN      --------------LYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAA
HNRPD_RAT       --------QREEWKMFIGGLSWDTTKKDLKDYFSKFGDVVDCTLKLDPITGRSRGFGFVLFKESESVD--
HNRPD_MOUSE     --------QREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVD--
HNRPD_HUMAN     --------QREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVD--
HNDLB_XENLA     --------------MFIGGLSWDTSKKDLTEYLSRFGEVLDCTIKTDPVTGRSRGFGFVLFKDAVSVDKV
SHEP_DROSE      --------------LYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECA
SHEP_DROME      --------------LYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECA
ROA2_BOVIN      -------EKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAA
RO31_XENLA      -------EPEQLRKLFIGGLSFETTDDSLREHFEQWGKLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAS
RO22_XENLA      -------EKEQFRKLFIGGLSFETTEESLRNFYEQWGQLTDCVVMRDPASKRSRGFGFVTFSCMNEVDAA
RBMS2_BOVIN     --------------LYIRGLQPSTTDQDLVKLCQSYGKIVSTKAILDKTTNKCKGYGFVDFDSPSAAQKA
CELF6_MOUSE     LNPGPAVPKDHDAILFVGQIPRGLDEQDLKPLFEEFGRIYELTVLKDRLTGLHKGCAFLTYCARDSALKA
TSAP1_DANRE     -------------SLWMGNLEPYMDEDFICRAFAQMGEVVKIRLIRDKITGKNAGYGFVELADDTAVERC
CEL3B_XENLA     --------------LFIGQIPRNLDEKDLKPIFEQFGKIYELTVIKDKFTGMHKGCAFLTYCARESALKA
ROA1_SCHAM      --------------LFIGGLDYRTTDESLKQHFEQWGEIVDVVVMKDPKTKRSRGFGFITYSRAHMVDDA
RBMS2_HUMAN     --------------LYIRGLQPGTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPSAAQKA
RBM28_HUMAN     -------------TLFVGRLPPSARSEQLEELFSQVGPVKQCFVVTEKGSKACRGFGYVTFSMLEDVQRA
CEL3A_XENLA     --------------LFIGQIPRNLDEKDLKPIFEQFGKIYELTVIKDKFTGMHKGCAFLTYCARESALKA
RBY1A_MOUSE     -----MAETNQPGKIFIGGLNIKTRQKTLQEIFGRFGPVARVILMRDRETKKSRGFAFLTFRRLADAKNA
PRP24_YEAST     -----IVSHLTECTLWMTNFPPSYTQRNIRDLLQDINVVLSIRLPSLRFNTSRR-FAYIDVTSKEDARYC
CELF6_HUMAN     LNPGPAVPKDHDAILFVGQIPRGLDEQDLKPLFEEFGRIYELTVLKDRLTGLHKGCAFLTYCARDSALKA
CELF4_DANRE     -SCATIPMKDHDAILFIGQIPRNLDEKDLRPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCARESALKA
SQD_DROME       -------QRDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAID-K
YOCE_SCHPO      ---------NSNSTLFVRNLAFQTKQDDLTNFFSDVGPIKHAVVVTNPETGENRGYGFVTFSMLEDAQRA
YHKF_SCHPO      ----------EDGKMFIGGLNWETTDDSLRDYFEQFGEVLDCTVMRDSTTGRSRGFGFLTFKNPKCVNEV
ROAA_MOUSE      --------------MFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILF---KDSSSV
ROA2_RAT        --------------LFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAA
ROA2_PONAB      --------------LFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAA
ROA2_MOUSE      --------------LFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAA
ROA2_HUMAN      --------------LFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAA
RBMS2_MOUSE     --------------LYIRGLQPGTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPSSAQKA
MRD1_YARLI      MDTGSNDERPATASVFVKNLNFKTTSRVLTDAFLDGFLVAQVKMKPDSKNKGKMGFGFVEFSSKEAAEIA
CELF4_MACFA     --------------LFIGQIPRNLDEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCERESALKA
RBY1B_MOUSE     -----MAETDQPGKIFIGGLNIKTRQKTLQEIFGRFGPVARVILMRDRETKKSRGFAFLTFRRPADAKNA
CELF5_HUMAN     --------------LFVGQIPRHLDEKDLKPLFEQFGRIYELTVLKDPYTGMHKGCAFLTYCARDSAIKA
SHEP_DROWI      --------------LYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAYAENA
CEL1B_XENLA     --------------MFVGQVPRSWSEKELRELFEQYGAVYEINVLRDRSQNPPQSKGFITFYTRKAALEA
GRP2_SINAL      ----------------------------------------------------------------------
GAR2_SCHPO      ----PSQDSNETCTVFVGRLSWNVDDQWLGQEFEEYGTIVGARVIMDGQSGRSKGYGYVDFETPEXXXXX
CELF1_XENTR     --------------MFVGQVPRSWSEKELRELFEQYGAVYEINVLRDRSQNPPQSKGFITFYTRKAALEA
TSAP1_BOVIN     ------------ASLWMGDLEPYMDENFISRAFATMGEVMSVKIIRNRLTGIPAGYCFVEFADLATAEKC
ROA1_CAEEL      --------------IFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAA
NUCL_CHICK      ----------ESKTLIVNNLSYAASEETLQELFKKA---TSIKMPQNN-QGRPKGYAFVEFPTAEDAKEA
GRP1_SINAL      ----------------------------------------------------------------------
DAZP1_MOUSE     --------------LFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTV
TSAP1_HUMAN     ------------ASLWMGDLEPYMDENFISRAFATMGEVMSVKIIRNRLTGIPAGYCFVEFADLATAEKC
RRP2_SPIOL      --------------LYVGNIPRNLNNDELRTIVEEHGAIEIAEVMYDKYSGRSRRFGFVTMKTVEDANAV
DAZP1_HUMAN     --------------LFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTV
CELF1_RAT       --------------MFVGQVPRTWSEKDLRELFEQYGAVYEINILRDRSQNPPQSKGFVTFYTRKAALEA
CELF1_MOUSE     --------------MFVGQVPRTWSEKDLRELFEQYGAVYEINILRDRSQNPPQSKGFVTFYTRKAALEA
CELF1_HUMAN     --------------MFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGFVTFYTRKAALEA
CELF1_CHICK     --------------MFVGQVPRSWCEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGFVTFYTRKAALEA
DAZP1_XENLA     --------------LFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTV
SHEP_DROVI      --------------LYIRGLQQGTTDKDLINMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAYAEGA
RT19_ARATH      ----------------------------------------------------------------------
HNRPG_BOVIN     ----------------------------------------------------------------------
GRP7_ARATH      ----------------------------------------------------------------------
CELF3_DANRE     --------------LFIGQIPRNLEEKDLKPIFEQFGKIYELTVIKDKYTGMHKGCAFLTYCARESALKA
SHEP_DROGR      --------------LYIRGLQQGTTDKDLINMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAYAEGA
RBPE_ANASP      -------------SIYVGNLSYSVTQDDLTKVFSEYGSVTRVQLPTDRETGRVRGFGFVEMESSAAEDAA
RBM3_HUMAN      ----------------------------------------------------------------------
RBM28_MOUSE     -------------TLFVGRLPPSARSDQLEELFSQVGPVKQCFVVTEKGSKACRGFGYVTFSMLEDVQRA
RB27C_DROME     ------MEEDERGKLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHV
TSAP1_RAT       ------------ASLWMGDLEPYMDENFISRAFATMGEVMSVKIIRNRLTGIPAGYCFVEFADLATAEKC
TSAP1_PONAB     ------------ASLWMGDLEPYMDENFISRAFATMGEVMSVKIIRNRLTGIPAGYCFVEFADLATAEKC
SHEP_DROSI      --------------LYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTT--NKCYGFVDFEQPAFAECA
SHEP_DROMO      --------------LYIRGLQQGTTDKDLINMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAYAEGA
RBM3_MOUSE      ----------------------------------------------------------------------
CELF4_PONAB     --------------LFIGQIPRNLDEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCERESALKA
CELF4_MOUSE     --------------LFIGQIPRNLDEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCERESALKA
CELF4_HUMAN     --------------LFIGQIPRNLDEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCERESALKA
CELF3_HUMAN     --------------LFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKA
CELF3_BOVIN     --------------LFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKA
CEL1A_XENLA     --------------MFVGQVPRSWSEKELRELFEQYGAVYEINVLRDRSQNPPQSKGFITFYTRKEAQNA
TSAP1_MOUSE     ------------ASLWMGDLEPYMDENFISRAFATMGEVMSVKIIRNRLTGIPAGYCFVEFADLATAEKC
RBY1F_HUMAN     -----MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDR-TSKSRGFAFITFENPADAKNA
RBPB_ANASP      -------------SIYVGNLSYDVTEESLNAVFAEYGSVKRVQLPVDRETGRVRGFGFVEMGSDAEETAA
YHOC_SCHPO      ----------------------------------------------------------------------
RBY1E_HUMAN     -----MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDR-TSKSRGFAFITFENPADAKNA
RBY1D_HUMAN     -----MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDR-TSKSRGFAFITFENPADAKNA
RBY1B_HUMAN     -----MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDR-TSKSRGFAFITFENPADAKNA
RBY1A_HUMAN     -----MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDR-TSKSRGFAFITFENPADAKNA
HNRGT_MACFA     ----------------------------------------------------------------------
HNRGT_HUMAN     ----------------------------------------------------------------------
CELF2_RAT       --------------MFVGQIPRSWSEKELKELFEPYGAVYQINVLRDRSQNPPQSKGFVTFYTRKAALEA
CELF2_PONAB     --------------MFVGQIPRSWSEKELKELFEPYGAVYQINVLRDRSQNPPQSKGFVTFYTRKAALEA
CELF2_MOUSE     --------------MFVGQIPRSWSEKELKELFEPYGAVYQINVLRDRSQNPPQSKGFVTFYTRKAALEA
CELF2_HUMAN     --------------MFVGQIPRSWSEKELKELFEPYGAVYQINVLRDRSQNPPQSKGFVTFYTRKAALEA
U2A2A_ARATH     LSMMPIQAMTQQATVYVGGLSPTANEQSVATFFSQVMAAVGGNTPGDAVVINHEKFAFVEMRSVEEASNA
TSP1L_DANRE     ---------NRMTSLWMGDLDPYMDENFIKQAFSTMGETAGVKIITHRVTGGSAGYCFVEMADEASVDRC
ROAA_HUMAN      --------------MFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILF---KDAASV
RBMS1_BOVIN     --------------LYIRGLPPNTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDF---DSPXXX
NUCL_MESAU      -------------------------------------------------TGTNRKFGYVDFESAEDLEKA
MRD1_CANAL      --------------------------------------------PKNSGKTLSMGFGFVEFRTKEQANVA
GRP8_ARATH      ----------------------------------------------------------------------
CELF2_CHICK     ---------------FVGQIPRSWSEKELKELFEPYGAVYQINVLRDRSQNPPQSKGFVTFYTRKAALEA
RMXL3_HUMAN     ----------------------------------------------------------------------
RBMS1_RAT       --------------LYIRGLPPNTTDQDLVKLCQPYGKIVSTKAILDKATNKCKGYGFVDF---DSPXXX
RBMS1_HUMAN     --------------LYIRGLPPHTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDF---DSPXXX
NUCL_XENLA      ---------SEGLSIFIGNLNSTKEFDELKDALREFFSKKNLTIQDIRI-GNSKKFGYVDFSSEEEVEKA
NUCL_RAT        --------------LFIGNLNPNKSVA---ELKVAISELFAKNAAVDVRTGTNRKFGYVDFESAEDLEKA
CELF1_DANRE     --------------MFVGQIPRTWSEDQLRELFEPYGAVYEINVLRDRSQNPPQSKGFVTYYTRKSALEA
ROC2_ARATH      ------VERNSDLKLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAA
NUCL_MOUSE      -------------------------------------------------TGTNRKFGYVDFESAEDLEKA
NGR1_YEAST      ---------------------------------------------------HHAGYCFVEFETQKDAKFA
MRD1_NEUCR      --------------------------------------------PKKPGQVLSMGFGFVAFRTKDQAQAA
CSTF2_PONAB     ----PAVDRSL-RSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSA
CSTF2_MOUSE     ----PAVDRSL-RSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSA
CSTF2_HUMAN     ----PAVDRSL-RSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSA
CSTF2_BOVIN     ----PAVDRSL-RSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSA
CELF3_MOUSE     --------------LFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKA
CELF2_XENTR     --------------MFVGQIPRSWSEKELKDLFEPYGAVYQINVLRDRSQNPPQSKGFVTFYTRKAALEA
CELF2_XENLA     --------------MFVGQIPRSWSEKELKDLFEPYGAVYQINVLRDRSQNPPQSKGFVTFYTRKAALEA
RSD1_SCHPO      -------------TVFVSQLANRLTSRELYDFFEQAGPVRDAQIVRDKISGRSKGVAYVEFCHEDSVQAA
HNRPG_PANTR     -----MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDA
HNRPG_HUMAN     -----MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDA
ROA0_HUMAN      ------MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAA
PAB1L_HUMAN     ----------------------------------------------------------------------
NAM8_YEAST      ----PTWDKNTVRQIWASLGEANINVRMMWNNTLNNGSRSSMG-PK-----NNQGYCFVDFPSSTHAANA
MIP6_YEAST      -----ITKTSKTNSLFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKNDAESA
CELF2_DANRE     --------------MFVGQIPRSWSEKELKELFEPYGAVYQINILRDRSQNPPQSKGFVTFYTRKAALEA
U2AF2_CAEEL     --------------IFIGGLPNYLTEDQVKELLCSFGPLKAFSLNVDS-QGNSKGYAFAEYLDPTLTDQA
MSIR6_DROME     ---------NDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVD--
EIF3G_NEMVE     -------QRDETATIRVTNLSEETRESDLQELFRPLGPISRIFLAKDKFTNQSKGFAFINFVHREDAARA
SFPQ_MOUSE      ----------QRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKGK------GFGFIKLESRALAEIA
SFPQ_HUMAN      ----------QRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKGK------GFGFIKLESRALAEIA
RBPD_ANASP      -------------TIYVGNLSYRATEADLKAVFADYGEVKRVVLPTDRETGRMRGFAFVEMNEDAQEDAA
PSPC1_RAT       ----------QRCRLFVGNLPTDITEEDFKRLFERYGEPSEVFINRDR------GFGFIRLESRTLAEIA
PSPC1_MOUSE     ----------QRCRLFVGNLPTDITEEDFKRLFERYGEPSEVFINRDR------GFGFIRLESRTLAEIA
PSPC1_HUMAN     ----------QRCRLFVGNLPTDITEEDFKRLFERYGEPSEVFINRDR------GFGFIRLESRTLAEIA
PSPC1_BOVIN     ----------QRCRLFVGNLPTDITEDDFKRLFERYGEPSEVFINRDR------GFGFIRLESRTLAEIA
NUCL_PONAB      -------KKERDATLLAKNLPYKVTQDELKEVFEDAAEIRLVS--KD---GKSKGIAYIEFKTEADAEKT
NUCL_MACFA      -------KKERDATLLAKNLPYKVTQDELKEVFEDAAEIRLVS--KD---GKSKGIAYIEFKTEADAEKT
NUCL_HUMAN      -------KKERDATLLAKNLPYKVTQDELKEVFEDAAEIRLVS--KD---GKSKGIAYIEFKTEADAEKT
CELF1_PONAB     --------------MFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGFVTFYTRKAALEA
YDC1_SCHPO      ----------------------------------------------------------------------
RBMS1_MOUSE     --------------LYIRGLPPNTTDQDLVKLCQPYGKIVSTKAILDKATNKCKGYGFVDFDSP-----X
HNRPG_RAT       ----------------------------------------------------------------------
GRPA_MAIZE      ----------------------------------------------------------------------
GRP2_SORBI      ----------------------------------------------------------------------
GRP1_DAUCA      ----------------------------------------------------------------------
RMXL3_PANTR     ----------------------------------------------------------------------
A1CF_PONAB      --------------LFVGGIPKKKREEILSEMKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMA
RBMS3_PONAB     -------EQLSKTNLYIRGLPPGTTDQDLIKLCQPYGKIVSTKAILDKNTNQCKGYGFVDFDSP-----X
RBMS3_MOUSE     -------EQLSKTNLYIRGLPPGTTDQDLIKLCQPYGKIVSTKAILDKNTNQCKGYGFVDFDSP-----X
RBMS3_HUMAN     -------EQLSKTNLYIRGLPPGTTDQDLIKLCQPYGKIVSTKAILDKNTNQCKGYGFVDFDSP-----X
RBM19_HUMAN     -------------TLFIKNLNFDTTEEKLKEVFSKVGTVKSCSISKKKNKAGSMGFGFVEYRKPEQAQKA
HNRPQ_RAT       --------------LFVGSIPKKTKEQILEEFSVTEGDVILYHQPDDK--KKNRGFCFLEYEDHKTAAQA
HNRPQ_MOUSE     --------------LFVGSIPKKTKEQILEEFSVTEGDVILYHQPDDK--KKNRGFCFLEYEDHKTAAQA
HNRPG_MOUSE     -----MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEIILMKDRETNKSRGFAFVTLESPADAKDA
CSX1_SCHPO      -------------TLWMGDLEPWMDATFIQQLWASLNEPVNVKVMRSKASSSETSYCFVQFSSSAAAERA
C3H42_ARATH     ------------AYVYVGGIPFDLTEGDLLAVFSQYGEIVDVNLIRDKGTGKSKGFAFLAYEDQRSTILA
A1CF_RAT        --------------LFVGGIPKKKREEILSEMKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHXXXXXX
U2A2B_ARATH     ----PVQAMTQQATVYVGGLPPTANEQSVSTFFSQVMSAIGGNTPGDAVVINHEKFAFVEMRSVEEASNA
U2A2A_NICPL     ----PVQAMTQQATVYVGGLPPTANEQSVATFFSHVMYAIGGNTPGDAVVINHEKFAFVEMRSVEEASNA
MRD1_DICDI      ---------NNTQFVYIKNLNWKTTNETLVGKFKSLKDYVNVNIPKNPSERLPCGFGFIEFSSKQGAYEC
HNRPR_HUMAN     --------------LFVGSIPKKTKENILEEFSKVTEGLVDVHQPDDK--KKNRGFCFLEYEDHKSAAQA
HNRPQ_HUMAN     --------------LFVGSIPKKTKEQILEEFSVTEGDVILYHQPDDK--KKNRGFCFLEYEDHKTAAQA
GRP2_ARATH      ----------------------------------------------------------------------
GRP10_BRANA     ----------------------------------------------------------------------
CSTFT_MOUSE     ----------------------------------------------------------------------
CSTFT_HUMAN     ----------------------------------------------------------------------
U2AF2_MOUSE     --------------LFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQA
RBPF_ANASP      -------------SIYVGNLSYEVTQEDISNVFAEYGSVKRVVLPTDRETGRLRGFAFVEMGSDAEETAA
U2AF2_HUMAN     --------------LFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQA
U2A2A_ORYSJ     --------------VYVGGLPPTANEHTVAVYFNQVMAAVGGNTPGDAVLINHKKFAFVEMRSVEEASNA
IST3_YEAST      ----------------------------------------------------------------------
CIRBP_RAT       ---------SDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDA
CIRBP_MOUSE     ---------SDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDA
CIRBP_CRIGR     ---------SDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDA
U2A2B_WHEAT     --------------VYVGGLPPSANEQSVAIYFNQVMAAIGGNTPGDAVLINHKKFAFVEMRSVEEASNA
TADBP_PONAB     ------VQKTSD--LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKV
TADBP_HUMAN     ------VQKTSD--LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKV
PSPC1_DANRE     ----------QRCRLFVGNLPSDMADEDFKKLFFKYGDAKEVFINRDR------GFGFIRLETRTLAEIA
CIRBP_XENLA     ---------SDEGKLFIGGLNFETNEDCLEQAFTKYGRISEVVVVKDRETKRSRGFGFVTFENVDDAKDA
CIRBP_PONAB     ---------SDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDA
CIRBP_HUMAN     ---------SDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDA
SHEP_DROAN      --------------LYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTT--NKCYGFVDFEQPAFAECA
RBM18_BOVIN     ----------------------------------------------------------------------
PSPC1_CHICK     ----------QRCRLFVGNLPTDITEEDFKRLFERYGEPSEVFINRDR------GFGFIRLESRTLAEIA
NONO_RAT        ----------QRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDK------GFGFIRLETRTLAEIA
NONO_PONAB      ----------QRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDK------GFGFIRLETRTLAEIA
NONO_MOUSE      ----------QRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDK------GFGFIRLETRTLAEIA
NONO_HUMAN      ----------QRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDK------GFGFIRLETRTLAEIA
MRD1_ASHGO      --------------------------------------------PKNSDKKLSMGFGFIEFRTKEQAGAV
U2A2B_ORYSJ     --------------VYVGGLPPTANEQSVAIYFNQVMAAIGGNTPGDAVLINHKKFAFVEMRSVEEASNA
RBM19_MOUSE     -------------TLFIKNLNFSTTEETLKGVFSKVGAIKSCTISKKKNKAGSMGFGFVEYKKPEQAQKA
RBM18_PONAB     ----------------------------------------------------------------------
RBM18_MOUSE     ----------------------------------------------------------------------
RBM18_HUMAN     ----------------------------------------------------------------------
HNRPM_MOUSE     ----------------------------------KVGEVTYVELLMD-AEGKSRGCAVVEFKMEESMKKA
GRP1_SORBI      ----------------------------------------------------------------------
A1CF_MOUSE      --------------LFRGGIPKKKREEILSEMKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHXXXXXX
RBM34_HUMAN     -------------SVFVGNLPYKVEESAIEKHFLDCGSIMAVRIVRDKMTGIGKGFGYVLFENTDSVHLA
EIF3G_CAEEL     --------RSDENTCRVTNLPQEMNEDELRDLFGKIGRVIRIFIARDKVTGLPKGFAFVTFESRDDAARA
C3H25_ORYSJ     ------------AYVFVGGIPYDLTEGDLLAVFAQYGEVVDVNLVRDKGTGKSKGFAFLAYEDQRSTILA
U2A2B_NICPL     ----PIQAMTQQATVYVGGLPAHANEQSVATFFSHVMSAIGGNTPGDAVVNVYKKFAFVEMRSVEEASNA
U1SBP_XENLA     ----------------------------------------------------------------------
TADBP_XENTR     --------------LIVLGLPWKTTEQDLKDYFSTFGEVIMVQVKKDAKTGHSKGFGFVRFADYETQVKV
MRD1_SCHPO      ------IESLDTATIYVKNLNFSTKQEEFQKVFKPLEGYLSAVIPKRPGKYLSMGFGFVEFKDKASAVAA
IST3_SCHPO      ----------------------------------------------------------------------
HNRPM_HUMAN     ----------------------------------KVGEVTYVELLMD-AEGKSRGCAVVEFKMEESMKKA
EIF3G_DICDI     ----------------------------------------------------------------------
A1CF_HUMAN      --------------LFVGGIPKKKREEILSEMKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMA
RBMX2_MOUSE     -------EYKHSAWIFVGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRSTVLA
NOP12_CANGA     ----------------------------------------------------------------------
MRD1_YEAST      --------------------------------------------PKHQGKTLSMGFGFVEFRTKEQANAV
LARK_DROME      --------------LFIGNLDEKTQATELRALFEKYGTVVECDVVKN--------YGFVHMETEQQGRDA
U2A2A_WHEAT     --------------VYVGGLPPIANEQTVAVFFNQVGNTFALGHAVVNVYINHKKFAFVEMRSVEEASNA
RNP24_SCHPO     ---------------------KEVSEENIKPITTEQITRIHMPMSKEKRFQN-KGFAYVDFATEDALKLA
RNA15_YEAST     ----------------------------------------------------------------------
RBMX2_HUMAN     -------EYKDSAWIFLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRSTILA
RBM46_MOUSE     --------------LFIGAIPEKKKEEILDEMKVTEGVVDVIVYPSATDKTKNRGFAFVEYESHRAAAMA
LARP7_XENTR     ----PLGEKPQDVTVYVELLPKNVTHSWIERVFGKYGMVVYVSIPRYKSTGDPKGFAFIEFETQEQAAKA
U2AF2_SCHPO     --------------IYISNLPLNLGEDQVVELLKPFGDLLSFQLIKNIADGSSKGFCFCEFKNPSDAEVA
SGN1_YEAST      ----------------------------------------------------------------------
RBPA_SYNY3      -------------SIYVGNLSYDVSEADLTAVFAEYGSVKRVQLPTDRETGRMRGFGFVXXXXXXXXXXX
RBM4_MACFA      --------------LFIGNLPREATEQEIRSLFEQYGKVLECDIIKN--------YGFVHIEDKTAAEDA
RBM4_HUMAN      --------------LFIGNLPREATEQEIRSLFEQYGKVLECDIIKN--------YGFVHIEDKTAAEDA
RBM4_BOVIN      --------------LFIGNLPREATEQEIRSLFEQYGKVLECDIIKN--------YGFVHIEDKTAAEDA
RBM42_RAT       ----------------------------------------------------------------------
RBM42_MOUSE     ----------------------------------------------------------------------
RBM42_HUMAN     ----------------------------------------------------------------------
RBM42_BOVIN     ----------------------------------------------------------------------
RB15B_HUMAN     ----------------------------------------------------------------------
NCBP2_TAEGU     ------------STLYVGNLSFYTTEEQIQELFSKCGDVKRIVMGLDKIKKTPCGFCFVEYYTRADAEHA
NCBP2_ARATH     -------------TVYIGNVSFYTTEEQLYELFSRAGEIKKIIMGLDKNTKTPCGFCFVLFYSREDTEDA
MYEF2_HUMAN     ----------------------------------KVGEVTYVELFKD-AEGKSRGCGVVEFKDEEFVKKA
MSI1H_HUMAN     --------------MFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVD-K
U2AF2_CAEBR     --------------IFIGGLPNYLTEDQVKELLCSFGPLKAFSLNVDS-QGNSKGYAFAEYLDPTLTDQA
RBM34_RAT       -------------SVFVGNLPYRVDESALEEHFLDCGSIVAVRIVRNPLTGVGRGFGYVLFENTDAVHLA
NCBP2_IXOSC     -------------TLYVGNMSFYTTEEQIYELFSKCGDVKKVIMGLDRFHKTPCGFCFVEYYTREDAENA
NCBP2_DICDI     ---------DKSSTIYVGYLSFYTTEEQLYELFSKCGEIKRIIMGLDRNQKTPCGFCFVEYYSKEDAADC
NCBP2_CHICK     ------------STLYVGNLSFYTTEEQIQELFSKCGDVKRIVMGLDKIKKTPCGFCFVEYYTRADAEHA
MYEF2_MOUSE     ----------------------------------KVGEVTYVELFKD-AEGKSRGCGVVEFKDEEFVKKA
MSI1H_RAT       --------------MFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVD-K
MSI1H_MOUSE     --------------MFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVD-K
ZCRB1_HUMAN     ----------------------------------------------------------------------
ZCRB1_BOVIN     ----------------------------------------------------------------------
YOW4_SCHPO      ------VQIHVDTNLYVTNFPPTYDELDITKLFSAYGNVVDVRFPSLRYNTNRR-FCYVQMRKPDEAHNA
RBM18_DANRE     ----------------------------------------------------------------------
MRD1_CANGA      --------------------------------------------PKQKNKVLSMGFGFVEFRTKEQATAV
EIF3G_LODEL     --------------------------------------------------------------GAGDADAV
YDB2_SCHPO      ----------------------------------------------------------------------
RBM42_XENTR     ---------SDDFRIFCGDLGNEVNDDILARAFSRYPSFLRAKVIRDKRTGKTKGYGFVSFKDPNDYVRA
RBM34_MOUSE     -------------SVFVGNLPYKIEDSALEEHFLDCGSIVAVRIVRNPLTGVGRGFGYVLFENTDAVHLA
NCBP2_ASHGO     ------------ATIYVGNLSFYTSEEQLYELFSKCGSIEKIIMGLDRFKFTPCGFCFIIYQTPQEALAA
CTF1_SCHPO      --------------VFVGNIPYDVSEQQMTEIFNQVGPVKTFKLVLDPETGSGKGYGFCEFFDSETTAMA
RBPA_ANASP      -------------SIYVGNLSYEVTQDTLSAVFAEYGTVKRVQLPTDRETGQPRGFGFVXXXXXXXXXXX
RBM8A_DANRE     ----------------------------------------------------------------------
RBM4_RABIT      --------------LFIGNLPREATEQEIRSLFEQYGKVLECDIIKN--------YGFVHIEDKTAAEDA
RBM4_MOUSE      --------------LFIGNLPREATEQEIRSLFEQYGKVLECDIIKN--------YGFVHIEDKTAAEDA
RBM4B_RAT       --------------LFIGNLPREATEQEIRSLFEQYGKVLECDIIKN--------YGFVHIEDKTAAEDA
RBM4B_PIG       --------------LFIGNLPREATEQEIRSLFEQYGKVLECDIIKN--------YGFVHIEDKTAAEDA
RBM4B_MOUSE     --------------LFIGNLPREATEQEIRSLFEQYGKVLECDIIKN--------YGFVHIEDKTAAEDA
RBM4B_HUMAN     --------------LFIGNLPREATEQEIRSLFEQYGKVLECDIIKN--------YGFVHIEDKTAAEDA
NOP12_ASHGO     ----------------------------------------------------------------------
EIF3G_YARLI     ----------------------------------------------------------------------
DAZL_CHICK      -------------TVFVGGIDIRMNEAEIRSYFEQYGTVKEVKIITDR-TGVSKGYGFVSFLDNVDVQKI
ZCRB1_XENLA     ------------STVYVSNLPFSLTNNDLHRIFSKYGKVVKVTILKDKDSRKSKGVSFVLFLDKESAQNC
TADBP_CHICK     ------VQKTSD--LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDIKTGHSKGFGFVRFTDYETQVKV
SFRS5_RAT       ----------------------------------------------------------------------
SFRS5_HUMAN     ----------------------------------------------------------------------
RBM8A_SALSA     ----------------------------------------------------------------------
RBM46_MACFA     --------------LFIGAIPEKKKEEILDEMKVTEGVVDVIVYPSATDKTKNRGFAFVEYESHRAAAMA
RBM46_HUMAN     --------------LFIGAIPEKKKEEILDEMKVTEGVVDVIVYPSATDKTKNRGFAFVEYESHRAAAMA
RBM42_DANRE     ----------------------------------------------------------------------
RBM18_XENLA     ----------------------------------------------------------------------
PES4_YEAST      --------------LFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSLGHGYLNFXXXXXXXXX
NOP12_YARLI     -----------DYTIFVGNVSEVITDKTVYNLFAAIGTVASVRFRSSKLLPRKVAFISQQFHSKRDTVNA
NCBP2_XENLA     ----------QSCTLYVGNLSFYTTEEQIHELFSKSGDVKRIVMGLDKVKKTACGFCFVEYYTRADAEQA
MRD1_EMENI      ----------------------------------------------------------------------
EI3G1_DROYA     --------RDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAA
EI3G1_DROWI     --------RDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAA
EI3G1_DROVI     --------RDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAA
EI3G1_DROSI     --------RDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAA
EI3G1_DROSE     --------RDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAA
EI3G1_DROPS     --------RDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAA
EI3G1_DROPE     --------RDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAA
EI3G1_DROMO     --------RDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAA
EI3G1_DROME     --------RDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAA
EI3G1_DROGR     --------RDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAA
EI3G1_DROER     --------RDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAA
EI3G1_DROAN     --------RDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAA
ZCRB1_RAT       ----------------------------------------------------------------------
ZCRB1_MOUSE     ----------------------------------------------------------------------
RBM8A_XENTR     ----------------------------------------------------------------------
RBM47_CANFA     --------------LFIGGIPKKKREEILEEIAKVTEGVLDVIVYASAADKKNRGFAFVEYESHRAAAMA
NOP13_YEAST     ----------------------------------------------------------------------
NCBP2_ORYSJ     -------------TVYVGNMSFYTTEEQAYELFSRAGEIRKIIMGLDKNSKTPCGFCFILYYSREDAEDA
MK67I_BOVIN     ----------------------------------------------------------------------
LARP7_RAT       ----PLGERPKDETVYVELLPKNVTHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKA
LARP7_MOUSE     ----PLGERPKDETVYVELLPKNVTHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKA
LARP7_MACFA     ----PLGERPKDETVYVELLPKNVNHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKA
LARP7_HUMAN     ----PLGERPKDETVYVELLPKNVNHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKA
EI3G2_DROAN     -------ERDDSSAVRISNLSESMTETDLEELVKKIGPHTKMYLAREKNTGLCKGFAYVHFKFRQDAAAA
RSP31_ARATH     --------------VFVGNFEYETRQSDLERLFDKYGRVDRVDMKS--------GYAFVYFEDERDAEDA
RB8AB_XENLA     ----------------------------------------------------------------------
RB8AA_XENLA     ----------------------------------------------------------------------
NOP12_YEAST     ----------------------------------------------------------------------
NCBP2_YEAST     -------ESMKSSTIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFIIYSCPDEALNA
NCBP2_DANRE     ----------QSATLYVGNLSFYTTEEQVHELFAKCGDVKRIIIGLDKIKKTACGFCFVEYYTRADAENA
EIF3G_MAGGR     ----------------------------------------------------------------------
EI3G2_DROYA     -------ERDDSSAVRISNLSESMTEADLEELVKKIGPHTKMYLAREKNTGLCKGFAYVHFKFRQDAAAA
U2AF2_DROME     --------------IFIGGLPNYLNDDQVKELLLSFGKLRAFNLVKDAATGLSKGYAFCEYVDLSITDQS
TADBP_MOUSE     ------VQKTSD--LIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKV
RBM8A_RAT       ----------------------------------------------------------------------
RBM8A_MOUSE     ----------------------------------------------------------------------
RBM8A_HUMAN     ----------------------------------------------------------------------
RBM8A_BOVIN     ----------------------------------------------------------------------
RB15B_MOUSE     ----------------------------------------------------------------------
NOP12_KLULA     ----------------------------------------------------------------------
NCBP2_RAT       ----------KSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENA
NCBP2_MOUSE     ----------KSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENA
NCBP2_HUMAN     ----------KSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENA
NCBP2_BOVIN     ----------KSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENA
MK67I_XENTR     ----------------------------------------------------------------------
EIF3G_CANAL     ----------------------------------------------------------------------
EIF3G_ANOGA     ---GAMRGRDDTSAIRISNLSEAMTEADLEELVKKFGPHTKMFLSRDKSTGLCKGFAYVHFRSRRDAATA
SFRS5_MOUSE     ----------------------------------------------------------------------
RBM42_XENLA     ----------------------------------------------------------------------
NCBP2_XENTR     -------------TLYVGNLSFYTTEEQIHELFSKSGDVKKIVMGLDKIKKTACGFCFVEYYTRTDAEQA
NCBP2_SCHPO     ----------QSNCVYVGNLSFYTTEEQIYALFSKCGEIRRIIMGVDRFTKTPCGFCFVEYFENQDALDS
NCBP2_ESOLU     ----------QSNTLYVGNLSFYTTEEQVYELFSKSGDVKRIIIGLDKVKKTACGFCFVEYYTRADAENA
NCBP2_CAEEL     -------------TLYVGNLSYYTKEDQVYELFGRAGDVRRVIMGLDRFKKTPCGFCFVEYYTREDAELA
NCBP2_CAEBR     -------------TLYVGNLSYYTKEDQVYELFGRAGDVRRVIMGLDRFKKTPCGFCFVEYYTREDAELA
LARP7_DANRE     ----PLGETPKDVTVYVELLPKTVTHIWLERVFSKCGHVVYISIPRYKSTRHSKGFAFVEFETQEQAQKA
EI3G2_DROWI     -------ERDDSSAVRISNLSESMTEVDLEELVKKIGPHTKMYLAREKNTGLCKGFAYVHFKFRQDAAAA
ZCRB1_DANRE     ------------STVYVSNIPFSLTNSDMHKLCSKYGKVVKVTIVKDKHTRMSKGVAFVLFLDRESAYNC
TRA2A_MOUSE     ----------------------------------------------------------------------
TRA2A_HUMAN     ----------------------------------------------------------------------
RBM46_XENTR     --------------LFIGSIQEKRKEEILEEMKVTEGVMDVIVYPSATDKTKNRGFAFVMYESHRAAAMA
RBM15_HUMAN     ----------------------------------------------------------------------
PABPX_SCHPO     ----------------------------------------------------------------------
EIF3G_PHANO     ----------------------------------------------------------------------
EI3G2_DROVI     -------ERDDSSAVRISNLSESMTEDDLEELVKKIGPYTKMYLAREKNSGLCKGFAYVHFKYRKDAAEA
EI3G2_DROGR     -------ERDDSCAVRISNLSESMTEDDLEELVKKIGPFTKMYLAREKTSGLCKGFAYVHFKYRKDAAEA
EI3G2_DROER     -------DRDDSSAVRISNLSESMTEADLEELVKKIGPHTKMYLAREKNTGLCKGFAYVHFKFRQDAAAA
DAZL_XENTR      -------------TVFVGGIDITMDEMAIGNLFEKYGKVKDLKIITDR-TGVSKGYGFVSFYDEVDVQKI
BOLL_MACFA      --------------IFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVS-KGYGFVTFETQEDAQKI
BOLL_HUMAN      --------------IFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVS-KGYGFVTFETQEDAQKI
NCBP2_SALSA     ----------QANTLYVGNLSFYTTEEQVYELFSKSGDVKRIIIGLDKVKKTACGFCFVEYYTRTDAENA
NCBP2_CULQU     ------------STLYIGNLSFYTTEEQIHELFSRCGDIRRIVMGLDKFKKTPCGFCFVEYYARIDSEYA
MSI2H_MOUSE     --------------MFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVD--
MSI2H_HUMAN     --------------MFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVD--
MK67I_XENLA     ----------------------------------------------------------------------
IF2B3_HUMAN     --------------LYIGNLSENAAPSDLESIFKDA------KIPVSGPFLVKTGYAFVDCPDESWALKA
EIF3G_PICST     ----------------------------------------------------------------------
DAZL_MACFA      -------------TVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDR-TGVSKGYGFVSFFNDVDVQKI
DAZL_HUMAN      -------------TVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDR-TGVSKGYGFVSFFNDVDVQKI
YKX5_SCHPO      --------------IYVGNLPWATSDRNLLDLFTDIGSVIRARIAYEP-TGRSKGFGVVQFENENDAASS
RSP3_CAEEL      ----------------------------------------------------------------------
RBM46_DANRE     ----------------------------------------------------NRGFAFVEYESHKAAAMA
NCBP2_AEDAE     ------------STLYIGNLSFYTTEEQIHELFSRCGDIRRIVMGLDKFKKTPCGFCFVEYYARDDAESA
EIF3G_XENTR     -SMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARA
EIF3G_RAT       -SMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARA
EIF3G_MOUSE     -SMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARA
EIF3G_HUMAN     -SMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARA
EIF3G_BOVIN     -SMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARA
EI3GB_XENLA     -SMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARA
EI3GA_XENLA     -SMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARA
EI3G2_DROMO     -------ERDDSSAVRISNLSESMTEDDLEELVKKIGPHTKMYLAREKNSGLCKGFAYVHFKYRKDAAEA
DAZL_MOUSE      -------------TVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDR-TGVSKGYGFVSFYNDVDVQKI
YQL5_SCHPO      ----------------------------------------------------------------EDAEKT
MK67I_RAT       -------EKLNSGVVYLGHLPSTLSESHIYDYCAQFGDIRRFRLSRSKRTGNSRGFAFVEFESEDVAKIV
GBP2_YEAST      ---GPIVERNFENSIFVRNLTFDCTPEDLKELFGTVGEVVEADIITSK--GHHRGMGTVEFTKNESVQDA
EIF3G_CULQU     --------RDDTTAIRISNLSEAMTEADLEELVKKIGPHSKMFLARDKNTGLCKGFAYVHFKSRRDAATA
EIF3G_AEDAE     --------RDDTTAIRISNLSEAMTEADLEELVKKIGPHSKMFLARDKNTGLCKGFAYVHFKSRRDAATA
DAZL_CALJA      -------------TVFVGGIDVRMDETEIRGFFARYGSVKEVKIITDR-TGVSKGYGFVSFFNDVDVQKI
DAZLA_XENLA     -------------TVFVGGIDITMDEIEIRDFFTRFGNVKEVKIITDR-TGVSKGYGFISFSDEVDVQKI
SR140_MOUSE     ----------------------------------------------------------------------
RNPS1_DANRE     --------------LYLGRLTRNVTKDHIQEIFATYGKIKMIDMPSDRLHPNSKGYAYVEYESPEDAQKA
RBM47_PONAB     --------------LFIGGIPKKKREEILEEIAKVTEGVLDVIVYASAADKKNRGFAFVEYESHRAAAMA
RBM47_HUMAN     --------------LFIGGIPKKKREEILEEIAKVTEGVLDVIVYASAADKKNRGFAFVEYESHRAAAMA
MK67I_HUMAN     ----------------------------------------------------------------------
EIF3G_SCLS1     ----------------------------------------------------------------------
EIF3G_NEUCR     ----------------------------------------------------------------------
EIF3G_CHAGB     ----------------------------------------------------------------------
EIF3G_BOTFB     ----------------------------------------------------------------------
EIF3B_ANOGA     -------------------------KGIIEKIFKNAGTIVNVHYPKDEED-NTKGYAFVEYKNQESAEEA
EI3G2_DROSI     -------DRDDSSAVRISNLSESMTETDLEELVKKIGPHTKMYLAREKNSGLCKGFAYVHFKFRQDAAAA
EI3G2_DROSE     -------DRDDSSAVRISNLSESMTETDLEELVKKIGPHTKMYLAREKNSGLCKGFAYVHFKFRQDAAAA
EI3G2_DROME     -------DRDDSSAVRISNLSESMTETDLEELVKKIGPHTKMYLAREKNSGLCKGFAYVHFKFRQDAAAA
DAZLB_XENLA     -------------TVFVGGIDITMDEIEIRDFFTRFGNVKEVKIITDR-TGVSKGYGFISFSDEVDIQKI
BOLL_MOUSE      --------------IFVGGIDFKTNENDLRKFFSQYGSVKEVKIVNDRAGVS-KGYGFITFETQEDAQKI
TCG1_SCHPO      ----------------------------------------------------------------------
SPEN_DROME      LTANPVVEDNRPLAIRVRNLPARSSDTSLKDGLFHEGKVTWVKV----VGQNSERYALVCFKKPDDVEKA
PPIL4_CRYNE     ----------------------------------------------------------------------
NCBP2_BOMMO     ------------STLYMGNLSFYTTEEQIYELYSRCGDIRRVIMGLDKYKKTPCGFCFVEYYAREDAENC
NCBP2_ANOGA     ------------STLYVGNLSFYTTEEQIHELFSRCGDVRRIIMGLDKFKKTPCGFCFVEYYSRLDAESA
EIF3G_DANRE     -SMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKNTGQSKGFAFISFHRREDAARA
CAZ_DROME       ----------------------------------------------------------------------
NOP15_YEAST     --------------IYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKEDAMIA
NOP12_CANAL     ---------------------------------------------------------------EKPASIA
HRP65_CHITE     --------------LYIGNLTSDVTEEELKELFSPYGEISEAFINAEK------NFAFLKIDYRANAERA
EIF3B_CULQU     -------------------------QGVLEKIFKNAGTIVNIHYPKDD-EENTKGFAFIEFKNPEMAEEA
TRA2B_RAT       ----------------------------------------------------------------------
TRA2B_MOUSE     ----------------------------------------------------------------------
TRA2B_HUMAN     ----------------------------------------------------------------------
TRA2B_BOVIN     ----------------------------------------------------------------------
SR140_PONAB     ----------------------------------------------------------------------
SR140_HUMAN     ----------------------------------------------------------------------
RBM41_DANRE     --------------IFVGNLSPNTTAEEIRSLFSQYGKISECDIVKN--------FGFVHMDSKSEADEA
PM14_DROME      ----------------------------------------------------------------------
EI3G2_DROPS     ------------SAVRISNLSESMTEADLEELVKKIGPHTKLYLAREKNTGLCKGFAYVHFKFRQDAAAA
EI3G2_DROPE     ------------SAVRISNLSESMTEADLEELVKKIGPHTKLYLAREKNTGLCKGFAYVHFKFRQDAAAA
YBKC_SCHPO      ----------------------------------------------------------IEFESQDAARNA
RX21_DROME      --------------VYVGNLTDKVKKDDLEGEFTKYGKLNSV-----WIAFNPPGFAFVEFEHRDDAEKA
REXON_RAT       ------------STIYAGPFSKDCNVGSLKKVFSSLGPVQSITL----VLETYRPYFSIQYELLEAAQLA
PPIL4_ASPOR     ----------------------------------------------------------------------
NOP12_SCHPO     ----------------------------------------------------------------------
MUG28_SCHPO     ----------------------------------------------------------------------
MRD1_ASPFU      ----------------------------------------------------------------------
IF23B_XENLA     --------------LYIGNLSENVSPPDLESLFKES------KIPFTGQFLVKSGYAFVDCPDETWAMKA
HRB1_YEAST      ------VNRNYSNSIFVGNLTYDSTPEDLTEFFSQIGKVVRADIITSR--GHHRGMGTVEFTNSDDVDRA
EIF3B_AEDAE     -------------------------QGVLEKLFKTAGTIVNIHYPKDD-EENTRGYAFIEFKNPEMAEEA
DAZ4_HUMAN      -------------TVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNR-TGVSKGYGFVSFVNDVDVQKI
DAZ3_HUMAN      -------------TVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNR-TGVSKGYGFVSFVNDVDVQKI
DAZ2_HUMAN      -------------TVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNR-TGVSKGYGFVSFVNDVDVQKI
DAZ1_HUMAN      -------------TVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNR-TGVSKGYGFVSFVNDVDVQKI
YKCG_SCHPO      ---------NPSCVVYVGNIPYEMAEEQVIDIFKQSGPVKSFQLVIDPESGQPKGYGFCEYHDPATAASA
YG5B_YEAST      --------------IFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLC
RBM8A_DROME     ----------------------------------------------------------------------
NCBP2_SINCH     ----------QSHTLYVGNLSFYTTEEQVHELFSKSGDVKRIIIGLDKVKKTACGFCFVEYYTRAGAENA
MRD1_CRYNE      ------------------------------------------------------GYGFVGFXXXXXXXXX
MK67I_DANRE     ----------------------------------------------------------------------
HNRPC_RAT       ----------------------------------------------------------------------
SFRS6_HUMAN     ----------------------------------------------------------------------
PPIL4_RHIOR     ----------------------------------------------------------------------
IF23A_XENLA     --------------LYIGNLSENVSPTDLESLFKES------KIPFTGQFLVKSGYAFVDCPDETWAMKA
SFRS1_ARATH     -------------TVYVGNLPGDIREREVEDLFSKYGPVVQIDL---KVPPRPPGYAFVEFDDARDAEDA
RBM25_MOUSE     -------------TVFVGNISEKASDMLIRQLLAKCGLVLSWKRVQG-ASGKLQAFGFCEYKEPESTLRA
PABP2_DROPS     ----------------------------------------------------------------------
PABP2_DROME     ----------------------------------------------------------------------
EIF3G_NEOFI     ----------------------------------------------------------------------
EIF3G_ASPFU     ----------------------------------------------------------------------
EIF3G_ASPFC     ----------------------------------------------------------------------
DAZL_DANRE      -------------TLFVGGIDMKVDENEIREFFAKYGSVKEVKIITYR-GGICKGYGFVYF--SEDVDIQ
RU17_ARATH      -------------TLFVSRLNYESSESKIKREFESYGPIKRVHLVTDQLTNKPKGYAFIEYMHTRDMKAA
RBM45_HUMAN     ----------------------------------------------------------------------
PPIL4_NEUCR     ----------------------------------------------------------------------
PPIL4_EMENI     ----------------------------------------------------------------------
MRD1_KLULA      --------------------------------------------PKQPGKTLSMGFGFAEFKTKEQANAV
IF2B2_HUMAN     --------------LYIGNLSPAVTADDLRQLFGDR------KLPLAGQVLLKSGYAFVDYPDQNWAIRA
FOX1C_MOUSE     -------EKQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNE--RGSKGFGFVTFETSSDADRA
FOX1C_HUMAN     -------EKQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNE--RGSKGFGFVTFETSSDADRA
EIF3G_EMENI     ----------------------------------------------------------------------
EIF3G_DEBHA     ----------------------------------------------------------------------
EIF3G_COCIM     ----------------------------------------------------------------------
EIF3G_ASPNC     ----------------------------------------------------------------------
EIF3G_ASPCL     ----------------------------------------------------------------------
SRR35_HUMAN     ------------------------------------GPIVDVYIPLDFYTRRPRGFAYVQFEDVRDAEDA
RBM45_RAT       ----------------------------------------------------------------------
RBM25_HUMAN     -------------TVFVGNISEKASDMLIRQLLAKCGLVLSWKRVQG-ASGKLQAFGFCEYKEPESTLRA
PPIL4_ASPFU     ----------------------------------------------------------------------
PAB2_SCHPO      ----------------------------------------------------------------------
NOP12_DEBHA     ---------------------------------------------------------YVVFAEKEPSLKC
MK67I_MOUSE     ----------------------------------------------------------------------
EIF3G_PICGU     ----------------------------------------------------------------------
EIF3G_CAEBR     --------RSDENTCRVTNLPQEMNEDELXXXXXXXXXXXXXXXARDKITGLPKGFAFVTFESRDDAARA
EIF3G_ASPOR     ----------------------------------------------------------------------
RU17_YEAST      ----------------------------------------------------------------------
RBM45_MOUSE     ----------------------------------------------------------------------
PM14_SCHPO      ----------------------------------------------------------------------
IF2B3_DANRE     --------------LYIGNVSEQASESIFWKIPFSAPFLVK------------SGYAFVDCPDEKVAMRA
IF2B3_CHICK     --------------LYIGNLGENVSPLDLESLFKDS------KIPFSGQFLVKTGYAFVDCPDESWAMKA
IF2B2_PONAB     --------------LYIGNLSPAVTVDDLRQLFGDR------KLPLAGQVLLKSGYAFVDYPDQNWAIRA
HNRPC_XENLA     ----------------------------------------------------------------------
FOX1L_DANRE     ----------------------------------------------------------------------
EIF3G_VANPO     ----------------------------------------------------------------------
EIF3G_BRUMA     ---GGAERRSEENTCRVTNLPEECDEMELRALFGTVGTVNRVFIAKDKHTNKPKGFAFVTFEHRSQTEAA
TRA2_DICDI      ----------------VFGLAPQTEERDLKDEFSRFGKIDHVDLIMDRKTGRSKCFGFVYFENKEDAVRA
SFRS6_BOVIN     ----------------------------------------------------------------------
RU1A_SCHPO      -------------TLYIRNIEEKIRKRILEHLFGSYGKVIDVQARK---TLRMRGQAFVVFDNLENASRA
RBM38_CHICK     --------------IFVGGLPYHTTDSSLRKYFEVFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERA
PM14_CAEEL      ----------------------------------------------------------------------
MODU_DROME      -------EENNERTVVVGLIGPNITKDDLKTFFEKVAPVEAVTISSNRLMPR----AFVRLASVDDIPKA
FUSIP_MOUSE     --------RPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDA
FUSIP_HUMAN     --------RPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDA
RNPS1_XENTR     ----------------------------------------------------------------------
RNP1B_XENLA     ----------------------------------------------------------------------
RNP1A_XENLA     ----------------------------------------------------------------------
NONA_DROME      --------------LYVGNLTNDITDDELREMFKPYGEISEIFSNLDK------NFTFLKVDYHPNAEKA
EPA2B_XENLA     ----------------------------------------------------------------------
EIF3G_BOMMO     ----PPVSREDVTAIRISNLSNFAVEADIDDLVKGFGPVHKLYLAKEKSTGHCKGFAYVHFKFRADAAKA
EIF3G_ASPTN     ----------------------------------------------------------------------
EIF3B_LODEL     ----------------------------------------------------------------------
CELF4_XENTR     ----------------------------------------------------------------------
YGR4_SCHPO      --------------LFVGNLPKDSSVETLQLHFKRAGQVPSVRIPTDKTSGRQKGYAFVEFINPK-TDVI
YFH9_SCHPO      ----------------------------------------------------------------------
SNRPA_XENLA     ----------------------------------------------------------------------
SFRS4_MOUSE     ----------------------------------------------------------------------
SFRS4_HUMAN     ----------------------------------------------------------------------
RBM38_XENLA     --------------IFVGGLPYHTTDASLRKYFEVFGDIDEAVVITDRQTAKSRGYGFVTMSDRAAAERA
RALY_MOUSE      ----------------------------------------------------------------------
PPIL4_SCHPO     ----------------------------------------------------------------------
NCBP2_DROWI     ----------------------------------------------------------------------
IF2B3_MOUSE     --------------LYIGNLSDHAGPADLESVFKDAKPVAGPFLVKT-------GYAFVDCPDEGWALKA
RSP4_CAEEL      -------------SLKIDNLSYQTTPNDLRRTFERYGDIGDVHIPRDKYSRQSKGFGFVRFYERRDAEHA
RNPS1_RAT       ----------------------------------------------------------------------
RNPS1_PONAB     ----------------------------------------------------------------------
RNPS1_MOUSE     ----------------------------------------------------------------------
RNPS1_MACFA     ----------------------------------------------------------------------
RNPS1_HUMAN     ----------------------------------------------------------------------
RNPS1_BOVIN     ----------------------------------------------------------------------
RBM38_HUMAN     --------------IFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERA
RBM24_DANRE     --------------IFVGGLPYHTTDSSLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRSAADRA
PPIL4_GIBZE     ----------------------------------------------------------------------
RU17_SCHPO      -------------TMFLSRLSYDTKESDIEREFTRYGPIERIRVVRNKVTGKSMGYAFVVFERERDLKVA
RBM41_HUMAN     ----------------------------------------------------------------------
NOL8_HUMAN      ----------------------------------------------------------------------
NCBP2_DROMO     ----------------------------------------------------------------------
NCBP2_DROAN     ----------------------------------------------------------------------
FOX1A_PONAB     ----------------------------------------------------------------------
FOX1A_MOUSE     --------KSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNE--RGSKGFGFVTFENSADADRA
FOX1A_MACFA     ----------------------------------------------------------------------
FOX1A_HUMAN     ----------------------------------------------------------------------
U1SBP_HUMAN     ----------------------------------------------------------------------
SNRPA_MOUSE     ----------------------------------------------------------------------
SFRS9_RAT       --------RRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKD-------GMGMVEYLRKEDMEYA
SFRS9_MOUSE     --------RRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKD-------GMGMVEYLRKEDMEYA
RNP4F_DROME     ----------------------------------------------------------------------
PPIL4_MOUSE     ----------------------------------------------------------------------
PPIL4_HUMAN     ----------------------------------------------------------------------
NOP4_YEAST      -------------TLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKD-TNKRSRGFGFVSFAVEDDTKEA
NCBP2_DROGR     ----------------------------------------------------------------------
NCB2B_DROVI     ----------------------------------------------------------------------
MRD1_USTMA      ----------------------------------------------------------------------
MINT_MOUSE      ----------------VRSIDTSLKDGLFHEFK-KFGKVTSVQIHG----ASEERYGLVFFRQQEDQEKA
IF2B1_DANRE     --------------LYIGNLNEKVTAEDLVKTFED------YKIPYSGQFLMKTGYASVDCPDDQWAMKA
FOX1A_DANRE     --------KTQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNE--RGSKGFGFVTFESSADADRA
EPA2A_XENLA     ----------------------------------------------------------------------
EIF3G_ASHGO     ----------------------------------------------------------------------
CIP2_SCHPO      ----------------------------------------------------------------------
RBM7_BOVIN      ----------------------------------------------------------------------
RBM11_HUMAN     ----------------------------------------------------------------------
PPIE_DROME      ----------------------------------------------------------------------
PPIE_PONAB      ----------------------------------------------------------------------
PPIE_MOUSE      ----------------------------------------------------------------------
PPIE_HUMAN      ----------------------------------------------------------------------
PPIE_BOVIN      ----------------------------------------------------------------------
RBY1A_MOUSE     ----------------------------------------------------------------------
RBY1B_MOUSE     ----------------------------------------------------------------------
GRP2_SINAL      ---------------FVGGLAWATDERSLETAFSQFGELVDSKIINDRETGRSRGFGFVTFKDEKSMKDA
GRP1_SINAL      ---------------FVGGLAWATDDRALETAFSQYGEVLDSKIINDRETGRSRGFGFVTFKDEKSMKDA
RT19_ARATH      --------RYMSTKLYIGGLSPGTDEHSLKDAFSSFNGVTEARVMTNKVTGRSRGYGFVNFISEDSANSA
HNRPG_BOVIN     -----MVEADRPGKLFIGGLNLETDEKSLEATFGKYGRISEVLLMKDRETNKSRGFAFITFESPADAKAA
GRP7_ARATH      ---------------FVGGLAWATDDRALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDA
RBPE_ANASP      ----------------------------------------------------------------------
RBM3_HUMAN      ---------SEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVA
RBM3_MOUSE      ---------SEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASDA
RBY1F_HUMAN     ----------------------------------------------------------------------
RBPB_ANASP      ----------------------------------------------------------------------
YHOC_SCHPO      ------------ATVHVGNLAPSVTESLLYNAFIPFGEIISVALHR-KEKAVDRSYAFVEFDEPEDAKEA
RBY1E_HUMAN     ----------------------------------------------------------------------
RBY1D_HUMAN     ----------------------------------------------------------------------
RBY1B_HUMAN     ----------------------------------------------------------------------
RBY1A_HUMAN     ----------------------------------------------------------------------
HNRGT_MACFA     -----MVEADRPGKLFIGGLNLETDEKALEAEFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPANAKAA
HNRGT_HUMAN     -----MVEADRPGKLFIGGLNLETDEKALEAEFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKAA
GRP8_ARATH      ---------------FVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDA
RMXL3_HUMAN     -----MMEADRPEKLFIGGLNLKTDEKALKAEFGKYGHIIKVFLMKDRKTNKSRGFAFVTFESPADAKAA
CSTF2_PONAB     ----------------------------------------------------------------------
CSTF2_MOUSE     ----------------------------------------------------------------------
CSTF2_HUMAN     ----------------------------------------------------------------------
CSTF2_BOVIN     ----------------------------------------------------------------------
HNRPG_PANTR     ----------------------------------------------------------------------
HNRPG_HUMAN     ----------------------------------------------------------------------
EIF3G_NEMVE     ----------------------------------------------------------------------
RBPD_ANASP      ----------------------------------------------------------------------
HNRPG_RAT       -----MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEILLMKDRETNKSRGFAFVTFESPADAKDV
GRPA_MAIZE      ---------------FVGGLAWATSNESLENAFASYGEILDSKVITDRETGRSRGFGFVTFSSENSMLDA
GRP2_SORBI      ---------------FVGGLAWATNNETLEQAFANFGQVIDSKVITDRETGRSRGFGFVTFSSEQSMLDA
GRP1_DAUCA      ---------------FVGGLAWATNDESLEQAFSQFGDITDSKIINDRETGRSRGFGFVTFKDEKSMRDA
RMXL3_PANTR     -----MMEADRPEKLFVGGLNLKTDEKALKAEFGKYGHIIKVFLIKDRKTNKSRGFAFVTFESPADAKAA
HNRPG_MOUSE     ----------------------------------------------------------------------
GRP2_ARATH      --------RLMSTKLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAA
GRP10_BRANA     ---------------FVGGLAWATGDAELERTFSQFGEVIDSKIINDRETGRSRGFGFVTFKDEKSMKDA
CSTFT_MOUSE     -------------SVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQETALSA
CSTFT_HUMAN     -------------SVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQETALSA
RBPF_ANASP      ----------------------------------------------------------------------
IST3_YEAST      -------EYKDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILA
CIRBP_RAT       ----------------------------------------------------------------------
CIRBP_MOUSE     ----------------------------------------------------------------------
CIRBP_CRIGR     ----------------------------------------------------------------------
CIRBP_XENLA     ----------------------------------------------------------------------
CIRBP_PONAB     ----------------------------------------------------------------------
CIRBP_HUMAN     ----------------------------------------------------------------------
GRP1_SORBI      ------------------------------------GEVLESKIILDRETQRSRGFGFVTFSTEEAMRSA
EIF3G_CAEEL     ----------------------------------------------------------------------
EIF3G_DICDI     -------------SIMVSNLSQNATEKDLYELFGQFGPVSRVSIPKS-MEGSSKGFAYVTYNHLDSAEKA
RNA15_YEAST     --------------VYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASA
LARP7_XENTR     ----------------------------------------------------------------------
RBM42_RAT       -----------DFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRA
RBM42_MOUSE     -----------DFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRA
RBM42_HUMAN     -----------DFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRA
RBM42_BOVIN     -----------DFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRA
NCBP2_ARATH     ----------------------------------------------------------------------
NCBP2_IXOSC     ----------------------------------------------------------------------
ZCRB1_HUMAN     ------------STVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNC
ZCRB1_BOVIN     ------------STVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRRSKGVAFILFLDKDSAQNC
RBM42_XENTR     ----------------------------------------------------------------------
CTF1_SCHPO      ----------------------------------------------------------------------
RBM8A_DANRE     --------------LFVTGVHEEATEEDVHDKFAEFGEIKNLHLNLDRRTGYLKGYALVEYETYKEAQAA
ZCRB1_XENLA     ----------------------------------------------------------------------
RBM8A_SALSA     --------------LFVTGVHEEATEEDIHDKFAEFGEIKNLHLNLDRRTGYLKGYALVEYETYKEAQAA
RBM42_DANRE     -----------DFRIFCGDLGNEVNDDILARAFSRYPSFLKAKVVRDKRTGKTKGYGFVSFKDPNDYVRA
ZCRB1_RAT       ------------STVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSALNC
ZCRB1_MOUSE     ------------STVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSALNC
RBM8A_XENTR     --------------LFVTGVHEEATEEDIHDKFGEFGEIKNIHLNLDRRTGFLKGYALVEYETYKEALAA
NOP13_YEAST     --------------LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNE
MK67I_BOVIN     --------------IYVGHLPPTLYETQIRAYFSQFGTVTRFRLSRSKKTGNSKGYGFVEFESEDVAKIA
RB8AB_XENLA     --------------LFVTGVHEEATEEDIHDKFGEFGEIKNIHLNLDRRTGFLKGYALVEYETYKEALAA
RB8AA_XENLA     --------------LFVTGVHEEATEEDIHDKFGEFGEIKNIHLNLDRRTGFLKGYALVEYETYKEALAA
EIF3G_MAGGR     --------RDDLATLRVTNVSEMAEEQELRDMFERFGRVTRVFLAKDRDTGLAKGFAFISFADRED---A
RBM8A_RAT       --------------LFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAA
RBM8A_MOUSE     --------------LFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAA
RBM8A_HUMAN     --------------LFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAA
RBM8A_BOVIN     --------------LFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAA
NCBP2_RAT       ----------------------------------------------------------------------
NCBP2_MOUSE     ----------------------------------------------------------------------
NCBP2_HUMAN     ----------------------------------------------------------------------
NCBP2_BOVIN     ----------------------------------------------------------------------
MK67I_XENTR     --------------IYIGHIPRALYEPQLREYFSQFGTVTRLRLSRSKKTGNSKGYAYVEFECDEVAKIV
EIF3G_CANAL     --------RDDSTTLKVSQLNSFVDEDMLRELFAKFGPLQRVTIVRNRETGESRGFAYVSFATEEIAQRA
EIF3G_ANOGA     ----------------------------------------------------------------------
RBM42_XENLA     -----------DFRIFCGDLGNEVNDDILARAFSRYPSFLRAKVIRDKRTGKTKGYGFVSFKDPNDYVRA
TRA2A_MOUSE     ----------------VFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEA
TRA2A_HUMAN     ----------------VFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEA
EIF3G_PHANO     -------DRDDSATLRVTNVSEFAEEQDLRDMFSRYGHVTRVFLAKDRETGRAKGFAFVSYADRTDA---
EIF3G_PICST     --------RDDSTTLKVSQLNSFVDEDMLRELFARFGPLQRVTLVRNRETGDSRGFAYVSFITEDMAQRA
DAZL_MACFA      ----------------------------------------------------------------------
DAZL_HUMAN      ----------------------------------------------------------------------
NCBP2_AEDAE     ----------------------------------------------------------------------
EIF3G_XENTR     ----------------------------------------------------------------------
EIF3G_RAT       ----------------------------------------------------------------------
EIF3G_MOUSE     ----------------------------------------------------------------------
EIF3G_HUMAN     ----------------------------------------------------------------------
EIF3G_BOVIN     ----------------------------------------------------------------------
EI3GB_XENLA     ----------------------------------------------------------------------
EI3GA_XENLA     ----------------------------------------------------------------------
DAZL_MOUSE      ----------------------------------------------------------------------
DAZL_CALJA      ----------------------------------------------------------------------
DAZLA_XENLA     ----------------------------------------------------------------------
SR140_MOUSE     --------------LYLGNINPQMNEEMLCQEFGRFGPLASVKIPRDEERARERNCGFVAFMSRRDAERA
MK67I_HUMAN     -------EQLTPGVVYVRHLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYAFVEFESEDVAKIV
EIF3G_SCLS1     -------ERDDLATLRVTNVSEMAEEQELRDMFERFGRVTRVFLAKDRETGLAKGFAFISFQERSDA---
EIF3G_NEUCR     -------ERDDLATLRVTNVSEMAEEQELRDMFERFGRVTRVFLAKDRDTGLAKGFAFISFADRSDA---
EIF3G_CHAGB     -------ERDDLATLRVTNVSEMAEEQELRDMFERFGRVTRVFLAKDRDTGMAKGFAFISY---ADRDDA
EIF3G_BOTFB     -------ERDDLATLRVTNVSEMAEEQELRDMFERFGRVTRVFLAKDRETGLAKGFAFISFQERSDA---
DAZLB_XENLA     ----------------------------------------------------------------------
NCBP2_BOMMO     ----------------------------------------------------------------------
NCBP2_ANOGA     ----------------------------------------------------------------------
EIF3G_DANRE     ----------------------------------------------------------------------
TRA2B_RAT       ----------------VFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEA
TRA2B_MOUSE     ----------------VFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEA
TRA2B_HUMAN     ----------------VFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEA
TRA2B_BOVIN     ----------------VFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEA
SR140_PONAB     --------------LYLGNINPQMNEEMLCQEFGRFGPLASVKIPRDEERARERNCGFVAFMNRRDAERA
SR140_HUMAN     --------------LYLGNINPQMNEEMLCQEFGRFGPLASVKIPRDEERARERNCGFVAFMNRRDAERA
HNRPC_RAT       --------------IFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEE-----
EIF3G_NEOFI     -------EKDDLATLRVTNVSELAEESELRDLFERFGRVTRVFLARDRETQRAKGFAFISFADRTDA---
EIF3G_ASPFU     -------EKDDLATLRVTNVSELAEESELRDLFERFGRVTRVFLARDRETQRAKGFAFISFADRTDA---
EIF3G_ASPFC     -------EKDDLATLRVTNVSELAEESELRDLFERFGRVTRVFLARDRETQRAKGFAFISFADRTDA---
FOX1C_MOUSE     ----------------------------------------------------------------------
FOX1C_HUMAN     ----------------------------------------------------------------------
EIF3G_EMENI     -------EKDDLATLRVTNVSELAEEQELRDLFERFGRVTRVFLARDRETQRAKGFAFISFADRSDA---
EIF3G_DEBHA     MPAKDLKDRDDSTTLKISQLNSIVDEDMLRELLGRYGPFQRAIVVRNRETGESRGFAYVTFATESKAEEA
EIF3G_COCIM     -------ERDELATLRVTNVSELAEEGELRDMFGRFGHVTRVFLAKDKETNMAKGFAFISFADRADA---
EIF3G_ASPNC     -------EKDDLATLRVTNVSELAEEGELRDLFERFGRVTRVFLARDRETQRAKGFAFISFADRSDA---
EIF3G_ASPCL     -------EKDDLATLRVTNVSELAEESEIRDLFERFGRVTRVFLARDRETQRAKGFAFISFADRSDA---
PAB2_SCHPO      -------------SVYVGNVDYSVTPEELQSHFASCGSVNRVTILCDKFTGHPKGFAYIEFSEPSLVPNA
MK67I_MOUSE     --------------VYLGHLPSTLSESHIYNYCAQFGDISRFRLSRSKRTGNSKGYAFVEFESEDVA---
EIF3G_PICGU     -------DRDDSTTLKISQLNTFVDEDMLRELLKRFHPLQRVTIVRNRETGESRGFAYVSFVTERQAEEA
EIF3G_ASPOR     -------EKDDLATLRVTNVSELAEEGELRDLFERFGRVTRVFLARDRETQRAKGFAFISFADRSDA---
EIF3G_BRUMA     ----------------------------------------------------------------------
FUSIP_MOUSE     ----------------------------------------------------------------------
FUSIP_HUMAN     ----------------------------------------------------------------------
RNPS1_XENTR     --------------VHIGRLTRNVTKDHILEIFSTYGKIKMIDMPVDRYHPHSKGYAYVEFEAPEEAEKA
RNP1B_XENLA     --------------VHIGRLTRNVTKDHILEIFSTYGKIKMIDMPVDRYHPHSKGYAYVEFEAPEEAEKA
RNP1A_XENLA     --------------VHIGRLTRNVTKDHILEIFSTYGKIKMIDMPVDRYHPHSKGYAYVEFEAPEEAEKA
EIF3G_ASPTN     -------EKDDLATLRVTNVSELAEEGELRDLFERFGRVTRVFLARDRETQRAKGFAFISFADRTDA---
CELF4_XENTR     --AATIPMKDHDAILFIGQIPRNLDEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCERESALKA
RNPS1_RAT       --------------VHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHSKGYAYVEFENPDEAEKA
RNPS1_PONAB     --------------VHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHSKGYAYVEFENPDEAEKA
RNPS1_MOUSE     --------------VHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHSKGYAYVEFENPDEAEKA
RNPS1_MACFA     --------------VHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHSKGYAYVEFENPDEAEKA
RNPS1_HUMAN     --------------VHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHSKGYAYVEFENPDEAEKA
RNPS1_BOVIN     --------------VHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHSKGYAYVEFENPDEAEKA
FOX1A_DANRE     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IKILNMIKLYGKPIKVNKASAHEKNMDVGANIFVGNLDPEVDEKLLYDTFSAFGVILQVPKIMRDVDSGT
SF3B4_CAEEL     IKILNMIKLYGKPIKVNKASAHEKNMDVGANIFVGNLDPEVDEKLLYDTFSAFGVILQVPKIMRDVDSGT
SF3B4_RAT       IKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGN
SF3B4_MOUSE     IKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGN
SF3B4_HUMAN     IKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGN
SAP49_SCHPO     CQILNQVKLFGKPIRVNRASQDRVNTLIGANLFVGNLDPLVDERVLYDTFSALGQLVKAPQVARD-ENGR
SF3B4_DICDI     LKVMKFVRLFXXXXXXXXXXXDK--VDIGANLFIGNLDADVDERILHDTFSRFGTIIFTPKVMRD-ENGV
HSH49_YEAST     IKIMNTVRLYDRLIKVRQVTNSTGTTNLPSNIFIKNLADSIDSDQLVKIFNKFGKLIREPEIFY-LSNGK
PABP4_HUMAN     LDTMNFDVIKGKPIRISQRDPSLRKSGVG-NVFIKNLDKSIDNKALYDTFSAFGNILSCKVV---CDENG
PABP2_ARATH     IQELNYIPLYGKPIRVMYSHRDPSVRRSGANIFIKNLDESIDHKALHDTFSSFGNIVSC-KVAVD-SSGQ
PABP1_HUMAN     LDTMNFDVIKGKPVRISQRDPSLRKSGVG-NIFIKNLDKSIDNKALYDTFSAFGNILSCKVV---CDENG
PABP1_BOVIN     LDTMNFDVIKGKPVRISQRDPSLRKSGVG-NIFIKNLDKSIDNKALYDTFSAFGNILSCKVV---CDENG
PABP_SCHPO      LDELNYTLIKGRPCRIMWSQRDPSLRKMGGNVFIKNLDPAIDNKALHDTFSAFGKILSC-KVAVD-ELGN
PABP1_RAT       LDTMNFDVIKGKPVRISQRDPSLRKSGVG-NIFIKNLDKSIDNKALYDTFSAFGNILSCKVV---CDENG
PABP1_PONAB     LDTMNFDVIKGKPVRISQRDPSLRKSGVG-NIFIKNLDKSIDNKALYDTFSAFGNILSCKVV---CDENG
PABP1_MOUSE     LDTMNFDVIKGKPVRISQRDPSLRKSGVG-NIFIKNLDKSIDNKALYDTFSAFGNILSCKVV---CDENG
PABPB_XENLA     LDTMNFDVIKGKPVRISQRDPSLRKSGVG-NIFIKNLDKSIDNKALYDTFSAFGNILSCKVV---CDENG
PABPA_XENLA     LDTMNFDVIKGRPVRISQRDPSLRKSGVG-NIFIKNLDKSIDNKALYDTFSAFGNILSCKVV---CDENG
PABP3_HUMAN     LDTMNFDVIKGKPVRISQRDPSLRKSGVG-NIFVKNLDKSINNKALYDTVSAFGNILSCNVV---CDENG
PABP_YARLI      LEELNYSPIKERPCRIMWSQRDPALRKTGANIYIKNLDPAIDNKALHDTFSAFGQILSC-KIATD-EFGN
PABP_NEOFI      LEDLNYTLIKGKPCRIMWSQRDPALRKTGGNVFIKNLDAAIDNKALHDTFAAFGNILSC-KVAQD-EFGN
PABP_DROME      LDTMNFDLVRNKPIRISQRDPSLRRSGVG-NVFIKNLDRAIDNKAIYDTFSAFGNILSC-KVATD-EKGN
PAB4L_HUMAN     LDTMNFDIIKGKSIRLSQRDAYLRRSGIG-NVFIKNLDKSIDNKTLYEHFSAFGKILS-SKVMSD-DQG-
EPAB_XENTR      LDTMNFEVIKGRPIRISQRDPGLRKSGVG-NVFIKNLDESIDNKALYDTFSAFGNILSCKVV---CDEHG
PABP_ASPNC      LEDLNYTLIKGKPCRIMWSQRDPALRKTGGNVFIKNLDSAIDNKALHDTFAAFGNILSC-KVAQD-EFGN
EPABB_XENLA     LDTMNFEVIKGRPIRISQRDPGLRKSGVG-NVFIKNLDDSIDNKALYDTFSAFGDILSCKVV---CDEYG
PABP_CRYNE      LEHLNYSLIKGQSCRIMWSQRDPALRKTGGNIFIKNLDQSIDNKALHDTFAAFGDILSC-KVGTD-ENGK
PABP_ASPOR      LEDLNYTLIKGKPCRIMWSQRDPALRKTGGNVFIKNLDSAIDNKALHDTFAAFGNILSC-KVAQD-EFGN
PABP_PHANO      LEELNYTVIKGKPCRIMWSQRDPALRKTGGNVFIKNLDHAIDNKALHDTFAAFGNILSC-KVAQD-ELGN
PABP_LODEL      IEELNYTPVEGRPCRIMWSQRDPSARRSGGNIFIKNLHPAIDNKALHDTFSAFGKILSV-KVATD-DLGQ
EPABA_XENLA     LDTMNFEVIKGRPIRISQRDPGLRKSGVG-NVFIKNLDESIDNKALYDTFSAFGNILSCKVV---CDEHG
PABP_ASPTN      LEDLNYTLIKGKPCRIMWSQRDPALRKTGGNVFIKNLDAAIDNKALHDTFAAFGNILSC-KVAQD-EFGN
PABP_ASPCL      LEDLNYTLIKGKPCRIMWSQRDPALRKTGGNVFIKNLDSAIDNKALHDTFAAFGNILSC-KVAQD-EFGN
PAP1L_HUMAN     LDTMNFEMLKGQPIRISQRDPGLRKSGVG-NIFIKNLEDSIDNKALYDTFSTFGNILSCKVA---CDEHG
PABP3_ARATH     MEALNYTPLFDRPIRIMLSNRDPSTRLSGGNIFIKNLDASIDNKALFETFSSFGTILSC-KVAMDV-TGR
PABP5_ARATH     MESLNYAPIRDRPIRIMLSNRDPSTRLSGGNVFIKNLDASIDNKALYETFSSFGTILSC-KVAMDV-VGR
PABP_NEUCR      LEELNYTLIKGRPCRIMWSQRDPALRKTGANIFIKNLDAAIDNKALHDTFAAFGNILSC-KVAQD-EHGN
PABP_ASPFU      LEDLNYTLIKGKPCRIMWSQRDPALRKTGGNVFIKNLDAAIDNKALHDTFAAFGNILSC-KVAQD-EFGN
PAP1M_HUMAN     LETLNFDVIKGRPVRISQRDPSLRKSGVG-NVFIKNLGKTIDNKALYNIFSAFGNILSCKVA---CDEKG
PABP_MAGGR      LEELNYTLIKGRPCRIMWSQRDPALRKTGGNVFIKNLDVAIDNKALHDTFAAFGNILSC-KVAQD-ENGN
PABP_EMENI      LDELNYTLIKGKPCRIMWSQRDPALRKTGGNVFIKNLDSAIDNKALHDTFAAFGNILSC-KVAQD-EFGV
PABP_CHAGB      LEELNYTLIKGRPCRIMWSQRDPALRKTGGNVFIKNLDVAIDNKALHDTFAAFGNILSC-KVAQD-ENGN
PABP_YEAST      IEQLNYTPIKGRLCRIMWSQRDPSLRKKGSNIFIKNLHPDIDNKALYDTFSVFGDILS-SKIATD-ENGK
PAP1B_DICDI     LDTLNYTLVHGKPCRISYRDPTKRKTNVG-NIFVKNLEKGVDNAMLYDTFSSFGNILSCKV---EFEKGI
PABP_ASHGO      IEQLNYTLIKGKPCRIMWSQRDPSLRKKGSNIYIKNLHPAIDNKSLHETFSTFGNILSC-KVATD-ENGV
PABP_DEBHA      IEDLNYSLIEGRPCRIQRDPSLRRNGD--GNIFIKNLHPAIDNKALHDTFTAFGKILSC-KVATD-DMGI
PABP_CANGA      IEKLNFTPIKGKLCRIMWSQRDPSLRKKGANIFIKNLHPDIDNKALYDTFSVFGNILS-SKVATD-ETGK
PABP_USTMA      MEQLNYSLIRNRPCRIMWSQRDPALRRTGGNIFIKNLDAGIDNKALHDTFAAFGNILSCKVATNETG---
PABP_KLULA      IQELNYAEINGRPCRIMWSERDPAIRKKGSNIFIKNLHPAIDNKALHETFSTFGEVLSC-KVALD-ENGN
PAP1A_DICDI     LDTLNNTPIRGKACRISQRDPSLRKSGVG-NVFIKNLDKGIDHKALYDTFSAFGNILSC-KVVTD-DGNS
PABP5_PONPY     LNTMNFDLINGKPFRLMWSQPDDRLRKSGGNIFIKNLDKSIDNRALFYLFSAFGNILSCKVV---CDDNG
PABP5_PANTR     LNTMNFDLINGKPFRLMWSQPDDRLRKSGGNIFIKNLDKSIDNRALFYLFSAFGNILSCKVV---CDDNG
PABP5_MACMU     LNTMNFDLINGKPFRLMWSQPDDRLRKSGGNIFIKNLDKSIDNRALFYLFSAFGNILSCKVV---CDDNG
PABP5_HYLLA     LNTMNFDLINGKPFRLMWSQPDDRLRKSGGNIFIKNLDKSIDNRALFYLFSAFGNILSCKVV---CDDNG
PABP5_HUMAN     LNTMNFDLINGKPFRLMWSQPDDRLRKSGGNIFIKNLDKSIDNRALFYLFSAFGNILSCKVV---CDDNG
PABP5_GORGO     LNTMNFDLINGKPFRLMWSQPDDRLRKSGGNIFIKNLDKSIDNRALFYLFSAFGNILSCKVV---CDDNG
TIAR_HUMAN      LAAMNGRKILGKEVKVNWASSQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDA-RVVKDMATGK
PABP_PICST      IEELNYSPIEGRPCRIMWSQRDPSARRSGGNIFIKNLHPAIDNKALHDTFSTFGKILSC-KVATD-DMGQ
TIAR_MOUSE      LAAMNGRKILGKEVKVNWASSQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDA-RVVKDMATGK
PABP_CANAL      IEELNYNPIEGRPCRIMWSQRDPSARRSGGNIFIKNLHPAIDNKALHDTFSAFGKILSC-KVATD-EFGQ
PABP_PICGU      IEELNYSLVDGRPCRIQRDPSLRRNGD--GNIFIKNLHPAIDNKALHDTFSAFGRILSC-KVATD-ELGQ
ROC1_NICSY      CQQFNGYELDGRALRVNSGPPPEKRENXXXRVYVGNLAWGVDQDALETLFSEQGKVVDA-KVVYDRDSGR
ROC3_ARATH      VEKFNRYDLNGRLLTVNKAAPRPRVYEPAFRVYVGNLPWDVDNGRLEQLFSEHGKVVEA-RVVYDRETGR
ROC3_NICSY      VELYSQYDLNGRLLTVNKAAPRPRTFQPTYRIYVGNIPWDIDDARLEQVFSEHGKVVSA-RVVFDRESGR
ROC1_SPIOL      VELLNGYDMDGRQLTVNKAAAPRGDFEPSCRVYVGNLPWDVDTSRLEQLFSEHGKVVSA-RVVSDRETGR
PUB1_YEAST      LQTLNGKQIENNIVKINWAXXXXXXXDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLS-GHVMWDMQTGS
ROC1_NICPL      CQQFNGYELDGRALRVNSGPPPEKXXXXXXXVYVGNLAWGVDQDALETLFSEQGKVVDA-KVVYDRDSGR
ROC2_NICSY      EQQFNGYEIDGRAIRVNAGPAPAKSVDSSNRVYVGNLSWGVDDLALKELFSEQGNVVDA-KVVYDRDSGR
PABP_COCIM      IKHVNGMLLNDKKVKKDRQSKFEEMKANFTNVYVKNIDQDTTEEEFRDLFEKFGEITSAT-LARDAESGK
ELAV2_PONAB     INTLNGLRLQTKTIKVSYARPSSASIR-DANLYVSGLPKTMTQKELEQLFSQYGRII-TSRILVDQVTGI
ELAV2_HUMAN     INTLNGLRLQTKTIKVSYARPSSASIR-DANLYVSGLPKTMTQKELEQLFSQYGRII-TSRILVDQVTGI
PUF68_DROME     LEQMNGALMGGRNIKVGRPSNMPQAQQVFNRIYVASIHPDLSEEDIKSVFEAFGPILYC-KLAQGTSLHT
TIA1_MOUSE      XXXMNGRKIMGKEVKVNWAXXXXXXXXXXXHVFVGDLSPEITTEDIKAAFAPFGRISDA-RVVKDMATGK
TIA1_HUMAN      XXXMNGRKIMGKEVKVNWAXXXXXXXXXXXHVFVGDLSPEITTEDIKAAFAPFGRISDA-RVVKDMATGK
ELAV2_RAT       INTLNGLRLQTKTIKVSYARPSSASIR-DANLYVSGLPKTMTQKELEQLFSQYGRII-TSRILVDQVTGI
ROC2_NICPL      EQQFNGYEIDGRAIRVNAGPAPAKSVDSSNRVYVGNLSWGVDDLALKELFSEQGNVVDA-KVVYDRDSGR
ROC1_ARATH      AQQFNGYELDGRPLRVNAGPPPPKREDXXXRVYVGNLSWGVDDMALESLFSEQGKVVEA-RVIYDRDSGR
PABPX_ARATH     IEKKNNSLLNGKMIRVMSVRAPDARRNGVGNVFVKNLPESVTNAVLQDMFKKFGNIVSCK--VATLEDGK
ELAV2_MOUSE     INTLNGLRLQTKTIKVSYARPSSASIR-DANLYVSGLPKTMTQKELEQLFSQYGRII-TSRILVDQVTGI
ROC5_NICSY      IRLFDGSQVGGRTVKVNIRSTYQGFVDSPHKLYVANLSWALTSQGLRDAFADQPGFMSA-KVIYDRSSGR
RBM7_MOUSE      MNLLNGIKLFGRPIKIQRSGSSHASQDASVSYHVGNLSP-------------------------------
ELAV3_MOUSE     INTLNGLKLQTKTIKVSYARPSSASIR-DANLYVSGLPKTMSQKEMEQLFSQYGRII-TSRILLDQATGV
RBM7_HUMAN      MNLLNGIKLYGRPIKIQRSGSSHAPQDVSLSYHVGNSSP-------------------------------
ELAV3_HUMAN     INTLNGLKLQTKTIKVSYARPSSASIR-DANLYVSGLPKTMSQKEMEQLFSQYGRII-TSRILVDQVTGV
ROC4_NICSY      VEMYNRYDVNGRLLTVNKAAXXXXTFEQSYRIYVGNIPWGIDDARLEQLFSEHGKVVSA-RVVYDRETGR
FCA_ARATH       IRALNQITLPGGPVQVRYADGERERITLEFKLFVGSLNKQATEKEVEEIFLQFGHVEDV-YLMRD-EYRQ
ELAV1_HUMAN     INTLNGLRLQSKTIKVSYARPSSEVIK-DANLYISGLPRTMTQKDVEDMFSRFGRIIN-SRVLVDQTTGL
PU60B_DANRE     LEQMNSVMLGGRNIKVGRPGSIGQAQPIYNRIYVASIHPDLSDDDIKSVFEAFGKIKSC-MLAREPTTGK
YG41_SCHPO      MSMNN------KPIKLNWASGREKSISKASSIFVGDLSPNVNEFDVYSLFASRYNSCKSAKIMTDPQTNV
PUF60_RAT       LEQMNSVMLGGRNIKVGRPSNIGQAQPIFNRIYVASVHQDLSDDDIKSVFEAFGKIKSC-TLARDPTTGK
PUF60_PONAB     LEQMNSVMLGGRNIKVGRPSNIGQAQPIFNRIYVASVHQDLSDDDIKSVFEAFGKIKSC-TLARDPTTGK
PUF60_MOUSE     LEQMNSVMLGGRNIKVGRPSNIGQAQPIFNRIYVASVHQDLSDDDIKSVFEAFGKIKSC-TLARDPTTGK
PUF60_HUMAN     LEQMNSVMLGGRNIKVGRPSNIGQAQPIFNRIYVASVHQDLSDDDIKSVFEAFGKIKSC-TLARDPTTGK
PUF60_BOVIN     LEQMNSVMLGGRNIKVGRPSNIGQAQPIFNRIYVASVHQDLSDDDIKSVFEAFGKIKSC-TLARDPTTGK
HRP1_YEAST      VKTQHI--LDGKVIDPKRAIPRDE-QDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDA-QLMLDKDTGQ
RBM7_BOVIN      MNLLNGIKLFGRPIKI------------------------------------------------------
ELAV4_RAT       INTLNGLRLQTKTIKVSYARPSSASIR-DANLYVSGLPKTMTQKELEQLFSQYGRII-TSRILVDQVTGV
ELAV4_MOUSE     INTLNGLRLQTKTIKVSYARPSSASIR-DANLYVSGLPKTMTQKELEQLFSQYGRII-TSRILVDQVTGV
ELAV4_HUMAN     INTLNGLRLQTKTIKVSYARPSSASIR-DANLYVSGLPKTMTQKELEQLFSQYGRII-TSRILVDQVTGV
SXL_MEGSC       INNLNGITVRNKRIKVSFARPGGEQLR-DTNLYVTNLSRSITDEQLETIFGKYGQIVQ-KNILRDKHTGT
RBM39_PONAB     IGLTGQ-RVLGVPIIVNRAAAMANNLQKGSRLYVGSLHFNITEDMLRGIFEPFGRIESI-QLMMDSETGR
RBM39_HUMAN     IGLTGQ-RVLGVPIIVNRAAAMANNLQKGSRLYVGSLHFNITEDMLRGIFEPFGRIESI-QLMMDSETGR
RBM39_MOUSE     IGLTGQ-RVLGVPIIVNRAAAMANNLQKGSRLYVGSLHFNITEDMLRGIFEPFGRIESI-QLMMDSETGR
SXL_DROSU       IKVLNGITVRNKRLKVSYARPGGESIK-DTNLYVTNLPRTITDDQLDTIFGKYGSIVQ-KNILRDKLTGR
RBM11_HUMAN     IALLNGIRLYGRPINV------------------------------------------------------
ELAV1_MOUSE     ISTLNGLRLQSKTIKVSYARPSSEVIK-DANLYISGLPRTMTQKDVEDMFSRFGRIIN-SRVLVDQTTGL
NSR1_YEAST      IQEMQGKEIDGRPINCDMSTSKDTPSEPSDTLFLGNLSFNADRDAIFELFAKHGEVVSV-RIPTHPETEQ
RBM23_HUMAN     IGLTGQ-RLLGVPIIVQASQAEKNRLAAMANLYVGSLHFNITEDMLRGIFEPFGKIDNIV-LMKDSDTGR
HNRDL_MOUSE     LE-LKEHKLDGKLIDPKRAKA-LKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENI-ELPMDTKTNE
HNRDL_HUMAN     LE-LKEHKLDGKLIDPKRAKA-LKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENI-ELPMDTKTNE
SXL_DROME       IKVLNGITVRNKRLKVSYARPGGESIK-DTNLYVTNLPRTITDDQLDTIFGKYGSIVQ-KNILRDKLTGR
SXL_CERCA       IKSLNGITVRNKRLKVSYARPGGESIK-DTNLYVTNLPRTITDDQLDTIFGKYGMIVQ-KNILRDKLTGK
PABP_ENCCU      IREYKHYELHNRQIRVMKKD--ERPPETG-NIFVKNLPEDFTGKDLDDAFSMFGEIVSCK--VATTSHGK
HNRDL_CHICK     EKVLELHKLDGKLIDPKRAKA-LKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENI-ELPMDTKTNE
SXL_CHRRU       IKSLNGVTVRNKRLKVSYARPGGESIK-DTNLYVTNLPRTITDDELEKIFGKYGNIVQ-KNILRDKLTGK
SXL_MUSDO       IKTVNGITVRNKRLKVSYARPGGESIK-DTNLYVTNLPRTITDDELEKIFGKYGNIVQ-KNILRDKLTGR
HNRDL_RAT       LE-LKEHKLDGKLIDPKRAKA-LKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENI-ELPMDTKTNE
RB87F_DROME     -QNARPHKIDGRTVEPKRAVPRQESPNAGATVFVGGLRDDHDEECLREYFKDFGQIVSV-NIVSDKDTGK
CELF5_XENTR     QTALHEQKTMARPIQVKPADSESRGGD--RKLFVGMLSKQQSEEEVTSMFQAFGSIEEC-SVLRGPD-GS
RA1L2_HUMAN     MN-TTPHKVDGRVVEPKRAVSREDSQRPGAHIFVGGIKEDTEEHHLRDYFEQYGKI-EVIEIMTDRGSGK
ROA1_RAT        MN-ARPHKVDGRVVEPKRAVSREDSQRPGAHIFVGGIKEDTEEHHLRDYFEQYGKI-EVIEIMTDRGSGK
ROA1_PANTR      MN-ARPHKVDGRVVEPKRAVSREDSQRPGAHIFVGGIKEDTEEHHLRDYFEQYGKI-EVIEIMTDRGSGK
ROA1_MOUSE      MN-ARPHKVDGRVVEPKRAVSREDSQRPGAHIFVGGIKEDTEEHHLRDYFEQYGKI-EVIEIMTDRGSGK
ROA1_HUMAN      MN-ARPHKVDGRVVEPKRAVSREDSQRPGAHIFVGGIKEDTEEHHLRDYFEQYGKI-EVIEIMTDRGSGK
ROA1_BOVIN      MN-ARPHKVDGRVVEPKRAVSREDSQRPGAHIFVGGIKEDTEEHHLRDYFEQYGKI-EVIEIMTDRGSGK
RA1L3_HUMAN     MN-ARPHKVDGRVVEPKRAVSREDSQRPGAHIFVGGIKEDTEEHHLRDYFEQYGKI-EVIEIMTDRGSGK
ROA1_XENLA      M-TARPHKVDGRVVEPKRAVSREDSSRPGAHIFVGGIKEDTEEDHLREYFEQYGKI-EVIEIMTDRGSGK
RB97D_DROME     QENRPHI-IDGKTVEAKRAESRETNISV-KKLFVGGLKDNHDEECLREYFLQFGNVVSV-KLLTDKTTGK
HNRDL_XENTR     LETKEH-KLDGKLIDPKRAKA-LKGKEPPKKVFVGGLSPETTEEQIKQYFGGFGEIENI-ELPMDTKTNE
HNDLA_XENLA     LE-TNEHKLDGKLIDPKRAKA-LKGKEPPKKVFVGGLSPETTEEQIKQYFGGFGEIENI-ELPIDTKTNE
ROA3_RAT        M-CARPHKVDGRVVEPKRAVSREDSVKPGAHIFVGGIKEDTEEYNLRDYFEKYGKI-ETIEVMEDRQSGK
ROA3_MOUSE      M-CARPHKVDGRVVEPKRAVSREDSVKPGAHIFVGGIKEDTEEYNLRDYFEKYGKI-ETIEVMEDRQSGK
ROA3_HUMAN      M-CARPHKVDGRVVEPKRAVSREDSVKPGAHIFVGGIKEDTEEYNLRDYFEKYGKI-ETIEVMEDRQSGK
RO32_XENLA      MS-ARPHKVDGRVVEPKRAVSREDSARPGAHIFVGGIKEDTEEYHLRDYFEGYGKI-ETIEVMEDRQSGK
ROA1_MACMU      MN-ARPHKVDGRVVEPKRAVSREDSQRPGAHIFVGGIKEDTEEHHLRDYFEQYGKI-EVIEIMTDRGSGK
HNRPM_RAT       AEVLNKHSLSGRPLKVKERRAMQKAGRLGSTVFVANLDYKVGWKKLKEVFSMAGVVVRA-DILEDKD-GK
PPIE_RHIOR      MDNMHLSELYGKVIKVQLA---------------------------------------------------
PPIE_DROME      IDNMNDSELCGRTIRVNLA---------------------------------------------------
ELAV_DROVI      VNVLNGLRLQNKTIKVSFARPSSDAIK-GANLYVSGLPKTMTQQELEAIFAPFGAII-TSRILQNAGNDT
ELAV_DROME      VNVLNGLRLQNKTIKVSFARPSSDAIK-GANLYVSGLPKTMTQQELEAIFAPFGAII-TSRILQNAGNDT
RO21_XENLA      TR---PHTIDGRVVEPKRAVAREESAKPGAHVFVGGIKEDTEEHHLREYFEEYGKIDSI-EIITDKQSGK
SHEP_DROYA      VK-----GLQGKGVQAQMAKQQEQD---PTNLYIANLPPHFKETDLEAMLSKYGQVVST-RILRD-QQMN
SHEP_DROER      VK-----GLQGKGVQAQMAKQQEQD---PTNLYIANLPPHFKETDLEAMLSKYGQVVST-RILRD-QQMN
ROA2_SAGOE      M-AARPHSIDGRVVEPKRAVAREESGKPGAHVFVGGIKEDTEEHHLRDYFAEYGKIDTI-EIITDRQSGK
ROA1_DROME      QK-SRPHKIDGRVVEPKRAVPRQDSPNAGATVFVGALKDDHDEQSIRDYFQHFGNIVDI-NIVIDKETGK
PPIE_PONAB      IDNMNESELFGRTIRVNLA---------------------------------------------------
PPIE_MOUSE      IDNMNESELFGRTIRVNLA---------------------------------------------------
PPIE_HUMAN      IDNMNESELFGRTIRVNLA---------------------------------------------------
PPIE_BOVIN      IDNMNESELFGRTIRVNLA---------------------------------------------------
HNRPD_RAT       -KVMDQHKLNGKVIDPKRAKA-MKTKEPVKKIFVGGLSPDTPEEKIREYFGGFG---EVESIELPMDNKT
HNRPD_MOUSE     -KVMDQHKLNGKVIDPKRAKA-MKTKEPVKKIFVGGLSPDTPEEKIREYFGGFG---EVESIELPMDNKT
HNRPD_HUMAN     -KVMDQHKLNGKVIDPKRAKA-MKTKEPVKKIFVGGLSPDTPEEKIREYFGGFG---EVESIELPMDNKT
HNDLB_XENLA     LETKEH-KLDGKLIDPKRAKALQ-GKEPPKKVFVGGLSPETTEEQIKQYFGGFGEIENI-ELPMDTKTNE
SHEP_DROSE      VK-----GLQGKGVQAQMAKQQEQD---PTNLYIANLPPHFKETDLEAMLSKYGQVVST-RILRD-QQMN
SHEP_DROME      VK-----GLQGKGVQAQMAKQQEQD---PTNLYIANLPPHFKETDLEAMLSKYGQVVST-RILRD-QQMN
ROA2_BOVIN      M-AARPHSIDGRVVEPKRAVAREESGKPGAHVFVGGIKEDTEEHHLRDYFEEYGKIDTI-EIITDRQSGK
RO31_XENLA      MS-ARPHKVDGRVVEPKRAVSREDSARPGAHIFVGGIKEDTEEYHLRDYSESYGKI-ETIEVMEDRQSGK
RO22_XENLA      MS-ARPHTIDGRVVEPKRAVAREESAKPGAHVFVGGIKEDTEEHHLREYFEEYGKI-ESTEIITDKQSGK
RBMS2_BOVIN     VTAL-------KASGVQAQMAKQQEQD-PTNLYISNLPLSMDEQELEGMLKPFGQVIST-RILRDT-SGT
CELF6_MOUSE     QSALHEQKTMNRPIQVKPAASEGRGED--RKLFVGMLGKQQGEEDVRRLFQPFGHIEEC-TVLRSPD-GT
TSAP1_DANRE     LRKVNGKPLPGKRFKLSRSNYGKQGESSTFSLFVSDLTPDVDDGMLYEFFHYHFSSCCSGKIVLDA-NGH
CEL3B_XENLA     QSALHEQKTMNRPIQVKPADSESRGED--RKLFVGMLGKQQTDEDVRRMFETFGNIDEC-TVLRGPD-GT
ROA1_SCHAM      -QNARPHKVDGRVVEPKRAVPRTERPEAGATVFVGGIKEEMEENDLRDYFKQYGTVVSA-AIVVDKETRK
RBMS2_HUMAN     VTAL-------KASGVQAQMAKQQEQD-PTNLYISNLPLSMDEQELEGMLKPFGQVIST-RILRDT-SGT
RBM28_HUMAN     LKEITTFEGCKINVTVAKKKLRNKTKEKGKNLIIRNLSFKCSEDDLKTVFAQFGAVLEV-NIPRKPD-GK
CEL3A_XENLA     QSALHEQKTMNRPIQVKPADSESRGED--RKLFVGMLGKQQTDEDVRRMFEPFGNIDEC-TVLRGPD-GT
RBY1A_MOUSE     VKEMNGVILDGKRIKVKQA---------------------------------------------------
PRP24_YEAST     VEKLNGLKIEGYTLKVSNPLEKSKRTDEGREIMIRNLSTELDENLLRESFEGFGSIEKINIPAGQKEHSF
CELF6_HUMAN     QSALHEQKTMNRPIQVKPAASEGRGED--RKLFVGMLGKQQGEEDVRRLFQPFGHIEEC-TVLRSPD-GT
CELF4_DANRE     QTALHEQKTMNRPIQVKPADSESRGED--RKLFVGMLNKQQCEDDVRRLFESFGSIEEC-TILRGPD-GN
SQD_DROME       VSAADEHIINSKKVDPKKAKARH------GKIFVGGLTTEISDEEIKTYFGQFGNIVEV-EMPFDKQKSQ
YOCE_SCHPO      AKELKNKKLHGRILRLNKAVKKTIRQDNRPRLIIRNLPWSIKKQHLEPHFSKFGKVREIK--IPTKGGGR
YHKF_SCHPO      MS--KEHHLDGKIIDPKRAIPREE-QEKTAKMFVGGVPGDCTEEEFRNFFNQFGRVLDA-TLMMDKDTGR
ROAA_MOUSE      EKVLDQHRLDGRVIDPKKAMAMKK--DPVKKIFVGGLNPEATEEKIREYFGQFGEI-EAIELPIDPKLNK
ROA2_RAT        M-AARPHSIDGRVVEPKRAVAREESGKPGAHVFVGGIKEDTEEHHLRDYFEEYGKIDTI-EIITDRQSGK
ROA2_PONAB      M-AARPHSIDGRVVEPKRAVAREESGKPGAHVFVGGIKEDTEEHHLRDYFEEYGKIDTI-EIITDRQSGK
ROA2_MOUSE      M-AARPHSIDGRVVEPKRAVAREESGKPGAHVFVGGIKEDTEEHHLRDYFEEYGKIDTI-EIITDRQSGK
ROA2_HUMAN      M-AARPHSIDGRVVEPKRAVAREESGKPGAHVFVGGIKEDTEEHHLRDYFEEYGKIDTI-EIITDRQSGK
RBMS2_MOUSE     VTAL-------KASGVQAQMAKQQEQD-PTNLYISNLPLSMDEQELEGMLKPFGQVIST-RILRDT-SGA
MRD1_YARLI      QKAMDGHVLDGHKLKISNRGQDEETTEIDSKILIKNLPFEATKKDVQKLFGAFGSLVRVPKKF----NSE
CELF4_MACFA     QSALHEQKTMNRPIQVKPADSESRG---DRKLFVGMLNKQQSEDDVRRLFEAFGNIEEC-TILRGPD-GN
RBY1B_MOUSE     VKEMNGVILDGKRIKVKQA---------------------------------------------------
CELF5_HUMAN     QTALHEQKTMARPIQVKPADS-ESRGGRDRKLFVGMLNKQQSEEDVLRLFQPFGVIDEC-TVLRGPD-GS
SHEP_DROWI      VK-----GLQAKGVQAQMAKQQEQD---PTNLYIANLPPHFKETDLEAMLSKYGQVVST-RILRD-QQMN
CEL1B_XENLA     QNALHNMKVLPHPIQMKPADSEKNNAVEDRKLFIGMVSKKCNENDIRTLFSQFGQI-EESRILRGPD-GM
GRP2_SINAL      --------------------------DVEYRCFVGGLAWATDERSLETAFSQFGELVD-SKIINDRETGR
GAR2_SCHPO      XXXNGTKEIDGRMVNLDLSNPRPANSEPSDTVFVGNLSFNATEDDLSTAFGGCGDIQSI-RLPTDPQSGR
CELF1_XENTR     QNALHNMKVLPHPIQMKPADSEKNNAVEDRKLFVGMVSKKCNENDIRAMFSQFGQI-EESRILRGPD-GM
TSAP1_BOVIN     LHKINGKPLPGKRFKLNYATGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLD-QTGV
ROA1_CAEEL      MKQRPHI-IDGKTVDPKRAVPRDDKNRSESNVYVSGVREDHTEDMLTEYFTKYGTVTK-SEIILDKATQK
NUCL_CHICK      LNSCNNTEIEGRAIRLEFSSPSWQKGNMNARLFVRGLSEDTTEETLRESFE--GSISA--RIVTDRDTGS
GRP1_SINAL      --------------------------DVEYRCFVGGLAWATDDRALETAFSQYGEVLD-SKIINDRETGR
DAZP1_MOUSE     LATLDGRNIDPKPCKEGWQKGPRSDSSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIY-DAEKQR
TSAP1_HUMAN     LHKINGKPLPGKRFKLNYATGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLD-QTGV
RRP2_SPIOL      IEKLNDTEIGGRKIKVNITEKPLEGMDIATKVYIGNLAKTVTNELLKDFFSEKGKVLGA-KVQRTPGTSK
DAZP1_HUMAN     LATLDGRNIDPKPCKEGWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIY-DAEKQR
CELF1_RAT       QNALHNMKVLPHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEEC-RILRGPD-GL
CELF1_MOUSE     QNALHNMKVLPHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEEC-RILRGPD-GL
CELF1_HUMAN     QNALHNMKVLPHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEEC-RILRGPD-GL
CELF1_CHICK     QNALHNMKILPHPIQMKPADSEKNNAVEDRKLFIGMISKKCNENDIRVMFSPFGQIEEC-RILRGPD-GL
DAZP1_XENLA     LATLDGRNIDPKPCTPRGMQPERSRPREGNKIFVGGIPHNCGETELKEYFNRFGVVTEVVMIY-DAEKQR
SHEP_DROVI      VK-----GLQAKGVQAQMAKQQEQD---PTNLYIANLPPHFKETDLEAMLAKYGQVVST-RILRD-QQMN
RT19_ARATH      ---------------------------MSTKLYIGGLSPGTDEHSLKDAFSSFNGVTEA-RVMTNKVTGR
HNRPG_BOVIN     --------------------------DRPGKLFIGGLNLETDEKSLEATFGKYGRISEV-LLMKDRETNK
GRP7_ARATH      --------------------------DVEYRCFVGGLAWATDDRALETAFAQYGDVID-SKIINDRETGR
CELF3_DANRE     QNALHEQKTMNRPIQVKPADSEGRG---DRKLFVGMLGKQLSDADVRKMFEPFGSIEEC-TVLRGPD-GA
SHEP_DROGR      VK-----GLQAKGVQAQMAKQQEQD---PTNLYIANLPPHFKETDLEAMLAKYGQVVST-RILRD-QQMN
RBPE_ANASP      IQALDGAEWMGRVLKVNKARPREE----------------------------------------------
RBM3_HUMAN      -------------------------------LFVGGLNFNTDEQALEDHFSSFGPISEVV-VVKDRETQR
RBM28_MOUSE     LKEITTFEGCKIDVTVAKKKLRNKSKETRKNLIIRNLSFKCSEDDLKAVFTHYGTVLEV-NIPKKPD-GK
RB27C_DROME     LQTLDGRTIDPKP--CNPRTLQKPKKGGGYKVFLGGLPSNVTETDLRTFFNRYGKVTEV-VIMYDQEKKK
TSAP1_RAT       LHKINGKPLPGKRFKLNYATGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLD-QTGV
TSAP1_PONAB     LHKINGKPLPGKRFKLNYVTGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLD-QTGV
SHEP_DROSI      VK-----GLQGKGVQAQMAKQQEQD---PTNLYIANLPPHFKETDLEAMLSKYGQVVST-RILRD-QQMN
SHEP_DROMO      VKGLQAKGVQAQMAKVGIWVLHRQQEQDPTNLYIANLPPHFKETDLEAMLAKFGQVVST-RILRD-QQMN
RBM3_MOUSE      -------------------------------LFVGGLNFNTDEQALEDHFSSFGPISEVV-VVKDRETQR
CELF4_PONAB     QSALHEQKTMNRPIQVKPADSESRGPSQDRKLFVGMLNKQQSEDDVRRLFEAFGNIEEC-TILRGPD-GN
CELF4_MOUSE     QSALHEQKTMNRPIQVKPADSESRGPSQDRKLFVGMLNKQQSEDDVRRLFEAFGNIEEC-TILRGPD-GN
CELF4_HUMAN     QSALHEQKTMNRPIQVKPADSESRGPSQDRKLFVGMLNKQQSEDDVRRLFEAFGNIEEC-TILRGPD-GN
CELF3_HUMAN     QSALHEQKTMNRPIQVKPADSESRGED--RKLFVGMLGKQQTDEDVRKMFEPFGTIDEC-TVLRGPD-GT
CELF3_BOVIN     QSALHEQKTMNRPIQVKPADSESRGED--RKLFVGMLGKQQTDEDVRKMFEPFGTIDEC-TVLRGPD-GT
CEL1A_XENLA     LHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMVSKNCNENDIRAMFSPFGQIEEC-RILRGPD-GM
TSAP1_MOUSE     LHKINGKPLPGKRFKLNYATGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLD-PTGV
RBY1F_HUMAN     AKDMNGTSLHGKAIKVEQA---------------------------------------------------
RBPB_ANASP      IEALDGAEWMGRDLKVNKAKPRE-----------------------------------------------
YHOC_SCHPO      -----------------------------ATVHVGNLAPSVTESLLYNAFIPFGEIISV--ALHRKEKAV
RBY1E_HUMAN     AKDMNGKSLHGKAIKVEQA---------------------------------------------------
RBY1D_HUMAN     AKDMNGKSLHGKAIKVEQA---------------------------------------------------
RBY1B_HUMAN     AKDMNGKSLHGKAIKVEQA---------------------------------------------------
RBY1A_HUMAN     AKDMNGKSLHGKAIKVEQA---------------------------------------------------
HNRGT_MACFA     --------------------------DRPGKLFIGGLNLETDEKALEAEFGKYGRIVEV-LLMKDRETNK
HNRGT_HUMAN     --------------------------DRPGKLFIGGLNLETDEKALEAEFGKYGRIVEV-LLMKDRETNK
CELF2_RAT       QNALHNIKTLPHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEEC-RILRGPD-GL
CELF2_PONAB     QNALHNIKTLPHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEEC-RILRGPD-GL
CELF2_MOUSE     QNALHNIKTLPHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEEC-RILRGPD-GL
CELF2_HUMAN     QNALHNIKTLPHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEEC-RILRGPD-GL
U2A2A_ARATH     MSLDGII-FEGAPVKVRRPSDYNPSLAAGASIFVGGLPYYFTESQVRELLESFGG-LKGFDLVKDRETGN
TSP1L_DANRE     VQRLNGKLVPGRKFKLNYAT-YGKRPEPGPSVFVGDLTSEVDDYQLHQFFLKKFPSCKGAKVVTD-PYGN
ROAA_HUMAN      EKVLDQHRLDGRVIDPKKAMAMKK--DPVKKIFVGGLNPEPTEEKIREYFGEFGEI-EAIELPMDPKLNK
RBMS1_BOVIN     XXXXXXXXXXG--VQAQMAKQQEQD---PTNLYISNLPLSMDEQELENMLKPFGQVIST-RILRD-SSGT
NUCL_MESAU      LELTGL-KVFGNEIKLEKPKGRDKKVRAARTLLAKNLSFNITEDELKEVFED---ALEIRLVSQD---GK
MRD1_CANAL      ISTLDGHVLDGHKLQLKLS--HKQGTGTSAXXXXXNLPFEATRKDLLELFGAFGQLKSV-RVPKKFDQ-S
GRP8_ARATH      --------------------------EVEYRCFVGGLAWATNDEDLQRTFSQFGDVID-SKIINDRESGR
CELF2_CHICK     QNALHNIKTLPHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEEC-RILRGPD-GL
RMXL3_HUMAN     -------------------------------LFIGGLNLKTDEKALKAEFGKYGHIIKV-FLMKDRKTNK
RBMS1_RAT       XXXXXXXXXXG--VQAQMAKQQEQD---PTNLYISNLPLSMDEQELENMLKPFGQVIST-RVLRD-SSGT
RBMS1_HUMAN     XXXXXXXXXXG--VQAQMAKQQEQD---PTNLYISNLPLSMDEQELENMLKPFGQVIST-RILRD-SSGT
NUCL_XENLA      LKLTGK-KILGTEVKIEKAMAFDKNKTASRTLFVKNIPYSTTVEELQEIFNAKDIRIPTGK------DGS
NUCL_RAT        LELTGL-KVFGNEIKLEKPKGRDKKVRAARTLLAKNLSFNITEDELKEVFED---AVEIRLVSQD---GR
CELF1_DANRE     QNALHNMKILPHPIQMKPADSEKNNAVEDRKLFVGMISKKCNENDIRLMFSPYGQIEEC-RILRGPD-GL
ROC2_ARATH      AQQFNGYEFEGRPLRVN--------------LYVGNLSWGVDDMALENLFNEQGKVVEA-RVIYDRDSGR
NUCL_MOUSE      LELTGL-KVFGNEIKLEKPKGRDKKVRAARTLLAKNLSFNITEDELKEVFED---AMEIRLVSQD---GK
NGR1_YEAST      LS-LNATPLFKRTFRLNWASGATLQSSIPSSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGS
MRD1_NEUCR      LKVMDGQVLDAHKISVKASAAEERRREQGTKLVVKNLPFEVTKKEVRTLFSAYGVALRIPKKFNQ----S
CSTF2_PONAB     MRNLNGREFSGRALRVDNA-ASEKNKE-------------------------------------------
CSTF2_MOUSE     MRNLNGREFSGRALRVDNA-ASEKNKE-------------------------------------------
CSTF2_HUMAN     MRNLNGREFSGRALRVDNA-ASEKNKE-------------------------------------------
CSTF2_BOVIN     MRNLNGREFSGRALRVDNA-ASEKNKE-------------------------------------------
CELF3_MOUSE     QSALHEQKTMNRPIQVKPADSESRG---DRKLFVGMLGKQQTDEDVRKMFEPFGTIDEC-TVLRGPD-GT
CELF2_XENTR     QNALHNIKTLPHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEEC-RILRGPD-GL
CELF2_XENLA     QNALHNIKTLPHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEEC-RILRGPD-GL
RSD1_SCHPO      I-ALSGKRLLGLPVIVQLTXXXXXXXXXXXRLCVSNIHFNLTDEDVKAIFEPFGDI-EFVHLQRD-DQNR
HNRPG_PANTR     ARDMNGKSLDGKAIKVEQAT--------------------------------------------------
HNRPG_HUMAN     ARDMNGKSLDGKAIKVEQAT--------------------------------------------------
ROA0_HUMAN      MAA-SPHAVDGNTVELKRAVSREDSARPGAHAXXXXXXXDVAEGDLIEHFSQFGTV-EKAEIIADKQSGK
PAB1L_HUMAN     ----------------------------GANVCVKNLDESIDDERLQKEFSPFGIINSANVMM---EGGC
NAM8_YEAST      LLKNGMLNFPNKKLKLXXXXXXXXXXXXXCSIFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGM
MIP6_YEAST      RKEFNYTVFFGQEVKIMKNTLFRKN--IGTNVFFSNLNPQLTTRSFYLIMIEYGNVLSCLLERR------
CELF2_DANRE     QNALHNIKLTGHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPYGQIEEC-RILRGPD-GL
U2AF2_CAEEL     IAGLNGMQLGDKQLVVQLACAHNTNLPNSASAIAGKADDEYEEILVRDECSKYGIVLEIPRPYED-HPVP
MSIR6_DROME     -KVLTQHELDGKKVDPKVARAHPKMVTRTKKIFVGGLSAPTTLEDVKSYFEQFGPI-EDAMLMFDKQTNR
EIF3G_NEMVE     IEVLS-----------------------------------------------------------------
SFPQ_MOUSE      KAELDDTPMRGRQLRVRFATH-------AAALSVRNLSPYVSNELLEEAFSQFGPIERAVVIVDDRGRST
SFPQ_HUMAN      KAELDDTPMRGRQLRVRFATH-------AAALSVRNLSPYVSNELLEEAFSQFGPIERAVVIVDDRGRST
RBPD_ANASP      ITELDGAEWMGRQLRVNKAKPRE-----------------------------------------------
PSPC1_RAT       KAELDGTILKSRPLRIRFATH-------GAALTVKNLSPVVSNELLEQAFSQFGPVEKAVVVVDDRGRAT
PSPC1_MOUSE     KAELDGTILKSRPLRIRFATH-------GAALTVKNLSPVVSNELLEQAFSQFGPVEKAVVVVDDRGRAT
PSPC1_HUMAN     KAELDGTILKSRPLRIRFATH-------GAALTVKNLSPVVSNELLEQAFSQFGPVEKAVVVVDDRGRAT
PSPC1_BOVIN     KAELDGTILKSRPLRIRFATH-------GAALTVKNLSPVVSNELLEQAFSQFGPVEKAVVVVDDRGRAT
NUCL_PONAB      FEEKQGTEIDGRSISLYYTGEKGQNQDYGKNLVLSNLSYSATEETLQEVFEK-ATFIKVPQNQ----NGK
NUCL_MACFA      FEEKQGTEIDGRSISLYYTGEKGQNQDYGKNLVLSNLSYSATEETLQEVFEK-ATFIKVPQNQ----NGK
NUCL_HUMAN      FEEKQGTEIDGRSISLYYTGEKGQNQDYGKNLVLSNLSYSATEETLQEVFEK-ATFIKVPQNQ----NGK
CELF1_PONAB     QNALHNMKVLPHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEEC-RILWGPD-GL
YDC1_SCHPO      --------------KKEPQSAPEGSENLGNDLFVSGIASRMQEDELQQIFSKFGTVTHV-RIMREPVTKA
RBMS1_MOUSE     XXXXXXXXXXXNGVQAQMAKQQEQD---PTNLYISNLPLSMDEQELENMLKPFGQVIST-RVLRD-SSGA
HNRPG_RAT       --------------------------DRPGKLFIGGLNTETNEKALEAVFGKYGRIVEI-LLMKDRETNK
GRPA_MAIZE      --------------------------DVEYRCFVGGLAWATSNESLENAFASYGEILD-SKVITDRETGR
GRP2_SORBI      --------------------------DVEYRCFVGGLAWATNNETLEQAFANFGQVID-SKVITDRETGR
GRP1_DAUCA      --------------------------EVEYRCFVGGLAWATNDESLEQAFSQFGDITD-SKIINDRETGR
RMXL3_PANTR     -------------------------------LFVGGLNLKTDEKALKAEFGKYGHIIKV-FLIKDRKTNK
A1CF_PONAB      RRKLGRIQLWGHPIAVDWAEPEEDTMSSVKILYVRNLMLSTSEEMIEKEFNNIGAVERVKKI--------
RBMS3_PONAB     XXXXXXXXXXXNGVQAQMAKQQEQD---PTNLYISNLPISMDEQELENMLKPFGHVIST-RILRDA-NGV
RBMS3_MOUSE     XXXXXXXXXXXNGVQAQMAKQQEQD---PTNLYISNLPISMDEQELENMLKPFGHVIST-RILRDA-NGV
RBMS3_HUMAN     XXXXXXXXXXXNGVQAQMAKQQEQD---PTNLYISNLPISMDEQELENMLKPFGHVIST-RILRDA-NGV
RBM19_HUMAN     LKQLQGHVVDGHKLEVRISERATKRKQTTSKILVRNIPFQAHSREIRELFSTFGELKTVRLPKKMTGTGT
HNRPQ_RAT       RRRLGKVKVWGNVGTVEWADPIEDDPEVMAKVFVRNLANTVTEEILEKSFSQFGKLERVKKL--------
HNRPQ_MOUSE     RRRLGKVKVWGNVGTVEWADPIEDDPEVMAKVFVRNLANTVTEEILEKSFSQFGKLERVKKL--------
HNRPG_MOUSE     ARDMNGKSLDGKAIKVEQAT--------------------------------------------------
CSX1_SCHPO      LMKYNNTMIPGATFKLNWATGHNNSRDPEFSIFVGDLLPTTEDSDLFMTFRSIYPSCTSAKIIVDPVTGL
C3H42_ARATH     VDNLNGALVLGRTIKVDHCGAYKKH---------------------------------------------
A1CF_RAT        XXXLGRIQLWGHPIAVDWAEPEEDTMSSVKILYVRNLMLSTSEEMIEKEFNSIGAVERVKKI--------
U2A2B_ARATH     MALDGII-LEGVPVKVRRPTDYNPSLAATLGIFVGGLPYYFTEVQIRELLESFGP-LRGFNLVKDRETGN
U2A2A_NICPL     MALDGVI-FEGGPVKVRRPSDYNPNLNLAARIFVGGLPYYFTESQIRELLESFGQ-LRGFDLVKDRETGN
MRD1_DICDI      IKKLNGSSIDGYEISLKLSDKNETNVQPSSKIIIKNLPFESTIKEIRKLFTAYGEIVRIPK----KPNGG
HNRPR_HUMAN     RRRLGKVKVWGNVVTVEWADVEEPDPEVMAKVFVRNLATTVTEEILEKSFSEFGKLERVKKL--------
HNRPQ_HUMAN     RRRLGKVKVWGNVGTVEWADPIEDDPEVMAKVFVRNLANTVTEEILEKAFSQFGKLERVKKL--------
GRP2_ARATH      ---------------------------MSTKLFIGGLSWGTDDASLRDAFAHFGDVVDA-KVIVDRETGR
GRP10_BRANA     --------------------------EVEYRCFVGGLAWATGDAELERTFSQFGEVID-SKIINDRETGR
CSTFT_MOUSE     ------------------------------SVFVGNIPYEATEEQLKDIFSEVGSVVSF-RLVYDRETGK
CSTFT_HUMAN     ------------------------------SVFVGNIPYEATEEQLKDIFSEVGSVVSF-RLVYDRETGK
U2AF2_MOUSE     IAGLNGMQLGDKKLLVQRASVGAKNATLVS---------------LPSTINQTPVTLQVPGLM-------
RBPF_ANASP      IEGLDGAEWMGRDLKVNKAKPKE-----------------------------------------------
U2AF2_HUMAN     IAGLNGMQLGDKKLLVQRASVGAKN---------------------------------------------
U2A2A_ORYSJ     MA-LDGIMFEGAPVKVRRPTDYNPNLNLAARIFVGGLPYYFTEAQVRELLESFGP-LRGFDLVKDRETGN
IST3_YEAST      -------------------SWHNEYKD-NAYIYIGNLNRELTEGDILTVFSEYGVPVDVI-LSRDENTGE
CIRBP_RAT       MMAMNGKSVDGRQIRVDQAGKSSDN---------------------------------------------
CIRBP_MOUSE     MMAMNGKSVDGRQIRVDQAGKSSDN---------------------------------------------
CIRBP_CRIGR     MMAMNGKSVDGRQIRVDQAGKSSDN---------------------------------------------
U2A2B_WHEAT     MA-LDGILFEGAPVKVRRPTDYNSNLNLAARIFVGGLPYYFTEAQVRELLESFGP-LRGFDLVKDRETGN
TADBP_PONAB     MSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVPKPFR------
TADBP_HUMAN     MSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVPKPFR------
PSPC1_DANRE     KAELDGTVLGNRPIRIRFATH-------GAALTVRNLSPVVSNELLEQAFSQFGPVERAIVIVDDRGRPT
CIRBP_XENLA     MMAMNGKSVDGRQIRVDQA---------------------------------------------------
CIRBP_PONAB     MMAMNGKSVDGRQIRVDQAGKSSDN---------------------------------------------
CIRBP_HUMAN     MMAMNGKSVDGRQIRVDQAGKSSDN---------------------------------------------
SHEP_DROAN      VKGLQGKGVQAQMAKVGIWVLHRQQEQDPTNLYIANLPPHYKETDLEAMLSKYGQVVST-RILRD-QQMN
RBM18_BOVIN     ----------------NASILSEGSLQEGHRLWIGNLDPKITEYHLLRLLQKFGTVKQFDFLFHKSGAGQ
PSPC1_CHICK     KAELDGTILKSRPLRIRFATH-------GAALTVKNLSPVVSNELLEQAFSQFGPVERAXXXXXXRGRAT
NONO_RAT        KVELDNMPLRGKQLRVRFACH-------SASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVD--DRGR
NONO_PONAB      KVELDNMPLRGKQLRVRFACH-------SASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVD--DRGR
NONO_MOUSE      KVELDNMPLRGKQLRVRFACH-------SASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVD--DRGR
NONO_HUMAN      KVELDNMPLRGKQLRVRFACH-------SASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVD--DRGR
MRD1_ASHGO      IAAMDGAVIDGHKIQLHKQSSLPKTXXXXXXXXVKNLPFEATRKDVFELFSSFGQLKSV-RVPKKFDK-S
U2A2B_ORYSJ     MA-LDGILFEGAPVKVRRPTDYNPNLNLAARIFVGGLPYYFTEAQVRELLESFGP-LRGFDLVKDRETGN
RBM19_MOUSE     LKQLQGHTVDGHKLEVRISERATKKKQTTSKILVRNIPFQANQREIRELFSTFGELKTVRLPKKMTGTGA
RBM18_PONAB     ----------------NASILSEGSLQEGHRLWIGNLDPKITEYHLLKLLQKFGKVKQFDFLFHKSGAGQ
RBM18_MOUSE     ----------------NASILSEGSLQEGHRLWIGNLDPKITEYHLLKLLQKFGKVKQFDFLFHKSGAGQ
RBM18_HUMAN     ----------------NASILSEGSLQEGHRLWIGNLDPKITEYHLLKLLQKFGKVKQFDFLFHKSGAGQ
HNRPM_MOUSE     AEVLNKHSLSGRPLKVKERRAMQKVMALGSTVFVANLDYKVGWKKLKEVFSMAGVVVRA-DILEDKD-GK
GRP1_SORBI      ---------------------------------------------LHSAFSTYGEVLE-SKIILDRETQR
A1CF_MOUSE      XXXLGRIQLWGHPIAVDWAEPEEDTMSSVKILYVRNLMLSTSEEMIEKEFNSIGAVERVKKI--------
RBM34_HUMAN     LK-LNNSELMGRKLRVMRSVNKEKFKQQNSN---------------------------------------
EIF3G_CAEEL     IAELNDIRMYHMVLKV------------------------------------------------------
C3H25_ORYSJ     VDNLNGAKVLGRIVRVDHVS--------------------------------------------------
U2A2B_NICPL     MALDGII-FEGAPCKVRRPSDYNPNLNLAARIFVGGLPYYFTEAQIRELLESFGP-LRGFDLVKDRETGN
U1SBP_XENLA     --------------------------DPHLTLFVSRLSPQTTEEKLKEVFSRYGDIKRI-RLVRDFITGF
TADBP_XENTR     MSQRHMIDGRWCDCKLPNSKSPDEPMR-SRKVFVGRCTEDMSAEELRQFFSQYGEVVDVPKPFR------
MRD1_SCHPO      MHAMNGFVLDGHKLEIKDAAAEVRKQDSGTKILIKNLPFEATKKDVQSLLGAYGQLRSV-RVPKKFDR-S
IST3_SCHPO      ------------------SSWHQDYSD-SAYIYIGNLDFDLNEDDILCVFSEFGEPVDI-NLVRDKETGK
HNRPM_HUMAN     AEVLNKHSLSGRPLKVKERRAMQKVMALGSTVFVANLDYKVGWKKLKEVFSMAGVVVRA-DILEDKD-GK
EIF3G_DICDI     ------------------------------SIMVSNLSQNATEKDLYELFGQFGPVVSIPKSME----GS
A1CF_HUMAN      RRKLGRIQLWGHGIAVDWAEPEEDTMSSVKILYVRNLMLSTSEEMIEKEFNNIGAVERVKKI--------
RBMX2_MOUSE     VDNFNGIKIKGRTIRVDHVS--------------------------------------------------
NOP12_CANGA     IKRLNGQVFSNRHLRVDSIT-HPAPHDKQRSVFVGNLDFEEDEESLWKHFGACGSIEYV-RIVRDPKTNM
MRD1_YEAST      IAAMDGTVIDGHKIQL-KLSHRQASQSXXXXXXVKNLPFEATRKDVFELFNSFGQLKSV-RVPKKFDK-S
LARK_DROME      IQNLNGYTLNEFAIKVEAAKSRRAPNTPTTKIFVGNLTDKTRAPEVRELFQKYGTV---------VECDI
U2A2A_WHEAT     MA-LDGIMFEGAPVKVRRPTDYNPSQAAALGIFVGGLPYYFTEAQVRELLETFGP-LRGFDIVKDKETGN
RNP24_SCHPO     LKALNLIKFSGRPSKPKTASIQSSKKEPSSILFVGNLDFETTDADLKEHFGQVGQIRRV-RLMTFEDTGK
RNA15_YEAST     -------------------------------VYLGSIPYDQTEEQILDLCSNVGPVINL-KMMFDPQTGR
RBMX2_HUMAN     VDNFNGIKIKGRTIRVDHVSNYRAPKD-------------------------------------------
RBM46_MOUSE     RRKLGTFQLWGHTIQVDWADPEEETMQRVKVLYVRNLMISTTEETIKAEFSKFGAVERVKKL--------
LARP7_XENTR     IEVLN-----------------------------------------------------------------
U2AF2_SCHPO     ISGLDGKDTYGNKLHLNQAMIDKSNMAILTNLITGDEIMDVQEEDIYESFSNYGPLIKIPRSIGTRNSGL
SGN1_YEAST      --------------KLSKEEKHAHQLEADSSIFVGNITPDVTPEQIEDHFKDCGQIKRIT-LLYDRNTGT
RBPA_SYNY3      XXXXXGAEWMGRDLKVNKAKPRE-----------------------------------------------
RBM4_MACFA      IRNLHHYKLHGVNINV---EASKNKSKTSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIV--------
RBM4_HUMAN      IRNLHHYKLHGVNINV---EASKNKSKTSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIV--------
RBM4_BOVIN      IRNLHHYKLHGVNINV---EASKNKSKTSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIV--------
RBM42_RAT       -------------------------------IFCGDLGNEVNDDILARAFSRFPSFLKA-KVIRDKRTGK
RBM42_MOUSE     -------------------------------IFCGDLGNEVNDDILARAFSRFPSFLKA-KVIRDKRTGK
RBM42_HUMAN     -------------------------------IFCGDLGNEVNDDILARAFSRFPSFLKA-KVIRDKRTGK
RBM42_BOVIN     -------------------------------IFCGDLGNEVNDDILARAFSRFPSFLKA-KVIRDKRTGK
RB15B_HUMAN     ---------YGYPAVCEEDLMPEDDQRATRNLFIGNLDHSVSEVELRRAFEKYGIIEEV--VIKRPARGQ
NCBP2_TAEGU     MRFINGTRLDDRIIRTDWDAGFKEGRQYGRGKTGGQVRDEY--RTDYDVRGGFGKIIQMQK---------
NCBP2_ARATH     VKYISGTILDDRPIRVD-----------------------------------------------------
MYEF2_HUMAN     LETMNKYDLSGRPLNIKEPGGHVPDMGLGSTIFVANLDFKVGWKKLKEVFSIAGTVKRA-DIKEDKD-GK
MSI1H_HUMAN     VLAQSRHELDSKTIDPKVARAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKV-DDAMLMFDKTTNR
U2AF2_CAEBR     IAGLNGMQLGDKQLVVQLACAHNTHLPNSASAIAGNMVTEDEEEILEDVCSKYGIVLEIPRPYDD-HPVP
RBM34_RAT       LK-LNNSELMGRKLRVMRSVNKEKLKQQNSN---------------------------------------
NCBP2_IXOSC     IRYVNGTKLDDRIIRTD-----------------------------------------------------
NCBP2_DICDI     IKYINGSKLDERLIRCDWDYGFKEGRQYGRGLSGGQVRDE------------------------------
NCBP2_CHICK     MRFINGTRLDDRIVRTDWDAGFKEGRQYGRGKTGGQVRDEY--RTDYDVRGGFGKIIQMQK---------
MYEF2_MOUSE     LETMNKYDLSGRPLNIKEQGSHASDVGLGSTIFVANLDFKVGWKKLKEVFSIAGTVKRA-DIKEDKD-GK
MSI1H_RAT       VLAQSRHELDSKTIDPKVARAQPKMVTRTKKIFVGGLSVNTTVEDVKHYFEQFGKV-DDAMLMFDKTTNR
MSI1H_MOUSE     VLAQSRHELDSKTIDPKVARAQPKMVTRTKKIFVGGLSVNTTVEDVKHYFEQFGKV-DDAMLMFDKTTNR
ZCRB1_HUMAN     -----------------------------STVYVSNLPFSLTNNDLYRIFSKYGKVVKVT-IMKDKDTRK
ZCRB1_BOVIN     -----------------------------STVYVSNLPFSLTNNDLYRIFSKYGKVVKVT-IMKDKDTRR
YOW4_SCHPO      LQLHKKLLEEKYPIQVFISDPLRRTPRSGAELYVTNIDFKVNEKDVETFFRDYGQVVRIPKRFNQ-----
RBM18_DANRE     ----------------------------GHRLWIGNIDPKITEYHLVKLLEKFGKVKQFDFLFHKSGEGQ
MRD1_CANGA      ISAMDGTVIDGHKIQLGNAGSQEXXXXXXXXXXXXXLPFEATRKDVFELFNSFGQLKSV-RVPKKFDK-S
EIF3G_LODEL     TSTGRYIPRHLRPDANGNIPTREARDD-STTLKVSQLNTFVDEDMLRELFARFGPLQRVT-VVRDRETGE
YDB2_SCHPO      -------------------------------LFVGNLGNDVNDESLYQAFSEYPSLVKT-KVVRDRE-GK
RBM42_XENTR     MREMNGKYVGSRPIKLRKSQWKDRNMDV------------------------------------------
RBM34_MOUSE     LK-LNNSELMGRKLRVMRSVNKEK----------------------------------------------
NCBP2_ASHGO     LKYLSKTKLDDREITIDLDPGFEEGRQFGRGKNGGQVSDEL-----------------------------
CTF1_SCHPO      VRKLNNSELGPRKIRV------------------------------------------------------
RBPA_ANASP      XXXXXXXXWMGRDLKVNKAKPRE-----------------------------------------------
RBM8A_DANRE     -------------------------------LFVTGVHEEATEEDVHDKFAEFGEIKNL-HLNLDRRTGY
RBM4_RABIT      IRNLHHYKLHGVNINV---EASKNKSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIV--------
RBM4_MOUSE      IRNLHHYKLHGVNINV---EASKNKSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIV--------
RBM4B_RAT       IRNLHHYKLHGVNINV---EASKNKSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIV--------
RBM4B_PIG       IRNLHHYKLHGVNINV---EASKNKSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIV--------
RBM4B_MOUSE     IRNLHHYKLHGVNINV---EASKNKSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIV--------
RBM4B_HUMAN     IRNLHHYKLHGVNINV---EASKNKSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIV--------
NOP12_ASHGO     --------------------AHPAPHDRKRSVFVGNLDFEESEESLWKHFMSCGPIEYV-RIVRDPKTNV
EIF3G_YARLI     ---------------------------------VTNLSEEATDDDLRRMFGKYGMINRV-YVAKDRDTGR
DAZL_CHICK      VE--SQISVHGKRLKLGPAIRKQQNL--------------------------------------------
ZCRB1_XENLA     VRGLNNKQLFGRAIKASIA---------------------------------------------------
TADBP_CHICK     MSQRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTADELQQFFAQYGEVVDVPKPFR------
SFRS5_RAT       ----------------------------GCRVFIGRLNPAAREKDVERFFKGYGRI-------RDID--L
SFRS5_HUMAN     ----------------------------GCRVFIGRLNPAAREKDVERFFKGYGRI-------RDID--L
RBM8A_SALSA     -------------------------------LFVTGVHEEATEEDIHDKFAEFGEIKNL-HLNLDRRTGY
RBM46_MACFA     RRKLGTFQLWGHTIQVDWADPEEETMQRVKVLYVRNLMISTTEETIKAEFNKFGAVERVKKL--------
RBM46_HUMAN     RRKLGTFQLWGHTIQVDWADPEEETMQRVKVLYVRNLMISTTEETIKAEFNKFGAVERVKKL--------
RBM42_DANRE     -------------------------------IFCGDLGNEVNDDILARAFSRYPSFLKA-KVVRDKRTGK
RBM18_XENLA     ----------------NASILSEGSLQDGHRLWIGNVDPKITEYHLLKLLQKFGKVKQFDFLFHKSGEGQ
PES4_YEAST      XXXLNYTKVNGKEIRIMRNTTFRKNF--GTNVFFSXXXXXXTTRVFYDTFSRYGKILSC-----KLDSRK
NOP12_YARLI     YIVFKNVKSVKGALTLNDSVAHPGAQDHKRCVFVGALDFEEQEESLWEAFSSCGDVEYV-RIVRDPKTNV
NCBP2_XENLA     MRFINGTRLDDRIVRTDWDAGFKEGRQYG-----------------------------------------
MRD1_EMENI      -----------------------ENIRISARLFVRNLSYETKESELEPVFSPFGKIEEI-HVAFDTRFTT
EI3G1_DROYA     IEILN-----------------------------------------------------------------
EI3G1_DROWI     IEILN-----------------------------------------------------------------
EI3G1_DROVI     IEILN-----------------------------------------------------------------
EI3G1_DROSI     IEILN-----------------------------------------------------------------
EI3G1_DROSE     IEILN-----------------------------------------------------------------
EI3G1_DROPS     IEILN-----------------------------------------------------------------
EI3G1_DROPE     IEILN-----------------------------------------------------------------
EI3G1_DROMO     IEILN-----------------------------------------------------------------
EI3G1_DROME     IEILN-----------------------------------------------------------------
EI3G1_DROGR     IEILN-----------------------------------------------------------------
EI3G1_DROER     IEILN-----------------------------------------------------------------
EI3G1_DROAN     IEILN-----------------------------------------------------------------
ZCRB1_RAT       -----------------------------STVYVSNLPFSLTNNDLYRIFSKYGKVVKVT-IMKDKDTRK
ZCRB1_MOUSE     -----------------------------STVYVSNLPFSLTNNDLYRIFSKYGKVVKVT-IMKDKDTRK
RBM8A_XENTR     -------------------------------LFVTGVHEEATEEDIHDKFGEFGEIKNI-HLNLDRRTGF
RBM47_CANFA     RRKLGRIQLWGHQIAVDWAEPEEDVMETVKILYVRNLMIETTEDTIKKSFGQFGCVERVKKI--------
NOP13_YEAST     -------------------------------LFVGNLSFDVTDDLLRKHFQHCGDIVKI-RMATFEDSGK
NCBP2_ORYSJ     VKYISGTMLDDRPIRVD-----------------------------------------------------
MK67I_BOVIN     ----------------------EKQKPTPGVIYVGHLPPTLYETQIRAYFSQFGTVTRF-RLSRSKKTGN
LARP7_RAT       IEFLN-----------------------------------------------------------------
LARP7_MOUSE     IEFLN-----------------------------------------------------------------
LARP7_MACFA     IEFLN-----------------------------------------------------------------
LARP7_HUMAN     IEFLN-----------------------------------------------------------------
EI3G2_DROAN     IEILN-----------------------------------------------------------------
RSP31_ARATH     IRKLDNFPFRGRPRGDAKAPS---NLKPTKTLFVINFDPRTKEHDIEKHFEPYGKVTNV-RIRRN-----
RB8AB_XENLA     -------------------------------LFVTGVHEEATEEDIHDKFGEFGEIKNI-HLNLDRRTGF
RB8AA_XENLA     -------------------------------LFVTGVHEEATEEDIHDKFGEFGEIKNI-HLNLDRRTGF
NOP12_YEAST     ---LNAVVFQDHHLRVDSV-AHPAPHDKKRSIFVGNLDFEEIEESLWKHFEPCGDIEYV-RIIRDSKTNM
NCBP2_YEAST     LKYLSDTKLDEKTITIDLDPGFEDGRQFGR----GKSGGQVSDELRFD----------------------
NCBP2_DANRE     MRFVNGTRLDDRIIRTDWDAGFKEGRQYG-----------------------------------------
EIF3G_MAGGR     -----------------------------ATLRVTNVSEMAEEQELRDMFERFGRVTRV-FLAKDRDTGL
EI3G2_DROYA     IEVLN-----------------------------------------------------------------
U2AF2_DROME     IAGLNGMQLGDKKLIVQRASVGAK----------------------------------------------
TADBP_MOUSE     MSQRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTAEELQQFFCQYGEVVDVPKPFR------
RBM8A_RAT       -------------------------------LFVTGVHEEATEEDIHDKFAEYGEIKNI-HLNLDRRTGY
RBM8A_MOUSE     -------------------------------LFVTGVHEEATEEDIHDKFAEYGEIKNI-HLNLDRRTGY
RBM8A_HUMAN     -------------------------------LFVTGVHEEATEEDIHDKFAEYGEIKNI-HLNLDRRTGY
RBM8A_BOVIN     -------------------------------LFVTGVHEEATEEDIHDKFAEYGEIKNI-HLNLDRRTGY
RB15B_MOUSE     ------------------------------NLFIGNLDHSVSEVELRRAFEKYGIIEEV--VIKRPARGQ
NOP12_KLULA     ---------------------HPSPHDKRRSVFVGNLDFEEVEESLWKHFEPCGDIEYV-RIIRDSKTNM
NCBP2_RAT       MRYINGTRLDDRIIRTD-----------------------------------------------------
NCBP2_MOUSE     MRYINGTRLDDRIIRTD-----------------------------------------------------
NCBP2_HUMAN     MRYINGTRLDDRIIRTD-----------------------------------------------------
NCBP2_BOVIN     MRYINGTRLDDRIIRTD-----------------------------------------------------
MK67I_XENTR     -------------------------------IYIGHIPRALYEPQLREYFSQFGTVTRL-RLSRSKKTGN
EIF3G_CANAL     --------------------------DDSTTLKVSQLNSFVDEDMLRELFAKFGPLQRVT-IVRNRETGE
EIF3G_ANOGA     IEVLN-----------------------------------------------------------------
SFRS5_MOUSE     ----------------------------GCRVFIGRLNPAAREKDVERFFKGYGRI-------RDID--L
RBM42_XENLA     -------------------------------IFCGDLGNEVNDDILARAFSRYPSFLRA-KVIRDKRTGK
NCBP2_XENTR     MRFINGTRLDDRIIRTDWDAGFKEGRQYG-----------------------------------------
NCBP2_SCHPO     LKYISRTSLDERIIRADLDHGYEEGRQYGRGASGGQVRDEMREE--------------------------
NCBP2_ESOLU     MRFVNGTRLDDRIIRTDWDAGFKEGRQYG-----------------------------------------
NCBP2_CAEEL     LQNISNTRMDDRVIRAD-----------------------------------------------------
NCBP2_CAEBR     LQNISNTRMDDRVIRAD-----------------------------------------------------
LARP7_DANRE     VEMLN-----------------------------------------------------------------
EI3G2_DROWI     IEILN-----------------------------------------------------------------
ZCRB1_DANRE     SRSLNNKQLFGRMVKASIA---------------------------------------------------
TRA2A_MOUSE     ------------------------NPDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGV-NVVYDQRTGR
TRA2A_HUMAN     ------------------------NPDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGV-NVVYDQRTGR
RBM46_XENTR     RRKLGPFQLWGHTIKVAWASPEEETMQKVKVLYVRNLMMSTTEETIKAEFNRYGVVERVKKI--------
RBM15_HUMAN     ----------------------EDDQRANRTLFLGNLDITVTESDLRRAFDRFGVITEVD--IKRPSRGQ
PABPX_SCHPO     -------------------------------LYVKNLDDTVIKSQLEDLFSPFGSILS-SMLACYPNSGI
EIF3G_PHANO     ---------YVPPHLRGRAGAGEKDRDDSATLRVTNVSEFAEEQDLRDMFSRYGHVTRV-FLAKDRETGR
EI3G2_DROVI     IEILN-----------------------------------------------------------------
EI3G2_DROGR     VEVLN-----------------------------------------------------------------
EI3G2_DROER     IEVLN-----------------------------------------------------------------
DAZL_XENTR      VK--SQINFHGKKLKLGPA---------------------------------------------------
BOLL_MACFA      LQEAEKLNYKDKKLNIGPA---------------------------------------------------
BOLL_HUMAN      LQEAEKLNYKDKKLNIGPA---------------------------------------------------
NCBP2_SALSA     MRFVNGTRLDDRIIRTDWDAGFKEGRQYG-----------------------------------------
NCBP2_CULQU     MRYINGTRLDDRIVRVD-----------------------------------------------------
MSI2H_MOUSE     -KVLGQHELDSKTIDPKVARAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKV-EDAMLMFDKTTNR
MSI2H_HUMAN     -KVLGQHELDSKTIDPKVARAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKV-EDAMLMFDKTTNR
MK67I_XENLA     -------------------------------IYIGHIPKSLIEPQLQEYFNQFGTVTRL-RLSRSKKTGN
IF2B3_HUMAN     IEALSKIELHGKPIEVEHSVPKRQRI---RKLQIRNIPPHLQWEVLDSLLVQYGVVESCEQVNTDSETAV
EIF3G_PICST     ----------------------KEGRDDSTTLKVSQLNSFVDEDMLRELFARFGPLQRVT-LVRNRETGD
DAZL_MACFA      VE--SQINFHGKKLKLGPA---------------------------------------------------
DAZL_HUMAN      VE--SQINFHGKKLKLGPA---------------------------------------------------
YKX5_SCHPO      IEKLNGYRYGGRPLQLSYA---------------------------------------------------
RSP3_CAEEL      -------------------------------VYVGNLPGDVREKEVEDIFHKYGRIKYV-----DIKSGR
RBM46_DANRE     RRKLGTFQLWGHTIQVDWAEPEEETMQRVRVLYVRNLMLSTTEETLRSEFSQLGSVERVKKLT-------
NCBP2_AEDAE     MRYINGTRLDDRIVRVD-----------------------------------------------------
EIF3G_XENTR     I---------------------------------------------------------------------
EIF3G_RAT       I---------------------------------------------------------------------
EIF3G_MOUSE     I---------------------------------------------------------------------
EIF3G_HUMAN     I---------------------------------------------------------------------
EIF3G_BOVIN     I---------------------------------------------------------------------
EI3GB_XENLA     I---------------------------------------------------------------------
EI3GA_XENLA     I---------------------------------------------------------------------
EI3G2_DROMO     IEILN-----------------------------------------------------------------
DAZL_MOUSE      VE--SQINFHGKKLKLGPA---------------------------------------------------
YQL5_SCHPO      IK---------KKVSENKNLQKKKGV-----LYVGRLPHGFYEKQMRMYFSQFGPVLRL-RMSRNRKTGS
MK67I_RAT       AETMDNY-LFGERLLSCKFMPREK----------------------------------------------
GBP2_YEAST      ISKFDMVRQDNPPPEAAKEKATREEIDNGFEVFIINLPYSMNWQSLKDMFKECGHVLRA-----DVENGF
EIF3G_CULQU     IELLN-----------------------------------------------------------------
EIF3G_AEDAE     IELLN-----------------------------------------------------------------
DAZL_CALJA      VE--SQINFHGKKLKLGPA---------------------------------------------------
DAZLA_XENLA     VK--SQISFHGKKLKLGPA---------------------------------------------------
SR140_MOUSE     --------------------------DVGTNLYLGNINPQMNEEMLCQEFGRFGPLASV-KIMTDEERAR
RNPS1_DANRE     LKHMDGGQIDGQEI--------------------------------------------------------
RBM47_PONAB     RRKLGRIQLWGHQIAVDWAEPEEDVMETVKILYVRNLMIETTEDTIKKSFGQFGCVERVKKI--------
RBM47_HUMAN     RRKLGRIQLWGHQIAVDWAEPEEDVMETVKILYVRNLMIETTEDTIKKSFGQFGCVERVKKI--------
MK67I_HUMAN     -------------------------------VYVRHLPNLLDETQIFSYFSQFGTVTRF-RLSRSKRTGN
EIF3G_SCLS1     -----------------------------ATLRVTNVSEMAEEQELRDMFERFGRVTRV-FLAKDRETGL
EIF3G_NEUCR     -----------------------------ATLRVTNVSEMAEEQELRDMFERFGRVTRV-FLAKDRDTGL
EIF3G_CHAGB     -----------------------------ATLRVTNVSEMAEEQELRDMFERFGRVTRV-FLAKDRDTGM
EIF3G_BOTFB     -----------------------------ATLRVTNVSEMAEEQELRDMFERFGRVTRV-FLAKDRETGL
EIF3B_ANOGA     VKSLNNYRLKHYTLLVNRFADFQKYSDI------------------------------------------
EI3G2_DROSI     IEVLN-----------------------------------------------------------------
EI3G2_DROSE     IEVLN-----------------------------------------------------------------
EI3G2_DROME     IEVLN-----------------------------------------------------------------
DAZLB_XENLA     VK--SQISFHGKKLKLGPA---------------------------------------------------
BOLL_MOUSE      LQEAEKLNYKDKKLNIGPA---------------------------------------------------
TCG1_SCHPO      -------------------------------VFVGRLSTSTKKSEIRSLFETVGTVRKVTIPFRRVRRGT
SPEN_DROME      LEVSHDKHFFGCKIEVNEFRPYEAELDETRTLFIGNLEKDITAGELRSHFEAFGEIIEI-----DIKKQG
PPIL4_CRYNE     -------------------------------LFVCKLNPVTQDEDLELIFSRFGKILSC-EVVRDKKSGD
NCBP2_BOMMO     MRYINGTRLDDRIIR-------------------------------------------------------
NCBP2_ANOGA     MRYINGTRLDDRIVRVD-----------------------------------------------------
EIF3G_DANRE     I---------------------------------------------------------------------
CAZ_DROME       -------------------------------IFVSGMDPSTTEQDIETHFGAIGIIKKDKRTMKNKETGA
NOP15_YEAST     QESMNNYLLMGHLLQV------------------------------------------------------
NOP12_CANAL     AKELNATVFEDHHLRVDHVS-HPAPKDNKRTIFVGNLDFEEKEETLWKYFSKLDQDVESVRIIRDSKTNL
HRP65_CHITE     KKDLDGRMRKNKPIRIRFAPN-------ATTIRVKNLTPFVSNELLFKSFEVFGQVERAVIIVD--DRGK
EIF3B_CULQU     VKAFNNYRLKSHTLLVNLFSDFQKYSDI------------------------------------------
TRA2B_RAT       ------------------------NPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADV-SIVYDQQSRR
TRA2B_MOUSE     ------------------------NPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADV-SIVYDQQSRR
TRA2B_HUMAN     ------------------------NPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADV-SIVYDQQSRR
TRA2B_BOVIN     ------------------------NPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADV-SIVYDQQSRR
SR140_PONAB     --------------------------DVGTNLYLGNINPQMNEEMLCQEFGRFGPLASV-KIMTDEERAR
SR140_HUMAN     --------------------------DVGTNLYLGNINPQMNEEMLCQEFGRFGPLASV-KIMTDEERAR
RBM41_DANRE     IQNLHHYMLNGMAMNVEMSKGKPK---TSTKLHVGNISSSCTNQELRAKFEEYGPV---------VECDI
PM14_DROME      ---------------MNKRNHIRLPPEVNRLLYVRNLPYKITSDEMYDIFGKFGAIRQI----RVGNTPE
EI3G2_DROPS     IEILN-----------------------------------------------------------------
EI3G2_DROPE     IEILN-----------------------------------------------------------------
YBKC_SCHPO      LERQSTQRLIGNPISLDVVPEWQKPSYY--MLFISNIDPEVSENDIKYLFQRYNFI--SARVLRCVD-GT
RX21_DROME      CDILNGSELLGSQLRV------------------------------------------------------
REXON_RAT       IETMNGTILEGSCIRVHRXXXXEQDSENQGTIYVAGIGETFKEHLLEQ--SNLFPDLEAVILPKELKSRK
PPIL4_ASPOR     -------------------------------LFVCKLNPVTQDEDLHLIFSRFGTILSC-EVIRDKRTGD
NOP12_SCHPO     --------------------SHPMPQDTKRCVFVGNLAFEAEEEPLWRYFGDCGSIDYV-RIVRDPKTNL
MUG28_SCHPO     ------------------------------NLFVKNLDDNINTQQLEELFSKFGRIKSCT-LASYPSTEI
MRD1_ASPFU      -----------------------EHIRLSSRLFVRNLPYDASESDLEPVFSKFGKIEEI-HVAFDTRSTT
IF23B_XENLA     IDTLSKVELHGKVIEVEHSVPKRQR---SRKLQIRNIPPHLQWEVLDSLLAQYGTVENCEQVNTDSETAV
HRB1_YEAST      IR--------------------------------------------------------------------
EIF3B_AEDAE     VKAFNNYRLKSHTLLVNLFSDFQKYSDI------------------------------------------
DAZ4_HUMAN      VG--SQIHFHGKKLKLGPAIRKQK----------------------------------------------
DAZ3_HUMAN      VG--SQIHFHGKKLKLGPAIRKQK----------------------------------------------
DAZ2_HUMAN      VG--SQIHFHGKKLKLGPAIRKQK----------------------------------------------
DAZ1_HUMAN      VG--SQIHFHGKKLKLGPAIRKQK----------------------------------------------
YKCG_SCHPO      VRNLNNYDAGTRRLRVDFPTADQ-----------------------------------------------
YG5B_YEAST      IKELNGRTVNGSTLFINRERIHNNNDDNFRCLFIGNLNPEKVETLI------------------------
RBM8A_DROME     -------------------------------LFVTSIHEEAQEDEIQEKFCDYGEIKNI-HLNLDRRTGF
NCBP2_SINCH     MRFINGTRLDDRIIRADWDAGFKEGRQYG-----------------------------------------
MRD1_CRYNE      XXXXXGFEIDGKSLEVKKGGDAEGGKTKSTKVLVKNLPFEATKKDVRELFSAYGQLLRLPRKAVPTSTGS
MK67I_DANRE     -------------------------------LYVGHLPRGLFEPQLKSYFEQFGKVLRL-RVSRSKKTGG
HNRPC_RAT       -------KLNGKVIDPKRAKAMKTKEPV-KKIFVGGLSPDTPEEKIREYFGGFG---EVESIELPMDNKT
SFRS6_HUMAN     -------------------------------VYIGRLSYNVREKDIQRFFSGYGRLLEVD---------L
PPIL4_RHIOR     -----------KRVRAREAKAHALTLEMIGDLFVCKLNPVTRDEDLEMIFSRFGLIHSC-EIIRDRQTGD
IF23A_XENLA     IDTLSKVELHGKVIEVEHSVPKRQR---SRKLQIRNIPPHLQWEVLDSLLAQYGTVENCEQVNTESETAV
SFRS1_ARATH     IHGRDGYDFDGHRLRVELAHGGRRSSD-------------------------------------------
RBM25_MOUSE     LRLLHDLQIGEKKLLVTKAQLDEWKAKKKANGVFKNARPE------------------------------
PABP2_DROPS     -------------------SLEEKQEIDTRSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKAD-GH
PABP2_DROME     -------------------SLEEKQEIDTRSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKAD-GH
EIF3G_NEOFI     ------------------AGKYEK--DDLATLRVTNVSELAEESELRDLFERFGRVTRV-FLARDRETQR
EIF3G_ASPFU     ------------------AGKYEK--DDLATLRVTNVSELAEESELRDLFERFGRVTRV-FLARDRETQR
EIF3G_ASPFC     ------------------AGKYEK--DDLATLRVTNVSELAEESELRDLFERFGRVTRV-FLARDRETQR
DAZL_DANRE      TIVDQPISFKGKKLKLGPAIMKERS---------------------------------------------
RU17_ARATH      YKQADGQKIDGRRVLVD-----------------------------------------------------
RBM45_HUMAN     ------------------------------------------ESVLRERFSPFGDIQDI-WVVRDKHTKE
PPIL4_NEUCR     -------------------------------LFVCKLNPVTTDEDLELIFSRFGKILSC-EVIRDQKTGD
PPIL4_EMENI     -------------------------------LFVCKLNPVTQDEDLELIFSRFGKILSC-EVIRDKRTGD
MRD1_KLULA      ISAMEGTILDGHKLQLKLSHRQXXXXXXXXXXXXXXLPFEATRKDVFELFSSFGQLKSV-RVPKKFDK-S
IF2B2_HUMAN     IETLSKVELHGKIMEVDYSVSKKLR---SRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAV
FOX1C_MOUSE     REKLNGTIVEGRKIEVNNATA-------------------------------------------------
FOX1C_HUMAN     REKLNGTIVEGRKIEVNNATA-------------------------------------------------
EIF3G_EMENI     ------------------AGKYEK--DDLATLRVTNVSELAEEQELRDLFERFGRVTRV-FLARDRETQR
EIF3G_DEBHA     -----------------------KDRDDSTTLKISQLNSIVDEDMLRNELLGRYGPFQRAIVVRNRETGE
EIF3G_COCIM     -----------------------------ATLRVTNVSELAEEGELRDMFGRFGHVTRV-FLAKDKETNM
EIF3G_ASPNC     ------------------AGKYEK--DDLATLRVTNVSELAEEGELRDLFERFGRVTRV-FLARDRETQR
EIF3G_ASPCL     ------------------AGKYEK--DDLATLRVTNVSELAEESEIRDLFERFGRVTRV-FLARDRETQR
SRR35_HUMAN     LYNLNRKWVCGRQIEIQFAQGDRK----------------------------------------------
RBM45_RAT       ------------------------------------------ESVLREHFSPFGDIQDI-WVVRDKHTKE
RBM25_HUMAN     LRLLHDLQIGEKKLLVKVDAKTKAQLD-------------------------------------------
PPIL4_ASPFU     -------------------------------LFVCKLNPVTQDEDLQLIFSRFGPILSC-EVIRDKRTGD
PAB2_SCHPO      -----------------EALRNDKESIDAQSVYVGNVDYSVTPEELQSHFASCGSVNRV-TILCDKFTGH
NOP12_DEBHA     VPKLNATEFEHAHLRVDHV-AHPAPKDNKRTIFVGNLDFEEKEETLWRYFSKTDNDVESVRVIRDAKTNV
MK67I_MOUSE     -------------------------------VYLGHLPSTLSESHIYNYCAQFGDISRF-RLSRSKRTGN
EIF3G_PICGU     -----------------------RDRDDSTTLKISQLNTFVDEDMLRNELLKRFHPLQRVTIVRNRETGE
EIF3G_CAEBR     IAELNDIRMYHMVLKV------------------------------------------------------
EIF3G_ASPOR     -----------------------------ATLRVTNVSELAEEGELRDLFERFGRVTRV-FLARDRETQR
RU17_YEAST      ---------------------HIKDTDPYRTIFIGRLPYDLDEIELQKYFVKFGEIEKI-RIVKDKITQK
RBM45_MOUSE     ------------------------------------ISKHTSELVLRERFSPFGDIQDI-WVVRDKHTKE
PM14_SCHPO      ------------------------NQEVNSILFIKNLSFKITAEEMYDLFGRYGPVRQI----RLGNTVQ
IF2B3_DANRE     IDTLSKVELHGKVLEVEHSVPKRQR---SCKLQIRNIPPHMQWEVLDGLLAQYGTVESCEQVNTDTETAV
IF2B3_CHICK     IEALSKVELHGKLIEVEHSVPKRQR---SRKLQIRNIPPHLQWEVLDSLLAQYGTVENCEQVNTDTETAV
IF2B2_PONAB     IETLSKVELHGKIMEVDYSVSKKLR---SRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAV
HNRPC_XENLA     ---------------------------MNSRVFIGNLNTLVVKKTDVEAFSKYGKI---------VGCSV
FOX1L_DANRE     -------------------------------LHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGS--
EIF3G_VANPO     -----------------------RERDDMATLKITQLNENADETTLREELLPFGNIPRVV-VVRNRETGR
EIF3G_BRUMA     IQKLNGYKLDHLVLKV------------------------------------------------------
TRA2_DICDI      KEECQDLQLHGKSIRTD-FSATKKPHEPTPGKYFGN--PRYDSRRSPPRFS-------------------
SFRS6_BOVIN     -------------------------------VYIGRLSYNVREKDIQRFFSGYGRLLGID---------L
RU1A_SCHPO      LKDLQGYPLYGKPMMI------------------------------------------------------
RBM38_CHICK     CKDPNPI-IDGRKANVNLAGAKPRSIQTGFTIGVQQLHP-------------------------------
PM14_CAEEL      --------------------------EVNRILYIKNLPYKITTEEMYEIFGKFGAVRQI----RVGNTAE
MODU_DROME      LK-LHSTELFSRFITVRRISQESISRTSELTLVVENVHESYSSDALEKIFKKFGDV-------EEIDVVC
FUSIP_MOUSE     LHNLDRKWICGRQIEIQFAQGDRK----------------------------------------------
FUSIP_HUMAN     LHNLDRKWICGRQIEIQFAQGDRK----------------------------------------------
RNPS1_XENTR     -------------------------------VHIGRLTRNVTKDHILEIFSTYGKIKMIDMPVDRYHPHL
RNP1B_XENLA     -------------------------------VHIGRLTRNVTKDHILEIFSTYGKIKMIDMPVDRYHPHL
RNP1A_XENLA     -------------------------------VHIGRLTRNVTKDHILEIFSTYGKIKMIDMPVDRYHPHL
NONA_DROME      KRALDGSMRKGRQLRVRFAP--------NATILVSNLTPFVSNELLYKSFEIFGPI-ERASITVD-DRGK
EPA2B_XENLA     -------------------SAEEKKEIDKRSVYVGNVDYGSTAQDLEAHFSSCGSINRIT-ILCDKFSGH
EIF3G_BOMMO     IQSLN-----------------------------------------------------------------
EIF3G_ASPTN     ------------------AGKYEK--DDLATLRVTNVSELAEEGELRDLFERFGRVTRV-FLARDRETQR
EIF3B_LODEL     -------------------------------------------KVLRKLFSTAGEIVEGDEIFMPMENGK
CELF4_XENTR     -------------------------------LFIGQIPRNLDEKDLKPLFEEFGKIYEL-TVLKDRFTGM
YGR4_SCHPO      SKALKFHHTIYKERKIN-----------------------------------------------------
YFH9_SCHPO      ----------------------------GYIIIVTGVHPEATEEQVEDLFADFGPVKNL-HLNLDRRTGY
SNRPA_XENLA     -------------------------------IYINNLNEKIKKKSLYAIFSQFGQILDI-LVSRNLKM--
SFRS4_MOUSE     -------------------------------VYIGRLSYQARERDVERFFKGYGKILEVD---------L
SFRS4_HUMAN     -------------------------------VYIGRLSYQARERDVERFFKGYGKILEVD---------L
RBM38_XENLA     CKDPNPI-IDGRKANVNLAGAKPRNLQSAFTIGVQQLHP-------------------------------
RALY_MOUSE      -------------LKIQTSNVTNKNKSINSRVFIGNLNTAVVKKSDVETFSKYG---------RVAGCSV
PPIL4_SCHPO     -------------------------------LFVCKLNPVTQDEDLELIFSRFGKIISC-QVIRDKETGD
NCBP2_DROWI     -------------------SEQERSLKESCTLYVGNLSFYTTEEQIHELFSRCGDVRLIVMGL-DKYKKT
IF2B3_MOUSE     IEALSKMELHGKPMEVEHSVPKRQRI---RKLQIRNIPPHLQWEVLDSLLVQYGVVESCEQVNTDSETAV
RSP4_CAEEL      LDRTDGKLVDGRELRVTLA---------------------------------------------------
RNPS1_RAT       -------------------------------VHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHL
RNPS1_PONAB     -------------------------------VHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHL
RNPS1_MOUSE     -------------------------------VHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHL
RNPS1_MACFA     -------------------------------VHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHL
RNPS1_HUMAN     -------------------------------VHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHL
RNPS1_BOVIN     -------------------------------VHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHL
RBM38_HUMAN     CKDPNPI-IDGRKANVNLAGAKPRSLQTGFAIGVQQLHPTLIQR--------------------------
RBM24_DANRE     CKDPNPI-IDGRKANVNLAGAKPRVMQPGFTFGVPQIHP-------------------------------
PPIL4_GIBZE     -------------------------------LFVCKLNPVTGDEDLELIFGRFGKILSC-EVIRDQKTGD
RU17_SCHPO      YKASAGLMLNGRRIVVD-----------------------------------------------------
RBM41_HUMAN     -------------------------------LYLKNLSPRVTERDLVSLFARFQE-KKGPPIQFRMMTGR
NOL8_HUMAN      -------------------------------LYVGGLSQDISEADLQNQFSRFGEVSDVEIITRKDDQGN
NCBP2_DROMO     -------------------SEQERSLRDSSTLYVGNLSFYTTEEQIHELFSRCGDV-RIIVMGLDKYKKT
NCBP2_DROAN     -------------------SEQERSLRDSTTLYVGNLSFYTTEEQIHELFSRCGDV-RVIVMGLDKYKKT
FOX1A_PONAB     -------------------SENTENKSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGS--
FOX1A_MOUSE     REKLHGTVVEGRKIEVNNATA-------------------------------------------------
FOX1A_MACFA     -------------------SENTENKSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGS--
FOX1A_HUMAN     -------------------SENTENKSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGS--
U1SBP_HUMAN     -------------------------------LFVARLNLQTKEDKLKEVFSRYGDIXXXXXXXXXX-TGF
SNRPA_MOUSE     -------------------------------IYINNLNEKIKKKSLYAIFSQFGQILDVSRIMK------
SFRS9_RAT       LRKLDDTK--------------------------------------------------------------
SFRS9_MOUSE     LRKLDDTK--------------------------------------------------------------
RNP4F_DROME     ---------------------YSPNMEIN-KIFVRNLHPACSKEELHELFSPFGTIKDVRLVHK-----L
PPIL4_MOUSE     -------------------------------LFVCKLNPVTTDEDLEIIFSRFGPIRSC-EVIRDWKTGE
PPIL4_HUMAN     -------------------------------LFVCKLNPVTTDEDLEIIFSRFGPIRSC-EVIRDWKTGE
NOP4_YEAST      LAKARKTKFNGHILRVDIAKRRDRSKKTSE--VVEKSTPESSEKI-------------------------
NCBP2_DROGR     -------------------SEQERSLRDSTTLYVGNLSFYTTEEQIHELFSRCGDV-RIIVMGLDKYKKT
NCB2B_DROVI     -------------------SEQERSLRDSTTLYVGNLSFYTTEEQIHELFSRCGDV-RIIVMGLDKYKKT
MRD1_USTMA      -----------------------------SRLIVRGLPSYLTDARLREHFSQKGAVTDV-KLMRRPD-GT
MINT_MOUSE      LTASKGKLFFGMQIEVNEFRPLDERIDATRTLFIGNLEKTTTYHDLRNIFQRFGEIV-------DIDIKK
IF2B1_DANRE     IETFSKVELHGKRIEVEHSVPKKQRT---RKLQIRNIPPHLQWEVLDGLLAQYGTVENCEQVNTDSETAV
FOX1A_DANRE     REKLHGTVVEGRKIEVNNATA-------------------------------------------------
EPA2A_XENLA     -------------------SAEEKKEIDKRSVYVGNVDYGGTAQDLEAHFSSCGSINRIT-ILCDKFSGH
EIF3G_ASHGO     -------------------------------------------------------------VVRNKETGR
CIP2_SCHPO      -------------------------------IVIKNIPFSLKKEVLFKVFTA----LDIPRFNYHFDNGV
RBM7_BOVIN      -------------------------------LFVGNLETKVTEELLFELFHQAGPVIKV-KIPKDKD-GK
RBM11_HUMAN     -------------------------------VFVGNLEARVREEILYELFLQAGPLTKV-TICKDRE-GK
PPIE_DROME      -------------------------------IYVGGLADEVTERLLNNAFIPFGDIADI-QMPADYESQR
PPIE_PONAB      -------------------------------LYVGGLAEEVDDKVLHAAFIPFGDITDI-QIPLDYETEK
PPIE_MOUSE      -------------------------------LYVGGLAEEVDDKVLHAAFIPFGDITDI-QIPLDYETEK
PPIE_HUMAN      -------------------------------LYVGGLAEEVDDKVLHAAFIPFGDITDI-QIPLDYETEK
PPIE_BOVIN      -------------------------------LYVGGLAEEVDDKVLHAAFIPFGDITDI-QIPLDYETEK
RBY1A_MOUSE     -------------------------------IFIGGLNIKTRQKTLQEIFGRFGPVARVI-LMRDRETKK
RBY1B_MOUSE     --------------------------DQPGKIFIGGLNIKTRQKTLQEIFGRFGPVARVI-LMRDRETKK
GRP2_SINAL      IEGMNGQDLDGRSITVNEA---------------------------------------------------
GRP1_SINAL      IEGMNGQDLDGRSITVNEA---------------------------------------------------
RT19_ARATH      ISAMNGQELNGFNISVNVA---------------------------------------------------
HNRPG_BOVIN     VRDMNGKSLDGKAIKVAQAT--------------------------------------------------
GRP7_ARATH      IEGMNGQDLDGRSITVNEA---------------------------------------------------
RBPE_ANASP      ------------------------------SIYVGNLSYSVTQDDLTKVFSEYGSVTRV-QLPTDRETGR
RBM3_HUMAN      MRAMNGESLDGRQIRVD-----------------------------------------------------
RBM3_MOUSE      MRAMNGESLDGRQIRVD-----------------------------------------------------
RBY1F_HUMAN     --------------------------DHPGKLFIGGLNRETNEKMLKAVFGKHGPISEV-LLIKDRTS-K
RBPB_ANASP      ------------------------------SIYVGNLSYDVTEESLNAVFAEYGSVKRV-QLPVDRETGR
YHOC_SCHPO      MENMNYSILCDRCIRVSPAN--------------------------------------------------
RBY1E_HUMAN     --------------------------DHPGKLFIGGLNRETNEKMLKAVFGKHGPISEV-LLIKDRTS-K
RBY1D_HUMAN     --------------------------DHPGKLFIGGLNRETNEKMLKAVFGKHGPISEV-LLIKDRTS-K
RBY1B_HUMAN     --------------------------DHPGKLFIGGLNRETNEKMLKAVFGKHGPISEV-LLIKDRTS-K
RBY1A_HUMAN     --------------------------DHPGKLFIGGLNRETNEKMLKAVFGKHGPISEV-LLIKDRTS-K
HNRGT_MACFA     ARDMNGKSLDGKAIKVAQAT--------------------------------------------------
HNRGT_HUMAN     ARDMNGKSLDGKAIKVAQAT--------------------------------------------------
GRP8_ARATH      IEEMNGKELDGRVITVNEAQS-------------------------------------------------
RMXL3_HUMAN     ARDMNGKYLDGKAIMV------------------------------------------------------
CSTF2_PONAB     ------------------------------SVFVGNIPYEATEEQLKDIFSEVGPVVSF-RLVYDRETGK
CSTF2_MOUSE     ------------------------------SVFVGNIPYEATEEQLKDIFSEVGPVVSF-RLVYDRETGK
CSTF2_HUMAN     ------------------------------SVFVGNIPYEATEEQLKDIFSEVGPVVSF-RLVYDRETGK
CSTF2_BOVIN     ------------------------------SVFVGNIPYEATEEQLKDIFSEVGPVVSF-RLVYDRETGK
HNRPG_PANTR     --------------------------DRPGKLFIGGLNTETNEKALEAVFGKYGRIVEV-LLMKDRETNK
HNRPG_HUMAN     --------------------------DRPGKLFIGGLNTETNEKALEAVFGKYGRIVEV-LLMKDRETNK
EIF3G_NEMVE     --------------------------DETATIRVTNLSEETRESDLQELFRPLGPISRI-FLAKDKFTNQ
RBPD_ANASP      -------------------------------IYVGNLSYRATEADLKAVFADYGEVKRVV-LPTDRETGR
HNRPG_RAT       ARDMNGKSLDGKAIKVEQAT--------------------------------------------------
GRPA_MAIZE      IENMNGKELDGRNITVNQAQS-------------------------------------------------
GRP2_SORBI      IENMNGKELDGRNITVNQAQS-------------------------------------------------
GRP1_DAUCA      IEGMNGQELDGRNITVNEAQS-------------------------------------------------
RMXL3_PANTR     ARDMNGKYLDGKAIMV------------------------------------------------------
HNRPG_MOUSE     --------------------------DRPGKLFIGGLNTETNEKALEAVFGKYGRIVEII-LMKDRETNK
GRP2_ARATH      ISEMDGKELNGRHIRVNPAN--------------------------------------------------
GRP10_BRANA     IDEMNGKELDGRTITVNEAQS-------------------------------------------------
CSTFT_MOUSE     MRNLNGREFSGRALRVDNA-ASEKNKE-------------------------------------------
CSTFT_HUMAN     MRNLNGREFSGRALRVDNA-ASEKNKE-------------------------------------------
RBPF_ANASP      ------------------------------SIYVGNLSYEVTQEDISNVFAEYGSVKRVV-LPTDRETGR
IST3_YEAST      VDNLNGFKIGGRALKID-----------------------------------------------------
CIRBP_RAT       -------------------------------LFVGGLSFDTNEQALEQVFSKYGQISEVV-VVKDRETQR
CIRBP_MOUSE     -------------------------------LFVGGLSFDTNEQALEQVFSKYGQISEVV-VVKDRETQR
CIRBP_CRIGR     -------------------------------LFVGGLSFDTNEQALEQVFSKYGQISEVV-VVKDRETQR
CIRBP_XENLA     -------------------------------LFIGGLNFETNEDCLEQAFTKYGRISEVV-VVKDRETKR
CIRBP_PONAB     -------------------------------LFVGGLSFDTNEQSLEQVFSKYGQISEVV-VVKDRETQR
CIRBP_HUMAN     -------------------------------LFVGGLSFDTNEQSLEQVFSKYGQISEVV-VVKDRETQR
GRP1_SORBI      IEGMNGKELDGRNITVNEAQS-------------------------------------------------
EIF3G_CAEEL     ---------------------------------VTNLPQEMNEDELRDLFGKIGRVIRI-FIARDKVTGL
EIF3G_DICDI     LKQLN-----------------------------------------------------------------
RNA15_YEAST     VRNLNGYQLGSRFLKCGYSS--------------------------------------------------
LARP7_XENTR     ----------------------EKPQDVDSRVYVELLPKNVTHSWIERVFGKYGMVVYV-SIPRYKSTGD
RBM42_RAT       MREMNGKYVGSRPIKLRKSMWKDRNLDV------------------------------------------
RBM42_MOUSE     MREMNGKYVGSRPIKLRKSMWKDRNLDV------------------------------------------
RBM42_HUMAN     MREMNGKYVGSRPIKLRKSMWKDRNLDV------------------------------------------
RBM42_BOVIN     MREMNGKYVGSRPIKLRKSMWKDRNLDV------------------------------------------
NCBP2_ARATH     ----------------------DEALRASTTVYIGNVSFYTTEEQLYELFSRAG---EIKKIIMGLDKNT
NCBP2_IXOSC     -------------------SEQERLLRLSTTLYVGNMSFYTTEEQIYELFSKCG---DVKKVIMGLDHKT
ZCRB1_HUMAN     TRAINNKQLFGRVIKASIA---------------------------------------------------
ZCRB1_BOVIN     TRAINNKQLFGRVIKASIA---------------------------------------------------
RBM42_XENTR     -------------------------------IFCGDLGNEVNDDILARAFSRYPSFLRA-KVIRDKRTGK
CTF1_SCHPO      ------------------------SMTAGNVVFVGNIPYDVSEQQMTEIFNQVGPV-KTFKLVLDPETGS
RBM8A_DANRE     MEGLNGQELMGQPISVD-----------------------------------------------------
ZCRB1_XENLA     -----------------------------STVYVSNLPFSLTNNDLHRIFSKYGKVVKVT-ILKDKDSRK
RBM8A_SALSA     MEGLNGQDMMGQPISVD-----------------------------------------------------
RBM42_DANRE     MREMNGRYVGSRPIKLRKSAWKDRNLEV------------------------------------------
ZCRB1_RAT       TRAINNKQLFGRVIKASIA---------------------------------------------------
ZCRB1_MOUSE     TRAINNKQLFGRVIKASIA---------------------------------------------------
RBM8A_XENTR     MEGLNGQDLMGQPISVD-----------------------------------------------------
NOP13_YEAST     LKDKSCRKIAGRPLRMEYGEDRSK----------------------------------------------
MK67I_BOVIN     AETMN-----------------------------------------------------------------
RB8AB_XENLA     MEGLNGQDLMGQPVSVD-----------------------------------------------------
RB8AA_XENLA     MEGLNGQDLMGQPVSVD-----------------------------------------------------
EIF3G_MAGGR     VKACNKMDGWG-----------------------------------------------------------
RBM8A_RAT       MEGLNGQDLMGQPISVD-----------------------------------------------------
RBM8A_MOUSE     MEGLNGQDLMGQPISVD-----------------------------------------------------
RBM8A_HUMAN     MEGLNGQDLMGQPISVD-----------------------------------------------------
RBM8A_BOVIN     MEGLNGQDLMGQPISVD-----------------------------------------------------
NCBP2_RAT       ----------------------EKLLKKSCTLYVGNLSFYTTEEQIYELFSKSG---DIKKIIMGLDKKT
NCBP2_MOUSE     ----------------------EKLLKKSCTLYVGNLSFYTTEEQIYELFSKSG---DIKKIIMGLDKKT
NCBP2_HUMAN     ----------------------EKLLKKSCTLYVGNLSFYTTEEQIYELFSKSG---DIKKIIMGLDKKT
NCBP2_BOVIN     ----------------------EKLLKKSCTLYVGNLSFYTTEEQIYELFSKSG---DIKKIIMGLDKKT
MK67I_XENTR     ADTMN-----------------------------------------------------------------
EIF3G_CANAL     LDTFN-----------------------------------------------------------------
EIF3G_ANOGA     -----------------------RGRDDTSAIRISNLSEAMTEADLEELVKKFGPHTKM-FLSRDKSTGL
RBM42_XENLA     TREMNGKYVGSRPIKLRKSQWKDRNIDV------------------------------------------
TRA2A_MOUSE     MERANGMELDGRRIRVD-----------------------------------------------------
TRA2A_HUMAN     MERANGMELDGRRIRVD-----------------------------------------------------
EIF3G_PHANO     ----------------------------------------------------------------------
EIF3G_PICST     LDALN-----------------------------------------------------------------
DAZL_MACFA      -------------------------------VFVGGIDVRMDETEIRSFFARYGSVKEV-KIITD-RTGV
DAZL_HUMAN      -------------------------------VFVGGIDVRMDETEIRSFFARYGSVKEV-KIITD-RTGV
NCBP2_AEDAE     -----------------KGSRHEQELRLTSTLYIGNLSFYTTEEQIHELFSRCGDIRRIVMGL-DKFKKT
EIF3G_XENTR     -----------------------RRADDNATIRVTNLSEDTRETDLQELFRPFGSISRI-YLAKDKTTGQ
EIF3G_RAT       -----------------------RRADDNATIRVTNLSEDTRETDLQELFRPFGSISRI-YLAKDKTTGQ
EIF3G_MOUSE     -----------------------RRADDNATIRVTNLSEDTRETDLQELFRPFGSISRI-YLAKDKTTGQ
EIF3G_HUMAN     -----------------------RRADDNATIRVTNLSEDTRETDLQELFRPFGSISRI-YLAKDKTTGQ
EIF3G_BOVIN     -----------------------RRADDNATIRVTNLSEDTRETDLQELFRPFGSISRI-YLAKDKTTGQ
EI3GB_XENLA     -----------------------RRADDNATIRVTNLSEDTRETDLQELFRPFGSISRI-YLAKDKTTGQ
EI3GA_XENLA     -----------------------RRADDNATIRVTNLSEDTRETDLQELFRPFGSISRI-YLAKDKTTGQ
DAZL_MOUSE      -------------------------------VFVGGIDVRMDETEIRSFFARYGSVKEV-KIITD-RTGV
DAZL_CALJA      -------------------------------VFVGGIDVRMDETEIRGFFARYGSVKEV-KIITD-RTGV
DAZLA_XENLA     -------------------------------VFVGGIDITMDEIEIRDFFTRFGNVKEV-KIITD-RTGV
SR140_MOUSE     LKNLN-----------------------------------------------------------------
MK67I_HUMAN     AETMN-----------------------------------------------------------------
EIF3G_SCLS1     ----------------------------------------------------------------------
EIF3G_NEUCR     ----------------------------------------------------------------------
EIF3G_CHAGB     VKACNKMDGFG-----------------------------------------------------------
EIF3G_BOTFB     ----------------------------------------------------------------------
DAZLB_XENLA     -------------------------------VFVGGIDITMDEIEIRDFFTRFGNVKEV-KIITD-RTGV
NCBP2_BOMMO     -------------------SEQEKLLKASSTLYMGNLSFYTTEEQIYELYSRCGDIRRV--IMLDKYKKT
NCBP2_ANOGA     -----------------KGSRHEKLLRVSSTLYVGNLSFYTTEEQIHELFSRCG---DVRRIIMGLDKKT
EIF3G_DANRE     -----------------------RRADDNATIRVTNLSEDTRETDLQELFRPFGSISRI-YLAKDKNTGQ
TRA2B_RAT       KERANGMELDGRRIRVD-----------------------------------------------------
TRA2B_MOUSE     KERANGMELDGRRIRVD-----------------------------------------------------
TRA2B_HUMAN     KERANGMELDGRRIRVD-----------------------------------------------------
TRA2B_BOVIN     KERANGMELDGRRIRVD-----------------------------------------------------
SR140_PONAB     LKNLN-----------------------------------------------------------------
SR140_HUMAN     LKNLN-----------------------------------------------------------------
HNRPC_RAT       ----------------------------------------------------------------------
EIF3G_NEOFI     ----------------------------------------------------------------------
EIF3G_ASPFU     ----------------------------------------------------------------------
EIF3G_ASPFC     ----------------------------------------------------------------------
FOX1C_MOUSE     -------------------------------LHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGS--
FOX1C_HUMAN     -------------------------------LHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGS--
EIF3G_EMENI     ----------------------------------------------------------------------
EIF3G_DEBHA     LNDLN-----------------------------------------------------------------
EIF3G_COCIM     ----------------------------------------------------------------------
EIF3G_ASPNC     ----------------------------------------------------------------------
EIF3G_ASPCL     ----------------------------------------------------------------------
PAB2_SCHPO      L-LLNGSMLHERPLKV------------------------------------------------------
MK67I_MOUSE     ----------------------------------------------------------------------
EIF3G_PICGU     LNTLN-----------------------------------------------------------------
EIF3G_ASPOR     ----------------------------------------------------------------------
EIF3G_BRUMA     ---------------------------------VTNLPEECDEMELRALFGTVGTVNRV-FIAKDKHTNK
FUSIP_MOUSE     ------------------------------SLFVRNVADDTRSEDLRREFGRYGPIVDV-YVPLDFYTRR
FUSIP_HUMAN     ------------------------------SLFVRNVADDTRSEDLRREFGRYGPIVDV-YVPLDFYTRR
RNPS1_XENTR     LKHMDGGQIDGQEI--------------------------------------------------------
RNP1B_XENLA     LKHMDGGQIDGQEI--------------------------------------------------------
RNP1A_XENLA     LKHMDGGQIDGQEI--------------------------------------------------------
EIF3G_ASPTN     ----------------------------------------------------------------------
CELF4_XENTR     QSALHEQKTMNRPIQVKPADSESR----------------------------------------------
RNPS1_RAT       LKHMDGGQIDGQEI--------------------------------------------------------
RNPS1_PONAB     LKHMDGGQIDGQEI--------------------------------------------------------
RNPS1_MOUSE     LKHMDGGQIDGQEI--------------------------------------------------------
RNPS1_MACFA     LKHMDGGQIDGQEI--------------------------------------------------------
RNPS1_HUMAN     LKHMDGGQIDGQEI--------------------------------------------------------
RNPS1_BOVIN     LKHMDGGQIDGQEI--------------------------------------------------------
FOX1A_DANRE     -------------------------------LHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGS--


                         +         .         .         .         .         *         .:210
query           SKGFAFINFASFEASDTALEAMNGQFLCNRAITVSYAFKRDSKGERHGTAAERMLAAQNPLFPKDRPHQV
SF3B4_CAEEL     SKGFAFINFASFEASDTALEAMNGQFLCNRAITVSYAFKRDSKGERHGTAAERMLAAQNPLFPKDRPHQV
SF3B4_RAT       SKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQL
SF3B4_MOUSE     SKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQL
SF3B4_HUMAN     SKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQL
SAP49_SCHPO     SKGYGFVSYDSFETADAAIEAMNNQFLMNKPITVSYAFKREGKGERHG----------------------
SF3B4_DICDI     SKGFAFINFDSFEASDAAIEAMNSQFLCNKPISVTYARKKDS-NERHGSSAERIIAA-------------
HSH49_YEAST     LK-CAYVYFEDFEKADLAIKSLNNQLVANNRITVDYAFKENGKGNKYGDDVDRLL---------------
PABP4_HUMAN     SKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAK------------------
PABP2_ARATH     SKGYGFVQYANEESAQKAIEKLNGMLLNDKQVYVGPFLRRQ---ERDSTA--------------------
PABP1_HUMAN     SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDER
PABP1_BOVIN     SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDER
PABP_SCHPO      AKGYGFVHFDSVESANAAIEHVNGMLLNDKKVYVGHHVSR------------------------------
PABP1_RAT       SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAK------------------
PABP1_PONAB     SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDER
PABP1_MOUSE     SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVG-RFKSQKERE-------------------------
PABPB_XENLA     SKGYGFVHFETQEAAERAIDKMNGMLLNDRKVFVGRFKSRKEREAELGARAK------------------
PABPA_XENLA     SKGYGFVHFETQEAAERAIDKMNGMLLNDRKVFVGRFKSRKEREAELGARAK------------------
PABP3_HUMAN     SKGYGFVHFETHEAAERAIKKMNGMLLNGRKVFVGQFKSRKEREAELGARAKEFPNVYIKNFGEDMDDER
PABP_YARLI      SRGFGFVHYESAESAESAIQHVNGMLLNDKKVFV------------------------------------
PABP_NEOFI      SKGYGFVHYETAEAANNAIKHVNGMLLNDKKVFVGHHISKKDR---------------------------
PABP_DROME      SKGYGFVHFETEEAANTSIDKVNGMLLNGKKVYVGKFIPRKEREKELGEKAK------------------
PAB4L_HUMAN     SKGYAFVHFQNQSAADRAIEEMNGKLLKGCKVFVGFKNRKDREAELRSKASE------------------
EPAB_XENTR      SRGYGFVHFETQEAANRAIQTMNGMLLNDRKVFVGHFKSRRERELEYG----------------------
PABP_ASPNC      SKGYGFVHYETAEAANNAIKHVNGMLLNDKKVFVGHHISKKDR---------------------------
EPABB_XENLA     SRGYGFVHFETQEAANRAIQTMNGMLLNDRKVFVGHFKSRRERELEYG----------------------
PABP_CRYNE      SRGFAFVHYSTGEAADAAIKAVNGMLL-------------------------------------------
PABP_ASPOR      SKGYGFVHYETAEAANNAIKHVNGMLLNDKKVFVGHHISKKDR---------------------------
PABP_PHANO      SKGYGFVHYETAEAANNAIKHVNGMLLNEKKVFVGH----------------------------------
PABP_LODEL      SKCFGFVHYETEEAAQAAIESVNGMLLNDREV---YVGKHVSKKDRE-SKLEEMKANYTNIYVKN-----
EPABA_XENLA     SRGYGFVHFETHEAANRAIQTMNGMLLNDRKVFVGHFKSRRERELEYG----------------------
PABP_ASPTN      SKGYGFVHYETAEAANNAIKHVNGMLLNDKKVFVGHHISKKDR---------------------------
PABP_ASPCL      SKGYGFVHYETAEAANNAIKHVNGMLLNDKKVFVGHHISKKDR---------------------------
PAP1L_HUMAN     SRGFGFVHFETHEAAQQAINTMNGMLLNDRKVFVGH----------------------------------
PABP3_ARATH     SKGYGFVQFEKEESAQAAIDKLNGMLMNDKQVFVGHFIRRQERARDENTPTPRFTNVYVKNLPKE-----
PABP5_ARATH     SKGYGFVQFEKEETAQAAIDKLNGMLLNDKQVFVGHFVRRQDRARSESGA----VPSFTNVYVKNLPKEI
PABP_NEUCR      SKGYGFVHYETDEAASQAIKHVNGMLLNEKKVYVGH----------------------------------
PABP_ASPFU      SKGYGFVHYETAEAANNAIKHVNGMLLNDKKVFVGHHISKKDR---------------------------
PAP1M_HUMAN     PKGYGFVHFQKQESAERAIDVMNGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEED-----
PABP_MAGGR      SKGYGFVHYETDEAASQAIKHVNGMLLNEKKVYVGH----------------------------------
PABP_EMENI      SKGYGFVHYETAEAANNAIKHVNGMLLNDKKVFVGHHISKKDR---------------------------
PABP_CHAGB      SKGYGFVHYETDEAAAQAIKHVNNMLLNEKKVYVGY----------------------------------
PABP_YEAST      SKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKER---------------------------
PAP1B_DICDI     SKGYGYVHFETNDSAEKAIEKVNGTLILGKPINV------------------------------------
PABP_ASHGO      SRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVAHVSKKDRQSK-------------------------
PABP_DEBHA      SKCFGFVHYXXXXXXXXXXXNVNGMLLNDREV---YVGKHISKKDRESKFEE------------------
PABP_CANGA      SKGFGYVHFXXXXXXXXXXXXLNGMLLNGQEI---YVGPHLSKKERESKFEE------------------
PABP_USTMA      SLGYGFVHYETAEAAEAAIKHVNGMLLNDKKVYVGHHIPRKER---------------------------
PABP_KLULA      SRGFGFVHFKEESDAKDAIEAVNGMLM-------------------------------------------
PAP1A_DICDI     SKGFGFVHYETQESADKAIAKVNGMMINGQKVFV------------------------------------
PABP5_PONPY     SKGYAYVHFDSLAAANRAIWHMNGVRLNNRQVYV------------------------------------
PABP5_PANTR     SKGYAYVHFDSLAAANRAIWHMNGVRLNNRQVYV------------------------------------
PABP5_MACMU     SKGYAYVHFDSLAAANRAIWHMNGVRLNNRQVYV------------------------------------
PABP5_HYLLA     SKGYAYVHFDSLAAANRAIWHMNGVRLNNRQVYV------------------------------------
PABP5_HUMAN     SKGYAYVHFDSLAAANRAIWHMNGVRLNNRQVYV------------------------------------
PABP5_GORGO     SKGYAYVHFDSLAAANRAIWHMNGVRLNNRQVYV------------------------------------
TIAR_HUMAN      SKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRK------------------------------
PABP_PICST      SKCFGFVHYXXXXXXXXXXXNVNGMLLNDREVFVG---KHISKKDRESKFEE------------------
TIAR_MOUSE      SKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRK------------------------------
PABP_CANAL      SKCFGFVHYXXXXXXXXXXXNVNGMLLNDREVFVG---KHISKKDRESKFEE------------------
PABP_PICGU      SKCFGFVHYXXXXXXXXXXXNVNGMLLNDREVFVKHVSKRDRESK-------------------------
ROC1_NICSY      SRGFGFVTYSSAEEVNNAIESLDGVDLNGRAIRVSPAEAR------------------------------
ROC3_ARATH      SRGFGFVTMSDVDELNEAISALDGQNLEGRAIRVNVAEER------------------------------
ROC3_NICSY      SRGFGFVTMSSEAEMSEAIANLDGQTLDGRTIRVNAAEER------------------------------
ROC1_SPIOL      SRGFGFVTMSSESEVNDAIAALDGQTLDGRAVRVNVAEER------------------------------
PUB1_YEAST      SRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAKRD-----------------------------
ROC1_NICPL      SRGFGFVTYSSAEEVNNAIESLDGVDLNGRAIRVSPAEAR------------------------------
ROC2_NICSY      SRGFGFVTYSSSKEVNDAIDSLNGVDLDGRSIRVSAAEER------------------------------
PABP_COCIM      SRGFGFVNFTSHDNAAAAVEALNDKDFKGQKLYVGRAQKKHEREE-------------------------
ELAV2_PONAB     SRGVGFIRFDKRIEAEEAIKGLNGQKPPGATEPITVKFANNPSQKTNQAILSQLYQSPNRRYPGPLAQQA
ELAV2_HUMAN     SRGVGFIRFDKRIEAEEAIKGLNGQKPPGATEPITVKFANNPSQKTNQAILSQLYQSPNRRYPGPLAQQA
PUF68_DROME     HKGYGFIEYANKQAMDEAIASMNGQLLVGRSIT-------------------------------------
TIA1_MOUSE      SKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRK------------------------------
TIA1_HUMAN      SKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRK------------------------------
ELAV2_RAT       SRGVGFIRFDKRIEAEEAIKGLNGQKPPGATEPITVKFANNPSQKTNQAILSQLYQSPNRRYPGPLAQQA
ROC2_NICPL      SRGFGFVTYSSAKEVNDAIDSLNGIDLDGRSIRVSAAEER------------------------------
ROC1_ARATH      SKGFGFVTYDSSQEVQNAIKSLDGADLDGRQIRVSEAEAR------------------------------
PABPX_ARATH     SRGYGFVQFEQEDAAHAAIQTLNSTIVADKEIYVGKFMKKTDR---------------------------
ELAV2_MOUSE     SRGVGFIRFDKRIEAEEAIKGLNGQKPPGATEPITVKFANNPSQKTNQAILSQLYQSPNRRYPGPLAQQA
ROC5_NICSY      SRGFGFITFSSAEAMNSALDTMNEVELEGRPLRLNVA---------------------------------
RBM7_MOUSE      ----------------------------------------------------------------------
ELAV3_MOUSE     SRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAITVKFA---------------------------------
RBM7_HUMAN      ----------------------------------------------------------------------
ELAV3_HUMAN     SRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAITVKFA---------------------------------
ROC4_NICSY      SRGFGFVTMASEAEMSDAIANLDGQSLDGRTIRVNVAEDRSRR---------------------------
FCA_ARATH       SRGCGFVKYSSKETAMAAIDGLNGTYTCNQPLIVRFAEKRPKPGE-------------------------
ELAV1_HUMAN     SRGVAFIRFDKRSEAEEAITSFNG----------------------------------------------
PU60B_DANRE     HKGFGFIEYEKPQSSLDAVSSMNGQYL-------------------------------------------
YG41_SCHPO      SRGYGFVRFTDENDQKSALAEMQGQICGDRPIRVGLA---------------------------------
PUF60_RAT       HKGYGFIEYEKAQSSQDAVSSMNGQYL-------------------------------------------
PUF60_PONAB     HKGYGFIEYEKAQSSQDAVSSMNGQYL-------------------------------------------
PUF60_MOUSE     HKGYGFIEYEKAQSSQDAVSSMNGQYL-------------------------------------------
PUF60_HUMAN     HKGYGFIEYEKAQSSQDAVSSMNGQYL-------------------------------------------
PUF60_BOVIN     HKGYGFIEYEKAQSSQDAVSSMNGQYL-------------------------------------------
HRP1_YEAST      SRGFGFVTYDSADAVD------------------------------------------------------
RBM7_BOVIN      ----------------------------------------------------------------------
ELAV4_RAT       SRGVGFIRFDKRIEAEEAIKGLNGQ---------------------------------------------
ELAV4_MOUSE     SRGVGFIRFDKRIEAEEAIKGLNGQ---------------------------------------------
ELAV4_HUMAN     SRGVGFIRFDKRIEAEEAIKGLNGQ---------------------------------------------
SXL_MEGSC       PRGVAFIRFNKREEAQEAISALN-----------------------------------------------
RBM39_PONAB     SKGYGFITFSDSECAKKALEQLNGFELAGRPMKVGHVTER------------------------------
RBM39_HUMAN     SKGYGFITFSDSECAKKALEQLNGFELAGRPMKVGHVTER------------------------------
RBM39_MOUSE     SKGYGFITFSDSECAKKALEQLNGFELAGRPMKVGHVTER------------------------------
SXL_DROSU       PRGVAFVRYNKREEAQEAISALN-----------------------------------------------
RBM11_HUMAN     ----------------------------------------------------------------------
ELAV1_MOUSE     SRGVAFIRFDKRSEAEEAITSFIG----------------------------------------------
NSR1_YEAST      PKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSSPR------------------------------
RBM23_HUMAN     SKGYGFITFSDSECARRALEQLNGFELAGRPMRVGHVTER------------------------------
HNRDL_MOUSE     RRGFCFITYTDEEPVKKLLES-------------------------------------------------
HNRDL_HUMAN     RRGFCFITYTDEEPVKKLLES-------------------------------------------------
SXL_DROME       PRGVAFVRYNKREEAQEAISALN-----------------------------------------------
SXL_CERCA       PRGVAFVRFNKREEAQEAISALNNVIPASQPLTVRLA-------EEHGKAKAQHYMSQ------------
PABP_ENCCU      SKGYGFVQFXXXXXXXXXFSSLDGLLLGGNRIVVELYNPEIKKGESKKTSA-------------------
HNRDL_CHICK     RRGFCFITYTDEEPVKKLLES-------------------------------------------------
SXL_CHRRU       PRGVAFVRFNKREEAQEAISALN-----------------------------------------------
SXL_MUSDO       PRGVAFVRFNKREEAQEAISALN-----------------------------------------------
HNRDL_RAT       RRGFCFITYTDEEPVKKLLES-------------------------------------------------
RB87F_DROME     KRGFAFIEFDDYDPVD------------------------------------------------------
CELF5_XENTR     SKGCAFVKFSSHAEAQAAIQALHG----------------------------------------------
RA1L2_HUMAN     KRGFAFVTFDDHDSVD------------------------------------------------------
ROA1_RAT        KRGFAFVTFDDHDSVD------------------------------------------------------
ROA1_PANTR      KRGFAFVTFDDHDSVD------------------------------------------------------
ROA1_MOUSE      KRGFAFVTFDDHDSVD------------------------------------------------------
ROA1_HUMAN      KRGFAFVTFDDHDSVD------------------------------------------------------
ROA1_BOVIN      KRGFAFVTFDDHDSVD------------------------------------------------------
RA1L3_HUMAN     KRGFAFVTFDDHDSVD------------------------------------------------------
ROA1_XENLA      KRGFAFVTFEDHDSVD------------------------------------------------------
RB97D_DROME     RRGFAFVEFDDYDAVDKAI---------------------------------------------------
HNRDL_XENTR     RRGFCFVTYTGEEPVKKLLES-------------------------------------------------
HNDLA_XENLA     RRGFCFVTYTGEEPVKKLLES-------------------------------------------------
ROA3_RAT        KRGFAFVTFDDHDTVD------------------------------------------------------
ROA3_MOUSE      KRGFAFVTFDDHDTVD------------------------------------------------------
ROA3_HUMAN      KRGFAFVTFDDHDTVD------------------------------------------------------
RO32_XENLA      KRGFAFVTFDDHDTVD------------------------------------------------------
ROA1_MACMU      KRGFAFVTFDDHNSVD------------------------------------------------------
HNRPM_RAT       SRGIGTVTFEQSIEAVQAISMFNGQLLFDRPMHVKMDERALPKGD---------------FFPPERPQQ-
PPIE_RHIOR      ----------------------------------------------------------------------
PPIE_DROME      ----------------------------------------------------------------------
ELAV_DROVI      TKGVGFIRFDKREEATRAIIALNGPSSCTDPIVVKFS---NTPGSTSKIIQPQLPAFLNPQLVRRIGGAM
ELAV_DROME      TKGVGFIRFDKREEATRAIIALNGPSSCTDPIVVKFS---NTPGSTSKIIQPQLPAFLNPQLVRRIGGAM
RO21_XENLA      KRGFAFVTFDDHDPVD------------------------------------------------------
SHEP_DROYA      SKGVGFARMESREKCEQIIQMFNGNTIAKDPLLVKFAFKTPDPNARRDVSAEGIPVAYDPTMQQNGV-SV
SHEP_DROER      SKGVGFARMESREKCEQIIQMFNGNTIAKDPLLVKFAFKTPDPNARRDVSAEGIPVAYDPTMQQNGV-SV
ROA2_SAGOE      KRGFGFVTFDDHDPVD------------------------------------------------------
ROA1_DROME      KRGFAFVEFDDYDPVD------------------------------------------------------
PPIE_PONAB      ----------------------------------------------------------------------
PPIE_MOUSE      ----------------------------------------------------------------------
PPIE_HUMAN      ----------------------------------------------------------------------
PPIE_BOVIN      ----------------------------------------------------------------------
HNRPD_RAT       NKGFCFITFKEEEPVKKIME--------------------------------------------------
HNRPD_MOUSE     NKGFCFITFKEEEPVKKIME--------------------------------------------------
HNRPD_HUMAN     NKGFCFITFKEEEPVKKIME--------------------------------------------------
HNDLB_XENLA     RRGFCFVTYTDEEPVQKLLES-------------------------------------------------
SHEP_DROSE      SKGVGFARMESREKCEQIIQMFNGNTIAKDPLLVKFAFKTPDPNARRDVSAEGIPVAYDPTMQQNGV-SV
SHEP_DROME      SKGVGFARMESREKCEQIIQMFNGNTIAKDPLLVKFAFKTPDPNARRDVSAEGIPVAYDPTMQQNGV-SV
ROA2_BOVIN      KRGFGFVTFDDHDPVD------------------------------------------------------
RO31_XENLA      KRGFAFVTFDDHDTVD------------------------------------------------------
RO22_XENLA      KRGFGFVTFNDHDPVD------------------------------------------------------
RBMS2_BOVIN     SRGVGFARMESTEKCEAIITHFNGKYI-------------------------------------------
CELF6_MOUSE     SKGCAFVKFGSQGEAQAAIQGLHGSRTMTGASSSLVVKLADTDRERALRRMQQMAGQLGAFHPAPLP---
TSAP1_DANRE     SKCCGFVSFESEREQKRALVDLQGATLGKKALRLSLASSRVNK---------------------------
CEL3B_XENLA     SKGCAFVKFQTHTEAQAAINALHGSRTASSSLVVKFADTEKERGLRRMQQVANQLGMFSPI---------
ROA1_SCHAM      KRGFAFVEFDDYDPVDKICLSRNHQ---------------------------------------------
RBMS2_HUMAN     SRGVGFARMESTEKCEAIITHFNGKYI-------------------------------------------
RBM28_HUMAN     MRGFGFVQFKNLLEAGKALKGMNMKEIKGRTVAVDWAVAKDKYKDTQSVSA-------------------
CEL3A_XENLA     SKGCAFVKFQTHTEAQAAINALHGSRTASSSLVVKFADTEKERGLRRMQQVANQLGMFSPI---------
RBY1A_MOUSE     ----------------------------------------------------------------------
PRP24_YEAST     NNCCAFMVFENKDSAERALQ-MNRSLLGNREISVSLA---DKKPFLERNEVKRLLASRN-----------
CELF6_HUMAN     SKGCAFVKFGSQGEAQAAIRGLHG----------------------------------------------
CELF4_DANRE     SKGCAFVKYSTHAEAQAAISALHG----------------------------------------------
SQD_DROME       RKGFCFITFDS-----------------------------------------------------------
YOCE_SCHPO      MCGFAFVWMKDRKAAEEAMNSLNGTEIDGRPIAVDWAVSKDA--FEATTLKDASSEEENKEFVSDEGHSI
YHKF_SCHPO      PRGFGFVTY----ENESAVEATMSQ---------------------------------------------
ROAA_MOUSE      RRGFVFITFKEEDPVKKVLE--------------------------------------------------
ROA2_RAT        KRGFGFVTFDDHDPVD------------------------------------------------------
ROA2_PONAB      KRGFGFVTFDDHDPVD------------------------------------------------------
ROA2_MOUSE      KRGFGFVTFDDHDPVD------------------------------------------------------
ROA2_HUMAN      KRGFGFVTFDDHDPVD------------------------------------------------------
RBMS2_MOUSE     SRGVGFARMESTEKCEAIITHFNGKYI-------------------------------------------
MRD1_YARLI      SRGFAFAEYVSAKEAEHAMSALQGTHLLGRRLVLQYAQADASNAEEE---IERMQATVS----KQAAQRS
CELF4_MACFA     SKGCAFVKYSSHAEAQAAINALHG----------------------------------------------
RBY1B_MOUSE     ----------------------------------------------------------------------
CELF5_HUMAN     SKGCAFVKFSSHTEAQAAIHALHG----------------------------------------------
SHEP_DROWI      SKGVGFARMESREKCEQIIQMFNGNTIAKDPLLVKFAFKTPDPNTRRDVSAEGIPVAYDPTLQQNGV-SV
CEL1B_XENLA     SRGCAFITFTTRSMAQMAIKAMHAQTMCSSPIVVKFADTQKDKEQKRMT---------------------
GRP2_SINAL      SRGFGFVTFKDEKSMKDAIEGMNGQDLDGRSITVNEA---------------------------------
GAR2_SCHPO      LKGFGYVTFSDIDSAKKCVE-MNGHFIAGRPCRLDFSTPR------------------------------
CELF1_XENTR     SRGCAFVTFTTRSMAQMAIKAMHAQTMCSSPIVVKFADTQKDKEQKRMT---------------------
TSAP1_BOVIN     SKGYGFVKFTDELEQKRALTECQGAILGSKPVRLSVAIPKASR---------------------------
ROA1_CAEEL      PRGFGFVTFDDHDSVD------------------------------------------------------
NUCL_CHICK      SKGFGFVDFSS-----------------------------------------------------------
GRP1_SINAL      SRGFGFVTFKDEKSMKDAIEGMNGQDLDGRSITVNEA---------------------------------
DAZP1_MOUSE     PRGFGFITFEDEQSVDQAVN-MHFHDIMGKKVEVKRAEPRDSKNQAPG----------------------
TSAP1_HUMAN     SKGYGFVKFTELEQKRALTECQGAVGLGSKPVRLSVAIPKASR---------------------------
RRP2_SPIOL      SNXXXXXXXXXXXXXXAAIQALNNSVLEGQKIRVNKA---------------------------------
DAZP1_HUMAN     PRGFGFITFEDEQSVDQAVN-MHFHDIMGKKVEVKRAEPRDSKSQAPG----------------------
CELF1_RAT       SRGCAFVTFTTRTMAQTAIKAMHAQTMCSSPMVVKFADTQKDKEQK------------------------
CELF1_MOUSE     SRGCAFVTFTTRTMAQTAIKAMHAQTMCSSPMVVKFADTQKDKEQK------------------------
CELF1_HUMAN     SRGCAFVTFTTRAMAQTAIKAMHAQTMCSSPMVVKFADTQKDKEQK------------------------
CELF1_CHICK     SRGCAFVTFTTRAMAQTAIKAMHAQTMCSSPIVVKFADTQKDKEQK------------------------
DAZP1_XENLA     PRGFGF