[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cele0:CAC35840.2

[Show Plain Result]


## Summary of Sequence Search
    1::795
    5::411     1e-41  34%  804 aa  EPC2_XENTR RecName: Full=Enhancer of polycomb homolog 2;
    5::413     2e-41  35%  813 aa  EPC1_MOUSE RecName: Full=Enhancer of polycomb homolog 1;
    5::414     2e-41  36%  836 aa  EPC1_HUMAN RecName: Full=Enhancer of polycomb homolog 1;
    5::411     1e-40  35%  804 aa  EPC2_XENLA RecName: Full=Enhancer of polycomb homolog 2;
    5::410     7e-40  34%  807 aa  EPC2_HUMAN RecName: Full=Enhancer of polycomb homolog 2;AltName:
    5::280     1e-39  36%  808 aa  EPC2_MOUSE RecName: Full=Enhancer of polycomb homolog 2;AltName:
    4::294     3e-10  27%  557 aa  EPL1_SCHPO RecName: Full=Enhancer of polycomb-like protein 1;
  276::374     2e-07  33%  821 aa  EPL1_CANGA RecName: Full=Enhancer of polycomb-like protein 1;
  243::344     2e-06  29%  806 aa  EPL1_KLULA RecName: Full=Enhancer of polycomb-like protein 1;
  274::377     3e-06  32%  832 aa  EPL1_YEAST RecName: Full=Enhancer of polycomb-like protein 1;
  354::421     5e-04  37% 1016 aa  EPL1_DEBHA RecName: Full=Enhancer of polycomb-like protein 1;
    1::795

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MATTSKAFRARALDSNRSMTVYWGHELPDLSECSVGNRAVTQMPSGMXXXXXXXXXXXXAIAAQQASTSG
EPC2_XENTR      ------SFRARALDAAKPLPIYRGKDMPDLNDCVSINRAVPQMPTGMEKEEESEHHLQRAISAQQVFREK
EPC1_MOUSE      ------SFRARALDASKPLPVFRCEDLPDLHEYASINRAVPQMPTGMEKEEESEHHLQRAISAQQVYGEK
EPC1_HUMAN      ------SFRARALDASKPLPVFRCEDLPDLHEYASINRAVPQMPTGMEKEEESEHHLQRAISAQQVYGEK
EPC2_XENLA      ------SFRARALDATKPLPIFRGNDMPDLNDCVSINRAVPQMPTGMEKEEESEHHLQRAISAQQVFREK
EPC2_HUMAN      ------SFRARALDAAKPLPIYRGKDMPDLNDCVSINRAVPQMPTGMEKEEESEHHLQRAISAQQVFREK
EPC2_MOUSE      ------SFRARALDAAKPLPIYRGKDMPDLNDCVSINRAVPQMPTGMEKEEESEHHLQRAISAQQVFREK
EPL1_SCHPO      VSKNARAYRQRKVGIKTVMPIYFERDIPDFDEEASLQRTVPLVESGVXXXXXXXXHLQQVIEAHEAIVRG
EPL1_CANGA      ----------------------------------------------------------------------
EPL1_KLULA      ----------------------------------------------------------------------
EPL1_YEAST      ----------------------------------------------------------------------
EPL1_DEBHA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IQLNHVIPTPKVDRVEDQRYHSTYHNKNKMHRSKYIKVHAWQALXXXXXXXXXXXXXXAWLSDHTHIDPR
EPC2_XENTR      KE-SMVIPVPEAE--SNVHYYSRLYKGEFKQPKQFIHIQPFNLDYEQPDYDMDSEDETLLLNRKMEIKPL
EPC1_MOUSE      RD-NMVIPVPEAES-NIAYYESIYPGEFRMPKQLHIQPFSLDAEQPDYDLDSEDEVFVNKLKKKMDICPL
EPC1_HUMAN      RD-NMVIPVPEAES-NIAYYESIYPGEFKMPKQLHIQPFSLDAEQPDYDLDSEDEVFVNKLKKKMDICPL
EPC2_XENLA      KECM-VIPVPEAE--SNVHYYSRLYKGEFKQPKQFIHITPFNLDYEQPDYDMDSEDETLLLNRKMEIKPL
EPC2_HUMAN      KE-SMVIPVPEAE--SNVNYYNRLYKGEFKQPKQFIHIQPFNLDNEQPDYDMDSEDETLLLNRKMEIKPL
EPC2_MOUSE      KE-SMVIPVPEAE--SNVNYYNRLYKGEFKQPKQFIHIQPFNLDNEQPDYDMDSEDETLLLNRKMEIKPL
EPL1_SCHPO      SEKKLIIPTREAKNIG---IIDKYYKKNFILPKTLIRFSLTVEECTNPEYCMDEHDTEYFLSKFSELDFE
EPL1_CANGA      ----------------------------------------------------------------------
EPL1_KLULA      ----------------------------------------------------------------------
EPL1_YEAST      ----------------------------------------------------------------------
EPL1_DEBHA      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VLEKIFDTVESHSSETQIASEDSVINLHKSLDSSIVYEIYEYWLSKRTSAATTSGCVGVGGLIPRVRTEC
EPC2_XENTR      QFEIMIDRLEKASSNQLVTLQEAKLLLNE--DDYLIKSVYDYWVRKRKNCRGPS-------LIPQVKQE-
EPC1_MOUSE      QFEEMIDRLEKGSGQQPVSLQEAXXXXXXXXXX--IREVYEYWIKKRKTCRGSS-------LIPLVKQE-
EPC1_HUMAN      QFEEMIDRLEKGSGQQPVSLQEAXXXXXXXXXX--IREVYEYWIKKRKNCRGPS-------LIPSVKQE-
EPC2_XENLA      QFEIMIDRLEKASSNQLVSLQEAKLLLNE--DDYLIKSVYDYWVRKRKN------CRGPC-LIPQVKQE-
EPC2_HUMAN      QFEIMIDRLEKASSNQLVTLQEAKLLLNE--DDYLIKAVYDYWVRKRKNCRGPS-------LIPQIKQE-
EPC2_MOUSE      QFEIMIDRLEKASSNQLVTLQEAKLLLNE--DDYLIKAVYDYWVRKRKNCRGPS-------LIPQIKQE-
EPL1_SCHPO      IVMQTFEEEINQNQPFLSMDTSQILPLSELITSDVLYQVYPYWRERRISK---------GGLPIMAKAQV
EPL1_CANGA      -------------------------------------EVYEHWSRRKIEAKGAE-------IFPQLKFE-
EPL1_KLULA      -------------------------------------KIHDHWKQRKISR---HGC----DIFPQLKSE-
EPL1_YEAST      -------------------------------------KIYDYWRERK---------IEVNGIFPQLKFE-
EPL1_DEBHA      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RKDGQGVINPYVAFRRRAEKMQTRKNRKNDEDSYEKILKLVHDMSKAQQLFDMTARREKQKLALIDMESE
EPC2_XENTR      KRDGSTNNDPYVAFRRRTEKMQTRKNRKNDEVSYEKMLKLRREFSRAITILEMIKRREKTKRELLHLTLE
EPC1_MOUSE      KRDGSSTNDPYVAFRRRTEKMQTRKNRKNDEASYEKMLKLRRDLSRAVTILEMIKRREKSKRELLHLTLE
EPC1_HUMAN      KRDGSSTNDPYVAFRRRTEKMQTRKNRKNDEASYEKMLKLRRDLSRAVTILEMIKRREKSKRELLHLTLE
EPC2_XENLA      KRDGSTNNDPYVAFRRRTEKMQTRKNRKNDEASYEKMLKLRREFSRAITILEMIKRREKTKRELLHLTLE
EPC2_HUMAN      KRDGSTNNDPYVAFRRRTEKMQTRKNRKNDEASYEKMLKLRREFSRAITILEMIKRREKTKRELLHLTLE
EPC2_MOUSE      KRDGSTNNDPYVAFRRRTEKMQTRKNRKNDEASYEKMLKLRREFSRAITILEMIKRREKTKRELLHLTLE
EPL1_SCHPO      GXXXXXXX-PYVCFRRR-EIRQARKTRRSDAQSYDRLRRLRQSMETSLQLLEQVYKREQKKLQALEDDYA
EPL1_CANGA      RPGEKEEVDPYVCFRRR-ELRHPRKTRRVDILNSQKLRILLKELRHAKDMSLLVAQREQINLQLIEDDLK
EPL1_KLULA      RNNDKDDNDPYVCFRRR-ELRQPRKTRRIDVQNSQKLRLLCQQLEYTKDLALTVAKRERAVLEVLENEKF
EPL1_YEAST      RPGEKEEIDPYVCFRRR-EVRHPRKTRRIDILNSQRLRALHQELKNAKDLALLVAKRENVSLNWINDELK
EPL1_DEBHA      --------DPYICFRRR-EFRQARKTRRADTLGAERIRLLQKSMHRARDLVMSVCRRELIKLENWETDHA


                         .         *         .         .         .         .         +:350
query           ILAKRMEMSDFGGSPSSFNEITEKIRAAATLEVVKPPLAEINGSDEVKKRKKPRRKIADKDLISKAWLKK
EPC2_XENTR      VVEKRYNLGDFGG--EILNEI--KIKVEKEIHVIPPSLHNGNHHPECKVKNTHHPSVKDEVLXAETLVTP
EPC1_MOUSE      IMEKRYNLGDYSG------EIMSEVMAQR--QPVKPPIIPITNSSQFKHQDATDSKEFKVNKQDKADLIR
EPC1_HUMAN      IMEKRYNLGDYNG------EIMSEVMAQR--QPMKPPIIPITNSSQFKHQERPKRKYEKKPKVLXXXXXX
EPC2_XENLA      VVEKRYNLGDFGG------EILNEIKPKADKEIYAIPPSLHNGNPECKVKNTHHLNVKDEDILVTPLPQA
EPC2_HUMAN      VVEKRYHLGDYGG------EILNEVKSRSEKELYATPATLHNGNHQECKTKHPHHKEEASDVVAEALITS
EPC2_MOUSE      VVEKRYHLGDYGG---------------------------------------------------------
EPL1_SCHPO      IFQKR-----------------------------------------------------------------
EPL1_CANGA      ILNKR-----------------------------------------------------------------
EPL1_KLULA      VFQARAQL--------------------------------------------------------------
EPL1_YEAST      IFDQRVKIKN------------------------------------------------------------
EPL1_DEBHA      IFKLRSD---------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           NAESWNRPPSLFGQHSGNVPTVTTKPVRESLANGRFAFKRRRGCVYRAxxxxxxxxxxxxxxxxxxxxxx
EPC2_XENTR      QPQATSEPLAVINKSDPQVPSPLSELEEENDPDGSYAFRRRTGCQYYA----------------------
EPC1_MOUSE      PKRKYEKKPKVXXXNQYDFPSSDEEPLSQVLSDGPFAFRRKAGCQYYA----------------------
EPC1_HUMAN      NAKDLNQYPSSDEEPLSQVLSGSSEAEEDNDPDGPFAFRRKAGCQYYA----------------------
EPC2_XENLA      NSEPLNRSQSSDDDEFPQVPSPLSELEEENDPDGSYAFRRRAGCQYYA----------------------
EPC2_HUMAN      QQPTPETLPVIYDFHSSDVLSPVSEPEEENDPDGPCAFRRRAGCQYYA----------------------
EPC2_MOUSE      ----------------------------------------------------------------------
EPL1_SCHPO      ----------------------------------------------------------------------
EPL1_CANGA      ----------------------------------------------------------------------
EPL1_KLULA      ----------------------------------------------------------------------
EPL1_YEAST      ----------------------------------------------------------------------
EPL1_DEBHA      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
EPC2_XENTR      ----------------------------------------------------------------------
EPC1_MOUSE      ----------------------------------------------------------------------
EPC1_HUMAN      ----------------------------------------------------------------------
EPC2_XENLA      ----------------------------------------------------------------------
EPC2_HUMAN      ----------------------------------------------------------------------
EPC2_MOUSE      ----------------------------------------------------------------------
EPL1_SCHPO      ----------------------------------------------------------------------
EPL1_CANGA      ----------------------------------------------------------------------
EPL1_KLULA      ----------------------------------------------------------------------
EPL1_YEAST      ----------------------------------------------------------------------
EPL1_DEBHA      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
EPC2_XENTR      ----------------------------------------------------------------------
EPC1_MOUSE      ----------------------------------------------------------------------
EPC1_HUMAN      ----------------------------------------------------------------------
EPC2_XENLA      ----------------------------------------------------------------------
EPC2_HUMAN      ----------------------------------------------------------------------
EPC2_MOUSE      ----------------------------------------------------------------------
EPL1_SCHPO      ----------------------------------------------------------------------
EPL1_CANGA      ----------------------------------------------------------------------
EPL1_KLULA      ----------------------------------------------------------------------
EPL1_YEAST      ----------------------------------------------------------------------
EPL1_DEBHA      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
EPC2_XENTR      ----------------------------------------------------------------------
EPC1_MOUSE      ----------------------------------------------------------------------
EPC1_HUMAN      ----------------------------------------------------------------------
EPC2_XENLA      ----------------------------------------------------------------------
EPC2_HUMAN      ----------------------------------------------------------------------
EPC2_MOUSE      ----------------------------------------------------------------------
EPL1_SCHPO      ----------------------------------------------------------------------
EPL1_CANGA      ----------------------------------------------------------------------
EPL1_KLULA      ----------------------------------------------------------------------
EPL1_YEAST      ----------------------------------------------------------------------
EPL1_DEBHA      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
EPC2_XENTR      ----------------------------------------------------------------------
EPC1_MOUSE      ----------------------------------------------------------------------
EPC1_HUMAN      ----------------------------------------------------------------------
EPC2_XENLA      ----------------------------------------------------------------------
EPC2_HUMAN      ----------------------------------------------------------------------
EPC2_MOUSE      ----------------------------------------------------------------------
EPL1_SCHPO      ----------------------------------------------------------------------
EPL1_CANGA      ----------------------------------------------------------------------
EPL1_KLULA      ----------------------------------------------------------------------
EPL1_YEAST      ----------------------------------------------------------------------
EPL1_DEBHA      ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
EPC2_XENTR      ----------------------------------------------------------------------
EPC1_MOUSE      ----------------------------------------------------------------------
EPC1_HUMAN      ----------------------------------------------------------------------
EPC2_XENLA      ----------------------------------------------------------------------
EPC2_HUMAN      ----------------------------------------------------------------------
EPC2_MOUSE      ----------------------------------------------------------------------
EPL1_SCHPO      ----------------------------------------------------------------------
EPL1_CANGA      ----------------------------------------------------------------------
EPL1_KLULA      ----------------------------------------------------------------------
EPL1_YEAST      ----------------------------------------------------------------------
EPL1_DEBHA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxx
EPC2_XENTR      -------------------------
EPC1_MOUSE      -------------------------
EPC1_HUMAN      -------------------------
EPC2_XENLA      -------------------------
EPC2_HUMAN      -------------------------
EPC2_MOUSE      -------------------------
EPL1_SCHPO      -------------------------
EPL1_CANGA      -------------------------
EPL1_KLULA      -------------------------
EPL1_YEAST      -------------------------
EPL1_DEBHA      -------------------------