[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cele0:AAA81130.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bdlA.bssp"
#ERROR : Can't open dsspfile "2diqA.bssp"
#ERROR : Can't open dsspfile "3db4A.bssp"
#ERROR : Can't open dsspfile "2e6nA.bssp"
#ERROR : Can't open dsspfile "3d4wA.bssp"
#ERROR : Can't open dsspfile "2d9tA.bssp"
#ERROR : Can't open dsspfile "3d6cA.bssp"
#ERROR : Can't open dsspfile "3dmuA.bssp"
#ERROR : Can't open dsspfile "3c1fA.bssp"
#ERROR : Can't open dsspfile "3bdcA.bssp"
#ERROR : Can't open dsspfile "3e5sA.bssp"
#ERROR : Can't open dsspfile "3d4dA.bssp"
#ERROR : Can't open dsspfile "3d8gA.bssp"
#ERROR : Can't open dsspfile "3ejiA.bssp"
#ERROR : Can't open dsspfile "3dhqA.bssp"
#ERROR : Can't open dsspfile "2digA.bssp"
#ERROR : Can't open dsspfile "3c1eA.bssp"
#ERROR : Can't open dsspfile "1a2tA.bssp"
#ERROR : Can't open dsspfile "2e5pA.bssp"
#ERROR : Can't open dsspfile "2e5qA.bssp"
#ERROR : Can't open dsspfile "3bdlA.bssp"
#ERROR : Can't open dsspfile "3d4wA.bssp"
#ERROR : Can't open dsspfile "3d4wA.bssp"
#ERROR : Can't open dsspfile "3d4wA.bssp"
#ERROR : Can't open dsspfile "3d6cA.bssp"
#ERROR : Can't open dsspfile "3d6cA.bssp"
#ERROR : Can't open dsspfile "3d6cA.bssp"
#ERROR : Can't open dsspfile "3d6cA.bssp"
#ERROR : Can't open dsspfile "3dmuA.bssp"
#ERROR : Can't open dsspfile "3dmuA.bssp"
#ERROR : Can't open dsspfile "3dmuA.bssp"
#ERROR : Can't open dsspfile "3dmuA.bssp"
#ERROR : Can't open dsspfile "3c1fA.bssp"
#ERROR : Can't open dsspfile "3c1fA.bssp"
#ERROR : Can't open dsspfile "3c1fA.bssp"
#ERROR : Can't open dsspfile "3c1fA.bssp"
#ERROR : Can't open dsspfile "3bdcA.bssp"
#ERROR : Can't open dsspfile "3bdcA.bssp"
#ERROR : Can't open dsspfile "3bdcA.bssp"
#ERROR : Can't open dsspfile "3bdcA.bssp"
#ERROR : Can't open dsspfile "3e5sA.bssp"
#ERROR : Can't open dsspfile "3e5sA.bssp"
#ERROR : Can't open dsspfile "3e5sA.bssp"
#ERROR : Can't open dsspfile "3e5sA.bssp"
#ERROR : Can't open dsspfile "3d4dA.bssp"
#ERROR : Can't open dsspfile "3d4dA.bssp"
#ERROR : Can't open dsspfile "3d4dA.bssp"
#ERROR : Can't open dsspfile "3d8gA.bssp"
#ERROR : Can't open dsspfile "3d8gA.bssp"
#ERROR : Can't open dsspfile "3d8gA.bssp"
#ERROR : Can't open dsspfile "3d8gA.bssp"
#ERROR : Can't open dsspfile "3ejiA.bssp"
#ERROR : Can't open dsspfile "3ejiA.bssp"
#ERROR : Can't open dsspfile "3ejiA.bssp"
#ERROR : Can't open dsspfile "3ejiA.bssp"
#ERROR : Can't open dsspfile "3dhqA.bssp"
#ERROR : Can't open dsspfile "3dhqA.bssp"
#ERROR : Can't open dsspfile "3dhqA.bssp"
#ERROR : Can't open dsspfile "3dhqA.bssp"
#ERROR : Can't open dsspfile "3c1eA.bssp"
#ERROR : Can't open dsspfile "1a2tA.bssp"

## Summary of PDB Search
:914
    4e-60  40%  3bdlA  [x.x.x] STAPHYLOCOCCAL NUCLEASE DOMAIN-CONTAINING
    5e-18  23%  2diqA  [x.x.x] TUDOR AND KH DOMAIN-CONTAINING PROTEIN
    3e-17  11%  3db4A  [x.x.x] E3 UBIQUITIN-PROTEIN LIGASE UHRF1
    2e-16  42%  2e6nA  [x.x.x] STAPHYLOCOCCAL NUCLEASE DOMAIN-CONTAINING
    1e-14  22%  3d4wA  [x.x.x] THERMONUCLEASE
    4e-14  22%  2d9tA  [x.x.x] TUDOR DOMAIN-CONTAINING PROTEIN 3
    3e-13  21%  3d6cA  [x.x.x] THERMONUCLEASE
    3e-12  24%  3dmuA  [x.x.x] THERMONUCLEASE
    5e-12  23%  3c1fA  [x.x.x] THERMONUCLEASE
    9e-12  16%  3bdcA  [x.x.x] THERMONUCLEASE
    1e-11  22%  3e5sA  [x.x.x] THERMONUCLEASE
    3e-11  22%  3d4dA  [x.x.x] THERMONUCLEASE
    3e-11  16%  3d8gA  [x.x.x] THERMONUCLEASE
    8e-11  20%  3ejiA  [x.x.x] THERMONUCLEASE
    1e-10  21%  3dhqA  [x.x.x] THERMONUCLEASE
    2e-10  15%  2digA  [x.x.x] LAMIN-B RECEPTOR
    4e-10  20%  3c1eA  [x.x.x] THERMONUCLEASE
    7e-10  15%  1a2tA  [x.x.x] STAPHYLOCOCCAL NUCLEASE
    6e-08  14%  2e5pA  [x.x.x] PHD FINGER PROTEIN 1
    2e-07  21%  2e5qA  [x.x.x] PHD FINGER PROTEIN 19
    7e-22  24%  3bdlA  [x.x.x] STAPHYLOCOCCAL NUCLEASE DOMAIN-CONTAINING(query 25->330)
    2e-11  22%  3d4wA  [x.x.x] THERMONUCLEASE(query 26->169)
    4e-10  16%  3d4wA  [x.x.x] THERMONUCLEASE(query 340->472)
    7e-09  18%  3d4wA  [x.x.x] THERMONUCLEASE(query 522->648)
    1e-08  24%  3d6cA  [x.x.x] THERMONUCLEASE(query 195->326)
    2e-08  22%  3d6cA  [x.x.x] THERMONUCLEASE(query 525->645)
    2e-08  16%  3d6cA  [x.x.x] THERMONUCLEASE(query 343->472)
    8e-06  15%  3d6cA  [x.x.x] THERMONUCLEASE(query 758->904)
    4e-10  19%  3dmuA  [x.x.x] THERMONUCLEASE(query 525->648)
    3e-09  25%  3dmuA  [x.x.x] THERMONUCLEASE(query 193->326)
    2e-08  17%  3dmuA  [x.x.x] THERMONUCLEASE(query 343->472)
    5e-05  14%  3dmuA  [x.x.x] THERMONUCLEASE(query 758->904)
    2e-11  20%  3c1fA  [x.x.x] THERMONUCLEASE(query 25->167)
    9e-10  16%  3c1fA  [x.x.x] THERMONUCLEASE(query 341->472)
    4e-07  19%  3c1fA  [x.x.x] THERMONUCLEASE(query 527->648)
    1e-04  16%  3c1fA  [x.x.x] THERMONUCLEASE(query 758->904)
    4e-10  22%  3bdcA  [x.x.x] THERMONUCLEASE(query 25->167)
    1e-08  24%  3bdcA  [x.x.x] THERMONUCLEASE(query 193->326)
    5e-08  20%  3bdcA  [x.x.x] THERMONUCLEASE(query 527->648)
    1e-04  16%  3bdcA  [x.x.x] THERMONUCLEASE(query 758->904)
    1e-10  21%  3e5sA  [x.x.x] THERMONUCLEASE(query 24->167)
    5e-08  15%  3e5sA  [x.x.x] THERMONUCLEASE(query 343->472)
    3e-07  19%  3e5sA  [x.x.x] THERMONUCLEASE(query 525->645)
    1e-05  14%  3e5sA  [x.x.x] THERMONUCLEASE(query 758->904)
    2e-10  16%  3d4dA  [x.x.x] THERMONUCLEASE(query 341->472)
    6e-08  23%  3d4dA  [x.x.x] THERMONUCLEASE(query 193->326)
    5e-07  21%  3d4dA  [x.x.x] THERMONUCLEASE(query 527->648)
    6e-11  23%  3d8gA  [x.x.x] THERMONUCLEASE(query 193->327)
    8e-11  22%  3d8gA  [x.x.x] THERMONUCLEASE(query 26->167)
    8e-08  20%  3d8gA  [x.x.x] THERMONUCLEASE(query 527->648)
    3e-04  14%  3d8gA  [x.x.x] THERMONUCLEASE(query 758->904)
    1e-10  15%  3ejiA  [x.x.x] THERMONUCLEASE(query 340->472)
    4e-09  22%  3ejiA  [x.x.x] THERMONUCLEASE(query 192->326)
    5e-07  20%  3ejiA  [x.x.x] THERMONUCLEASE(query 522->648)
    3e-06  14%  3ejiA  [x.x.x] THERMONUCLEASE(query 758->904)
    2e-09  24%  3dhqA  [x.x.x] THERMONUCLEASE(query 193->326)
    2e-08  15%  3dhqA  [x.x.x] THERMONUCLEASE(query 341->472)
    2e-07  20%  3dhqA  [x.x.x] THERMONUCLEASE(query 527->648)
    2e-04  16%  3dhqA  [x.x.x] THERMONUCLEASE(query 758->904)
    6e-05  20%  3c1eA  [x.x.x] THERMONUCLEASE(query 527->648)
    9e-10  21%  1a2tA  [x.x.x] STAPHYLOCOCCAL NUCLEASE(query 28->167)
:914

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxRRGLVKSVLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDS
3bdlA           ----------------------------------------------------------------------
2diqA           ----------------------------------------------------------------------
3db4A           ----------------------------------------------------------------------
2e6nA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
2d9tA           ----------------------------------------------------------------------
3d6cA           ---------------------------LIKAIDGDTVKLMY-----KGQPMTFRLLEVDTPETKH-----
3dmuA           -------------------------ATLIKAIDGDTVKL-----MYKGQPMTFRLLLVDTPEKY------
3c1fA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3d4dA           -----------------------EPATLIKAIDGDTVKL-----MYKGQPMTFRLLLVDTPEFN------
3d8gA           ----------------------------------------------------------------------
3ejiA           -----------------------EPATLIKAIDGDTVKLMYKGQP-----MTFRKLLVDTPEFN------
3dhqA           -----------------------EPATLIKAIDGDTVKL-----MYKGQPMTFRLLLVDTPEFN------
2digA           ----------------------------------------------------------------------
3c1eA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
2e5pA           ----------------------------------------------------------------------
2e5qA           ----------------------------------------------------------------------
3bdlA           ------------------------VAKVMQVLNADAIVVKLNS----GDYKTIHLSSIRPPRLEGENTQD
3d4wA           -------------------------ATLIKAIDGDTVKL-----MYKGQPMTFRLLLVDTPEFN------
3d4wA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3c1fA           ------------------------PATLIKAIDGDTVKL-----MYKGQPMTFRLLLVDTPEFN------
3c1fA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3bdcA           ------------------------PATLIKAIDGDTVKL-----MYKGQPMTFRLLLVDTPEFN------
3bdcA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3e5sA           -----------------------EPATLIKAIDGDTVKL-----MYKGQPMTFRLLLVDTPEFN------
3e5sA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3d8gA           -------------------------ATLIKAIDGDTVKL-----MYKGQPMTFRLLLVDTPEFN------
3d8gA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3c1eA           ----------------------------------------------------------------------
1a2tA           ---------------------------LIKAIDGDTKLMY------KGQPMTFRLLLVDTPETKH-----


                         .         .         *         .         .         .         .:140
query           ASATPDEPYAWDSREYLRQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQ
3bdlA           ----------------------------------------------------------------------
2diqA           ----------------------------------------------------------------------
3db4A           ----------------------------------------------------------------------
2e6nA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
2d9tA           ----------------------------------------------------------------------
3d6cA           -PKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGL--AYIYADGKMVNEALVRQGLAKVYV
3dmuA           ------GPEASAFKKKMVENAKKIEVEFDKGQRTDKGRGLAYIYADGK------MVNEALVRQGLAKVYV
3c1fA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3d4dA           ------EKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGL--AEIYADGKMVNEALVRQGLAKVYV
3d8gA           ----------------------------------------------------------------------
3ejiA           ------EKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGL--AYIYADGKMVNEALVRQGLAKVAY
3dhqA           ------EKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGL--RYIYADGKMVNEALVRQGLAKVAY
2digA           ----------------------------------------------------------------------
3c1eA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
2e5pA           ----------------------------------------------------------------------
2e5qA           ----------------------------------------------------------------------
3bdlA           KNPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIASPATETVPAFSEATVTIGGINIAEALVSKGLATVQD
3d4wA           ------EKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGL--AYIYADGKMVNEALVRQGLRKVYV
3d4wA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3c1fA           ------EKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGL--AYIYADGKMVNEALKRQGLAKVAY
3c1fA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3bdcA           ------EKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGL--AYIYADGKMVNEALVRQGLAKVYV
3bdcA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3e5sA           ------EKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGL--AYIYADGKMVNEAKVRQGLAKVAY
3e5sA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3d8gA           ------EKYGPEASAFTKKMVENAKKREVEFDKGQRTDKYGRGL--AYIYADGKMVNEALVRQGLAKVYV
3d8gA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3c1eA           ----------------------------------------------------------------------
1a2tA           -PKKGVEKYGPEASAFTKKMVENAKKIEVEFDTDKYGRGLAYIYADGK------MVNEALVRQGLAKVAY


                         +         .         .         .         .         *         .:210
query           GKVADEYSTKLLELQEQAKSAGRGKWNSNAGTIRDIRWVIDNPRELVDKYAQKPIDAVIEMVRDGSTVRA
3bdlA           ----------------------------------------------------------------------
2diqA           ----------------------------------------------------------------------
3db4A           ----------------------------------------------------------------------
2e6nA           ----------------------------------------------------------------------
3d4wA           ---------------------------------------------------LHKEPATLIKAIDGDTVK-
2d9tA           ----------------------------------------------------------------------
3d6cA           YKGNNTHEQLLRKAEAQAKKEKLNIWS-------------------------------------------
3dmuA           YKGNNTHEQLLRKAEAQAKKEKLNIWS-------------------------------------------
3c1fA           ----------------------------------------------------HKEPATLIKAIDGDTVK-
3bdcA           ----------------------------------------------------------------------
3e5sA           ------------------------------------------------------EPATLIKAIDGDTVK-
3d4dA           YKGNNTHEQLLRKAEAQAKKEKLNIWS-------------------------------------------
3d8gA           ----------------------------------------------------------------------
3ejiA           VYKGNTHEQLLRKAEAQAKKEKLNIWS-------------------------------------------
3dhqA           VYKGNTHEQLLRKAEAQAKKEKLNIWS-------------------------------------------
2digA           ----------------------------------------------------------------------
3c1eA           ---------------------------------------------------LHKEPATLIKAIDGDTVK-
1a2tA           ----------------------------------------------------------------------
2e5pA           ----------------------------------------------------------------------
2e5qA           ----------------------------------------------------------------------
3bdlA           DDQRSSHYDELLAAEARAIKNGKGKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKL
3d4wA           YKGNNTHEQLLRKAEAQAKKEKLNIWSED-----------------------------------------
3d4wA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
3d6cA           ------------------------------------------------------EPATLIKAIDGDTVK-
3d6cA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------HKEPATLIKAIDGDTVK-
3dmuA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3c1fA           VYKGNTHEQLLRKAEAQAKKEKLNIWS-------------------------------------------
3c1fA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3bdcA           YKGNNTHEQLLRKAEAQAKKEKLNIWS-------------------------------------------
3bdcA           ----------------------------------------------------HKEPATLIKAIDGDTVK-
3bdcA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3e5sA           VYKGNTHEQLLRKAEAQAKKEKLNIWS-------------------------------------------
3e5sA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------HKEPATLIKAIDGDTVK-
3d4dA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------HKEPATLIKAIDGDTVK-
3d8gA           YKGNNTHEQLLRKAEAQAKKEKLNIWS-------------------------------------------
3d8gA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3ejiA           ---------------------------------------------------LHKEPATLIKAIDGDTVK-
3ejiA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------HKEPATLIKAIDGDTVK-
3dhqA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3c1eA           ----------------------------------------------------------------------
1a2tA           VYKPNTHEQHLRKSEAQAKKEKLNIWS-------------------------------------------


                         .         .         .         +         .         .         .:280
query           FLLPNFEYITLQLSGVRAPSTRNPNAADXXXXXXXXXXXXXXXXXLLQRDVQIILESTSNQNFVGSIVHP
3bdlA           ----------------------------------------------------------------------
2diqA           ----------------------------------------------------------------------
3db4A           ----------------------------------------------------------------------
2e6nA           ----------------------------------------------------------------------
3d4wA           -LMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKM---------VENAKKIEVEFDKGQRTGLAYIYAD
2d9tA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3c1fA           -LMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKM---------VENAKKIEVEFDKGQRRGLAYIYAD
3bdcA           ----------------------------------------------------------------------
3e5sA           -LMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKM---------VENAKKIEVEFDKGQRTGLAYIYAD
3d4dA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
2digA           ----------------------------------------------------------------------
3c1eA           -LMYKGQPMTFRLLLVDTPEFNEKYGPE---------ASAFTKKMVENAKKIEVEFDKGQGRGLAYIYAD
1a2tA           ----------------------------------------------------------------------
2e5pA           ----------------------------------------------------------------------
2e5qA           ----------------------------------------------------------------------
3bdlA           YLPKETCLITFLLAGIECPRGARNLPGLVQEGEPFSEEATLFTKELVQREVEVEVESMKAGNFIGWLHID
3d4wA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
3d6cA           -LMYKGQPMTFRLLEVDTPETKHPKKGVEKYGPEASAFTKKM---VENAKKIEVEFDKGQRTGLAYIYAD
3d6cA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3dmuA           -LMYKGQPMTFRLLLVDTPEKYGPEASAFKKKMVEN---------AKKIEVEFDKGQRTDKYGLAYIYAD
3dmuA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3bdcA           -LMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKM---------VENAKKIEVEFDKGQRTGLAYIYAD
3bdcA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d4dA           -LMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKM---------VENAKKIEVEFDKGQRRGLAEIYAD
3d4dA           ----------------------------------------------------------------------
3d8gA           -LMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKM---------VENAKKREVEFDKGQRTGLAYIYAD
3d8gA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3ejiA           -LMYKGQPMTFRKLLVDTPEFNEKYGPEASAFTKKM---------VENAKKIEVEFDKGQRTGLAYIYAD
3ejiA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3dhqA           -LMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKM---------VENAKKIEVEFDKGQRTGLRYIYAD
3dhqA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3c1eA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KGNIAESLLREGYAKCVDWSIGLCTGGAQKLRDAERQAKEKRLRLWKSYQxxxxxxxxxRKAFTGKVVEI
3bdlA           ------------------------------------------------------------KQFVAKVMQV
2diqA           ----------------------------------------------------------------------
3db4A           ----------------------------------------------------------------------
2e6nA           ----------------------------------------------------------------------
3d4wA           GKMVNEALVRQGLRK-VAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSE----------------------
2d9tA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3c1fA           GKMVNEALKRQGLAK-VAYVYKGNNTHEQLLRKAEAQAKKEKLNIW------------------------
3bdcA           ------------------------------------------------------------HKEPATLIKA
3e5sA           GKMVNEAKVRQGLAK-VAYVYKGNNTHEQLLRKAEAQAKKEKLNIW------------------------
3d4dA           ----------------------------------------------------------------------
3d8gA           ------------------------------------------------------------HKEPATLIKA
3ejiA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
2digA           ----------------------------------------------------------------------
3c1eA           GKMVNEALVRQGLA--KVAYVYKGNNTHEQLRKAEAQAKKEKLNIWS-----------------------
1a2tA           ------------------------------------------------------------HKEPATLIKA
2e5pA           ----------------------------------------------------------------------
2e5qA           ----------------------------------------------------------------------
3bdlA           GANLSVLLVEHALSKVHF--TAERSSYYKSLLSAEEAAKQKKEKVWAMPV--------------------
3d4wA           ----------------------------------------------------------------------
3d4wA           -----------------------------------------------------------LHKEPATLIKA
3d4wA           ----------------------------------------------------------------------
3d6cA           GKMVNEALVRQGLAK-VAYVYKGNNTHEQLLRKAEAQAKKEKLNIW------------------------
3d6cA           ----------------------------------------------------------------------
3d6cA           --------------------------------------------------------------EPATLIKA
3d6cA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3dmuA           GKMVNEALVRQGLAK-VAYVYKGNNTHEQLLRKAEAQAKKEKLNIW------------------------
3dmuA           --------------------------------------------------------------EPATLIKA
3dmuA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3c1fA           ------------------------------------------------------------HKEPATLIKA
3c1fA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3bdcA           GKMVNEALVRQGLAKVAYVYKGNNTH-EQLLRKAEAQAKKEKLNIW------------------------
3bdcA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3e5sA           --------------------------------------------------------------EPATLIKA
3e5sA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3d4dA           ------------------------------------------------------------HKEPATLIKA
3d4dA           GKMVNEALVRQGLAK-VAYVYKGNNTHEQLLRKAEAQAKKEKLNIW------------------------
3d4dA           ----------------------------------------------------------------------
3d8gA           GKMVNEALVRQGLAK-VAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS-----------------------
3d8gA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3ejiA           -----------------------------------------------------------LHKEPATLIKA
3ejiA           GKMVNEALVRQGLAK-VAYVYKGNNTHEQLLRKAEAQAKKEKLNIW------------------------
3ejiA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3dhqA           GKMVNEALVRQGLAKVAYVYKGNNTH-EQLLRKAEAQAKKEKLNIW------------------------
3dhqA           ------------------------------------------------------------HKEPATLIKA
3dhqA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3c1eA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VLSDAVVVQKDDGSEVKLHLSSIRLPRESGDDKATGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQ
3bdlA           LNADAIVVKLNSGDYKTIHLSSIRPPRL--EGENTQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVT
2diqA           ----------------------------------------------------------------------
3db4A           ----------------------------------------------------------------------
2e6nA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
2d9tA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3bdcA           IDGDTVKL-MYKGQPMTFRLLLVDTP-EFNE-----------------KYGPEASAFTKKMVENAKKIEV
3e5sA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d8gA           IDGDTVKL-MYKGQPMTFRLLLVDTP-EFNE-----------------KYGPEASAFTKKMVENAKKREV
3ejiA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
2digA           ----------------------------------------------------------------------
3c1eA           ----------------------------------------------------------------------
1a2tA           IDGDTKLMY--KGQPMTFRLLLVDTP-------ETKHPKK-----GVEKYGPEASAFTKKMVENAKKIEV
2e5pA           ----------------------------------------------------------------------
2e5qA           ----------------------------------------------------------------------
3bdlA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
3d4wA           IDGDTVKL-MYKGQPMTFRLLLVDTP-EFNE-----------------KYGPEASAFTKKMVENAKKIEV
3d4wA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3d6cA           IDGDTVKL-MYKGQPMTFRLLEVDTPETKHPKK------------GVEKYGPEASAFTKKMVENAKK-IE
3d6cA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3dmuA           IDGDTVKL-MYKGQPMTFRLLLVDTP-EKYG-----------------PEASAFKKKMVENAKKIEVEF-
3dmuA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3c1fA           IDGDTVKL-MYKGQPMTFRLLLVDTP-EFNE-----------------KYGPEASAFTKKMVENAKKIEV
3c1fA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3e5sA           IDGDTVKL-MYKGQPMTFRLLLVDTP-EFNE-----------------KYGPEASAFTKKMVENAKKIEV
3e5sA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3d4dA           IDGDTVKL-MYKGQPMTFRLLLVDTP-EFNE-----------------KYGPEASAFTKKMVENAKKIEV
3d4dA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3ejiA           IDGDTVKL-MYKGQPMTFRKLLVDTP-EFNE-----------------KYGPEASAFTKKMVENAKKIE-
3ejiA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3dhqA           IDGDTVKL-MYKGQPMTFRLLLVDTP-EFNE-----------------KYGPEASAFTKKMVENAKKIEV
3dhqA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3c1eA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           IDYVQPKSENFPEKTCATIKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTXXXXXXXXXXXXXXXF
3bdlA           VDYIRPASPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLH
2diqA           ----------------------------------------------------------------------
3db4A           ----------------------------------------------------------------------
2e6nA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
2d9tA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3bdcA           EF-DKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLL------------------
3e5sA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d8gA           EFDKGQRTDKY-GRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLL------------------
3ejiA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
2digA           ----------------------------------------------------------------------
3c1eA           ----------------------------------------------------------------------
1a2tA           EFDKGQRTDKYGRG-LAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHL------------------
2e5pA           ----------------------------------------------------------------------
2e5qA           ----------------------------------------------------------------------
3bdlA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
3d4wA           EF-DKGQRTDKYGRGLAYIYADGKMVNEALVRQGLRKVAYVYKGNNTHEQLL------------------
3d4wA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3d6cA           VEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLL------------------
3d6cA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3dmuA           -DKGQRTDKYG--RGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLL------------------
3dmuA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3c1fA           EFDKGQRTDKY-GRGLAYIYADGKMVNEALKRQGLAKVAYVYKGNNTHEQLL------------------
3c1fA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3e5sA           EFDKGQRTDKYGR-GLAYIYADGKMVNEAKVRQGLAKVAYVYKGNNTHEQLL------------------
3e5sA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3d4dA           EF-DKGQRTDKYGRGLAEIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLL------------------
3d4dA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3ejiA           VEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLL------------------
3ejiA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3dhqA           EFDKGQRTDKYG-RGLRYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLL------------------
3dhqA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3c1eA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           ADKTAEKKDTHRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETVLITFLLGGINCP
3bdlA           SKKEVP---IHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECP
2diqA           ----------------------------------------------------------------------
3db4A           ----------------------------------------------------------------------
2e6nA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
2d9tA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
2digA           ----------------------------------------------------------------------
3c1eA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
2e5pA           ----------------------------------------------------------------------
2e5qA           ----------------------------------------------------------------------
3bdlA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
3d4wA           -------------------------------KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLL--LVDTP
3d6cA           ----------------------------------------------------------------------
3d6cA           ----------------------------------KEPATLIKAIDGDTVKLMYKGQPM--TFRLLEVDTP
3d6cA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3dmuA           ----------------------------------KEPATLIKAIDGDTVKLMYKGQPMTFRLL--LVDTP
3dmuA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3c1fA           ------------------------------------PATLIKAIDGDTVKLMYKGQPMTFRLL--LVDTP
3c1fA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3bdcA           ------------------------------------PATLIKAIDGDTVKLMYKGQPMTFRLL--LVDTP
3bdcA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3e5sA           ----------------------------------KEPATLIKAIDGDTVKLMYKGQPMTFRLL--LVDTP
3e5sA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d4dA           ------------------------------------PATLIKAIDGDTVKLMYKGQP--MTFRLLLVDTP
3d8gA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3d8gA           ------------------------------------PATLIKAIDGDTVKLMYKGQPMTFRLL--LVDTP
3d8gA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3ejiA           -------------------------------KLHKEPATLIKAIDGDTVKLMYKGQP--MTFRKLLVDTP
3ejiA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3dhqA           ------------------------------------PATLIKAIDGDTVKLMYKGQPMTFRLL--LVDTP
3dhqA           ----------------------------------------------------------------------
3c1eA           ------------------------------------PATLIKAIDGDTVKLMYKGQPMTFRLL--LVDTP
1a2tA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           KGARVGPGGVSTGXXXXXXXXXXXXTRKLVLQHEVQLEVESTDKNGNFVGYLYVSPDGNTSRAINLSEAL
3bdlA           RGARNLPGL--VQEGEPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHIDG-------ANLSVLL
2diqA           ----------------------------------------------------------------------
3db4A           ----------------------------------------------------------------------
2e6nA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
2d9tA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
2digA           ----------------------------------------------------------------------
3c1eA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
2e5pA           ----------------------------------------------------------------------
2e5qA           ----------------------------------------------------------------------
3bdlA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
3d4wA           EFNE--KYG----------PEASAFTKKMVENAKKIEVEFRTDKYGRGLAYIYADG-------KMVNEAL
3d6cA           ----------------------------------------------------------------------
3d6cA           ETKHPKKGVEKYGPEASAF------TKKMVENAKKIEVEFRTDKYGRGLAYIYA-------DGKMVNEAL
3d6cA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3dmuA           E--KYGPEA----------SAFKKKMVENAKKIEVEFDGQRTDKYGRGLAYIYAD-------GKMVNEAL
3dmuA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3c1fA           E--FNEKYG----------PEASAFTKKMVENAKKIEVEFRTDKYGRGLAYIYADG-------KMVNEAL
3c1fA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3bdcA           E--FNEKYG----------PEASAFTKKMVENAKKIEVEFRTDKYGRGLAYIYA-------DGKMVNEAL
3bdcA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3e5sA           E--FNEKYG----------PEASAFTKKMVENAKKIEVEFRTDKYGRGLAYIYADG-------KMVNEAK
3e5sA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d4dA           --EFNEKYG----------PEASAFTKKMVENAKKIEVEFRTDKYGRGLAEIYADG-------KMVNEAL
3d8gA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3d8gA           EFNE--KYG----------PEASAFTKKMVENAKKREVEQRTDKYGRGLAYIYA-------DGKMVNEAL
3d8gA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3ejiA           E--FNEKYG----------PEASAFTKKMVENAKKIEKGQRTDKYGRGLAYIYADG-------KMVNEAL
3ejiA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3dhqA           E--FNEKYG----------PEASAFTKKMVENAKKIEVEFRTDKYGRGLRYIYADG-------KMVNEAL
3dhqA           ----------------------------------------------------------------------
3c1eA           EFNE--KYGPEASAF----------TKKMVENAKKIEVEFDTDKYGRGLAYIYA-------DGKMVNEAL
1a2tA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           VENGLASLHFTAERSGHYXXXXXXXXXXXXXXXXXXXXFTXXXXXXXXXXXXADTSERKQNFRQVAVTDI
3bdlA           VEHALSKVHFTAERSSYYKSLLSAEEAAKQKKEKVWAMPV-------------LEEKERSASYKPVFVTE
2diqA           ----------------------------------------------------------------------
3db4A           ----------------------------------------------------------------------
2e6nA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
2d9tA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
2digA           ----------------------------------------------------------------------
3c1eA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
2e5pA           ----------------------------------------------------------------------
2e5qA           ----------------------------------------------------------------------
3bdlA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
3d4wA           VRQGLRKVAYVYKGNNTH----------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3d6cA           VRQGLAKVAYVYKGN-------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3dmuA           VRQGLAKVAYVYKGNNTH----------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3c1fA           KRQGLAKVAYVYKGNNTH----------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3bdcA           VRQGLAKVAYVYKGNNTH----------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3e5sA           VRQGLAKVAYVYKGN-------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d4dA           VRQGLAKVAYVYKGNNTH----------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3d8gA           VRQGLAKVAYVYKGNNTH----------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3ejiA           VRQGLAKVAYVYKGNNTH----------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3dhqA           VRQGLAKVAYVYKGNNTH----------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3c1eA           VRQGLAKVAYVYKGNNTH----------------------------------------------------
1a2tA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           APGALRFSAQNIEDGPKIEKMTTEMRQALAEHPPLAGSYTTKRGDLCVAKFSQDGQWYRCKVESVRAGQA
3bdlA           ITDDLHFYVQDVETGTQLEKLMENMRNDIASHPPVEGSYAPRRGEFCIAKFV-DGEWYRARVEKVSPAKI
2diqA           ----------------QLDKLVNEMTQHYENSVPEDLTV--HVGDIVAAPLPTNGSWYRARVLGTENGNL
3db4A           ------------------------------------TELLYKVNEYVDARDT-NGAWFEAQVVRVEDVIY
2e6nA           ---------SGSSGGTQLEKLMENMRNDIASHPPVEGSYAPRRGEFCIAKFV-DGEWYRARVEKVEPAKI
3d4wA           ----------------------------------------------------------------------
2d9tA           ---------------------------------SGSSGKVWKPGDECFALYWEDNKFYRAEVEALSGMTA
3d6cA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
2digA           -------------------------------------SRKFADGEVVRGRWPGSSLYYEVEILSHSTSQL
3c1eA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
2e5pA           -----------------------------------SSGPRLWEGQDVLARWT-DGLLYLGTIKKVSAREV
2e5qA           -----------------------------------SGSSGLTEGQYVLCRWT-DGLYYLGKIKRVSSKQS
3bdlA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3d6cA           ---------------------------------------------------------EPATLIKAIDGDT
3dmuA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3dmuA           ---------------------------------------------------------EPATLIKAIDGDT
3c1fA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3c1fA           ---------------------------------------------------------EPATLIKAIDGDT
3bdcA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3bdcA           ---------------------------------------------------------EPATLIKAIDGDT
3e5sA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3e5sA           ---------------------------------------------------------EPATLIKAIDGDT
3d4dA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3d8gA           ---------------------------------------------------------EPATLIKAIDGDT
3ejiA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3ejiA           ---------------------------------------------------------EPATLIKAIDGDT
3dhqA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3dhqA           ---------------------------------------------------------EPATLIKAIDGDT
3c1eA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           EIVYIDYGNRETIEAVKLAQIPAGFANFPAGVREYNLALAKLPNEDYVQLTSDAFAQYLFGHSSVFINSE
3bdlA           HVFYIDYGNREVLPSTRLGTLSPAFSTRVAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVE
2diqA           DLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECSLARIASGPS-------------------------
3db4A           HVKYDDYPENGVVQNSRVRARARTIIKWQDLEVGQVVLNYNPDNPKERGFWYDARKRETRTARELYAN-V
2e6nA           HVFYIDYGNREVLPSTRLGTLSPAFRVLPAQATEYAFA--------------------------------
3d4wA           ----------------------------------------------------------------------
2d9tA           VVKFTDYGNYEEVLLSNIKPVQTEAWVRDPNSGPS-----------------------------------
3d6cA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
2digA           YTVKYKDGTELELKENDIKSGP------------------------------------------------
3c1eA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
2e5pA           CLVQFEDDSQFLVLWKDISPAALSG---------------------------------------------
2e5qA           CLVTFEDNSKYWV---------------------------------------------------------
3bdlA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3d6cA           VKLMYKGQPMT----FRLLEVDT-----PETKHPKK------GVEKYGPEASAFTKKMVENAKKIEVEFD
3dmuA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3dmuA           VKLMYKGQPMT----FRLLLVDT-----PE------------KYGPEASAFKKKMVENAKKIEVEFDKGQ
3c1fA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3c1fA           VKLMYKGQPMT----FRLLLVDT-----PE------------FNEKYGPEASAFTKKMVENAKKIEVEFD
3bdcA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3bdcA           VKLMYKGQPMT----FRLLLVDT-----PE------------FNEKYGPEASAFTKKMVENAKKIEVEFD
3e5sA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3e5sA           VKLMYKGQPMT----FRLLLVDTPEFNEKYG-----------------PEASAFTKKMVENAKKIEVEFD
3d4dA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3d8gA           VKLMYKGQPMT----FRLLLVDTPEFNEKYG-----------------PEASAFTKKMVENAKKREVEFD
3ejiA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3ejiA           VKLMYKGQPMT----FRKLLVDT-----PEFNEKYG------------PEASAFTKKMVENAKKIEVEFD
3dhqA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3dhqA           VKLMYKGQPMT----FRLLLVDT-----PE------------FNEKYGPEASAFTKKMVENAKKIEVEFD
3c1eA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           YKVGTSEYVTVYYDSGNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSRKNIWxxxxxx
3bdlA           HLSAGCPHVTLQFA--DSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESA--------------
2diqA           ----------------------------------------------------------------------
3db4A           VLDDSLNDCRII----------------------------------------------------------
2e6nA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
2d9tA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
2digA           ----------------------------------------------------------------------
3c1eA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
2e5pA           ----------------------------------------------------------------------
2e5qA           ----------------------------------------------------------------------
3bdlA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
3d4wA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3d6cA           ----------------------------------------------------------------------
3d6cA           KGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKV-AYVYKGNNTHEQLLRKAEAQAKKEKLNIW------
3dmuA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3dmuA           ----------------------------------------------------------------------
3dmuA           ---RTDKYGRGLAYIYADGKMVNEALVRQGLAKV-AYVYKGNNTHEQLLRKAEAQAKKEKLNIW------
3c1fA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3c1fA           ----------------------------------------------------------------------
3c1fA           KGQRTDKYGRGLAYIYADGKMVNEALKRQGLAKV-AYVYKGNNTHEQLLRKAEAQAKKEKLNIW------
3bdcA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3bdcA           ----------------------------------------------------------------------
3bdcA           KGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKV-AYVYKGNNTHEQLLRKAEAQAKKEKLNIW------
3e5sA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3e5sA           ----------------------------------------------------------------------
3e5sA           KGQRTDKYGRGLAYIYADGKMVNEAKVRQGLAKV-AYVYKGNNTHEQLLRKAEAQAKKEKLNIW------
3d4dA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d4dA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3d8gA           ----------------------------------------------------------------------
3d8gA           KGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKV-AYVYKGNNTHEQLLRKAEAQAKKEKLNIW------
3ejiA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3ejiA           ----------------------------------------------------------------------
3ejiA           KGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKV-AYVYKGNNTHEQLLRKAEAQAKKEKLNIW------
3dhqA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3dhqA           ----------------------------------------------------------------------
3dhqA           KGQRTDKYGRGLRYIYADGKMVNEALVRQGLAKV-AYVYKGNNTHEQLLRKAEAQAKKEKLNIW------
3c1eA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxx
3bdlA           ----
2diqA           ----
3db4A           ----
2e6nA           ----
3d4wA           ----
2d9tA           ----
3d6cA           ----
3dmuA           ----
3c1fA           ----
3bdcA           ----
3e5sA           ----
3d4dA           ----
3d8gA           ----
3ejiA           ----
3dhqA           ----
2digA           ----
3c1eA           ----
1a2tA           ----
2e5pA           ----
2e5qA           ----
3bdlA           ----
3d4wA           ----
3d4wA           ----
3d4wA           ----
3d6cA           ----
3d6cA           ----
3d6cA           ----
3d6cA           ----
3dmuA           ----
3dmuA           ----
3dmuA           ----
3dmuA           ----
3c1fA           ----
3c1fA           ----
3c1fA           ----
3c1fA           ----
3bdcA           ----
3bdcA           ----
3bdcA           ----
3bdcA           ----
3e5sA           ----
3e5sA           ----
3e5sA           ----
3e5sA           ----
3d4dA           ----
3d4dA           ----
3d4dA           ----
3d8gA           ----
3d8gA           ----
3d8gA           ----
3d8gA           ----
3ejiA           ----
3ejiA           ----
3ejiA           ----
3ejiA           ----
3dhqA           ----
3dhqA           ----
3dhqA           ----
3dhqA           ----
3c1eA           ----
1a2tA           ----