[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cele0:AAN63415.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c48A.bssp"
#ERROR : Can't open dsspfile "3c48B.bssp"
#ERROR : Can't open dsspfile "3dzcA.bssp"
#ERROR : Can't open dsspfile "3c4qB.bssp"
#ERROR : Can't open dsspfile "3c4qA.bssp"
#ERROR : Can't open dsspfile "3beoA.bssp"
#ERROR : Can't open dsspfile "3e3lD.bssp"
#ERROR : Can't open dsspfile "2bisA.bssp"
#ERROR : Can't open dsspfile "3e3lC.bssp"
#ERROR : Can't open dsspfile "2c4mA.bssp"
#ERROR : Can't open dsspfile "1e4oA.bssp"
#ERROR : Can't open dsspfile "3e3lB.bssp"
#ERROR : Can't open dsspfile "3cuvA.bssp"
#ERROR : Can't open dsspfile "3e3oA.bssp"
#ERROR : Can't open dsspfile "3e3oB.bssp"
#ERROR : Can't open dsspfile "3e3lA.bssp"
#ERROR : Can't open dsspfile "3e3nC.bssp"
#ERROR : Can't open dsspfile "3d1jA.bssp"
#ERROR : Can't open dsspfile "1e1yA.bssp"
#ERROR : Can't open dsspfile "2atiA.bssp"
#ERROR : Can't open dsspfile "3cuyA.bssp"
#ERROR : Can't open dsspfile "1a8iA.bssp"
#ERROR : Can't open dsspfile "3e3nE.bssp"
#ERROR : Can't open dsspfile "3cv3A.bssp"
#ERROR : Can't open dsspfile "1b4dA.bssp"
#ERROR : Can't open dsspfile "3ddsA.bssp"
#ERROR : Can't open dsspfile "3ddwB.bssp"
#ERROR : Can't open dsspfile "3e3oD.bssp"
#ERROR : Can't open dsspfile "3dd1B.bssp"
#ERROR : Can't open dsspfile "3cejA.bssp"
#ERROR : Can't open dsspfile "2bgtA.bssp"
#ERROR : Can't open dsspfile "3e3oC.bssp"
#ERROR : Can't open dsspfile "3copA.bssp"
#ERROR : Can't open dsspfile "2c4mC.bssp"
#ERROR : Can't open dsspfile "2bguA.bssp"
#ERROR : Can't open dsspfile "3ddsB.bssp"
#ERROR : Can't open dsspfile "1c3jA.bssp"
#ERROR : Can't open dsspfile "2acvA.bssp"
#ERROR : Can't open dsspfile "3cehA.bssp"
#ERROR : Can't open dsspfile "1c8lA.bssp"
#ERROR : Can't open dsspfile "1bx3A.bssp"
#ERROR : Can't open dsspfile "2bfwA.bssp"
#ERROR : Can't open dsspfile "2c4mB.bssp"
#ERROR : Can't open dsspfile "2acvB.bssp"
#ERROR : Can't open dsspfile "1ahpA.bssp"
#ERROR : Can't open dsspfile "2ecpA.bssp"
#ERROR : Can't open dsspfile "3bjxD.bssp"
#ERROR : Can't open dsspfile "2c9zA.bssp"
#ERROR : Can't open dsspfile "2c1zA.bssp"
#ERROR : Can't open dsspfile "3bjxB.bssp"
#ERROR : Can't open dsspfile "3d0rA.bssp"
#ERROR : Can't open dsspfile "2c1xA.bssp"
#ERROR : Can't open dsspfile "3d0rB.bssp"
#ERROR : Can't open dsspfile "1bc9A.bssp"
#ERROR : Can't open dsspfile "1dvgA.bssp"
#ERROR : Can't open dsspfile "3d0qA.bssp"
#ERROR : Can't open dsspfile "3bppA.bssp"

## Summary of PDB Search
:400
    2e-38  20%  3c48A  [x.x.x] PREDICTED GLYCOSYLTRANSFERASES
    4e-35  19%  3c48B  [x.x.x] PREDICTED GLYCOSYLTRANSFERASES
    8e-35  14%  3dzcA  [x.x.x] UDP-N-ACETYLGLUCOSAMINE 2-EPIMERASE
    9e-35  20%  3c4qB  [x.x.x] PREDICTED GLYCOSYLTRANSFERASES
    6e-33  19%  3c4qA  [x.x.x] PREDICTED GLYCOSYLTRANSFERASES
    8e-33  12%  3beoA  [x.x.x] UDP-N-ACETYLGLUCOSAMINE 2-EPIMERASE
    3e-32   8%  3e3lD  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    4e-32  15%  2bisA  [x.x.x] GLGA GLYCOGEN SYNTHASE
    3e-31   8%  3e3lC  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    9e-30  11%  2c4mA  [x.x.x] GLYCOGEN PHOSPHORYLASE
    1e-29  12%  1e4oA  [c.87.1] MALTODEXTRIN PHOSPHORYLASE
    4e-29   8%  3e3lB  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    4e-29   8%  3cuvA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    6e-29   8%  3e3oA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    8e-29   9%  3e3oB  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-28   9%  3e3lA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-27   8%  3e3nC  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-27  11%  3d1jA  [x.x.x] GLYCOGEN SYNTHASE
    4e-27   9%  1e1yA  [c.87.1] GLYCOGEN PHOSPHORYLASE
    7e-27  12%  2atiA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    2e-26  12%  3cuyA  [x.x.x] GLUCURONOSYLTRANSFERASE GUMK
    3e-26   8%  1a8iA  [x.x.x] GLYCOGEN PHOSPHORYLASE B
    3e-26   9%  3e3nE  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-25  13%  3cv3A  [x.x.x] GLUCURONOSYLTRANSFERASE GUMK
    5e-25  10%  1b4dA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE B)
    2e-24  12%  3ddsA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    3e-24  13%  3ddwB  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    3e-24  10%  3e3oD  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-24  13%  3dd1B  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    9e-24  12%  3cejA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    1e-23   9%  2bgtA  [x.x.x] BETA-GLUCOSYLTRANSFERASE
    1e-23   9%  3e3oC  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    2e-23   9%  3copA  [x.x.x] GLYCOGEN SYNTHASE
    3e-23  11%  2c4mC  [x.x.x] GLYCOGEN PHOSPHORYLASE
    6e-23   9%  2bguA  [x.x.x] BETA-GLUCOSYLTRANSFERASE
    2e-22  13%  3ddsB  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    3e-22  11%  1c3jA  [c.87.1] BETA-GLUCOSYLTRANSFERASE
    3e-22   9%  2acvA  [x.x.x] TRITERPENE UDP-GLUCOSYL TRANSFERASE UGT71G1[MASQUE :
    4e-22  12%  3cehA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    4e-21  11%  1c8lA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)
    5e-21  12%  1bx3A  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE B)
    7e-21  23%  2bfwA  [x.x.x] GLGA GLYCOGEN SYNTHASE
    2e-20   7%  2c4mB  [x.x.x] GLYCOGEN PHOSPHORYLASE
    8e-19  10%  2acvB  [x.x.x] TRITERPENE UDP-GLUCOSYL TRANSFERASE UGT71G1[MASQUE :
    1e-14  12%  1ahpA  [c.87.1] E.COLI MALTODEXTRIN PHOSPHORYLASE
    1e-14  12%  2ecpA  [c.87.1] MALTODEXTRIN PHOSPHORYLASE
    2e-13   8%  3bjxD  [x.x.x] HALOCARBOXYLIC ACID DEHALOGENASE DEHI
    3e-13  11%  2c9zA  [x.x.x] UDP GLUCOSE\:FLAVONOID 3-O-GLUCOSYLTRANSFERASE
    3e-13  12%  2c1zA  [x.x.x] UDP-GLUCOSE FLAVONOID 3-O GLYCOSYLTRANSFERASE
    3e-13   9%  3bjxB  [x.x.x] HALOCARBOXYLIC ACID DEHALOGENASE DEHI
    5e-13  11%  3d0rA  [x.x.x] PROTEIN CALG3
    2e-12  12%  2c1xA  [x.x.x] UDP-GLUCOSE FLAVONOID 3-O GLYCOSYLTRANSFERASE
    3e-10  10%  3d0rB  [x.x.x] PROTEIN CALG3
    1e-09  12%  1bc9A  [x.x.x] CYTOHESIN-1
    3e-07  10%  1dvgA  [a.132.1] HEME OXYGENASE-1
    2e-04  19%  3d0qA  [x.x.x] PROTEIN CALG3
    6e-04   8%  3bppA  [x.x.x] 1510-N MEMBRANE PROTEASE
:400

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVRVTILHPDLGIGGAERLIVDAAVGLQDRGHSVRIFTNQYSRSHCFQETLDLDICTVVPWIPRSIFGKG
3c48A           --RVAMISMHTSQQGMNVYILSTATELAKQGIEVDIYTRATRPSQGEIVRVAENLRVINIGPYEGLSKEE
3c48B           --RVAMISMHTSQQGMNVYILSTATELAKQGIEVDIYTRATRPSQGEIVRVAENLRVINIGPYEGLSKEE
3dzcA           --KKVLIVF--GTRPEAIKMAPLVQQLCQDNRFVAKVCVTGQHREMLDQVLELFSI--TPDFDLNIMEPG
3c4qB           -----QQPGTGDSGGMNVYILSTATELAKQGIEVDIYTRATRPSQGEIVRVAERVINIAAGPYEGLSKEE
3c4qA           -----QQPGTGDSGGMNVYILSTATELAKQGIEVDIYTRATRPSQGEIVRVAENLRVINIAAGPYEGLSK
3beoA           --KVMTIFGT---RPEAIKMAPLVLELQKHPEKIESIVTVTAQHRQMLDQVLSIFGITPDFDLNIMKDRQ
3e3lD           -------DWDKAWEVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGD-
2bisA           --KVLLLGLPVKVGGLAEALTAISEALASLGHEVLVFTPSHGRFQGEEIGKIRVFGEEVQVKVSYEERGN
3e3lC           LVDLERLDWDKAWEVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGD-
2c4mA           -KTFAYTNHTVLTEALEQWDEQIFQQLFWRVWEIIAEID-----RRFRLERAADGLDEETINRMAPIQHG
1e4oA           VIQLNDTHPTIAIPELLRVLIDEHQMSWDDAWAITSKTFAYTNHTLMPEALERWDVKLVKGLLPRHMQII
3e3lB           LVDLERLDWDKAWEVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDV
3cuvA           ------LDWDKAWEVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDV
3e3oA           ------------WEVTVKTCAYTNHTVIPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDV
3e3oB           -------------EVTVKTCAYTNHTVIPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDV
3e3lA           LVDLERLDWDKAWEVTVKTCAYTNHTVLPEAL-ERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGD
3e3nC           -------------------------------WPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRL
3d1jA           --------------------------------------------PDVVHAHDWHAGLAPAYLAARGRPAK
1e1yA           -----------VTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRL
2atiA           ------------------------------------------------------------DRIVALFPKD
3cuyA           ------------RANIHFITDQLALRGTTRFFSLRGDMRLPLDSHNGVDCYLWRTTVHPFNTRRSWLRPV
1a8iA           ------AIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVIPEALERWPVHLLETLLPRHLQIIYEINQ
3e3nE           ------------------------------------------------------INQRFLNRVAAAFPGD
3cv3A           ------------MKGDMRLPLDDNTVVSHNGVDCYLWRTTVHPFNTRRSWLRPVEDAMFRWYAA------
1b4dA           LVDLERLDWDKAWEVTVKTCAYTNHTVIPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDV
3ddsA           ---------------------------TQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKH
3ddwB           ----------------ERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIEEEGSK-
3e3oD           ------LDWDKAWEVTVKTCAYTNHTVIPEALERWPVHLLETLLPRHLQ--------IIYEINQRFLNRV
3dd1B           ----------------------------------------------------------------------
3cejA           ------------------------------------------------------------DRIVALFPKD
2bgtA           ------------------------------------------------------IAIINMGNNVINFKTV
3e3oC           --TCAYTNHTVIPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKR
3copA           -----------------------------------------------------------RPAKSVFTVHN
2c4mC           -KTFAYTNHTVLTEALEQWDEQIFQQLFWRVWEIIAEIDRRFRLERAADGLDEETINRMAPIQHGTVHMA
2bguA           -----------------------KIAIINMGNNVINFKTVPSSETIYLFKVISEMGLNVDIISLK-NGVY
3ddsB           ----------------------------------------------------------------------
1c3jA           -----------------------KIAIINMGNNVINFKTVPSSETI----------YLFKVISEMGLNVD
2acvA           ----------------------------------------------------------------------
3cehA           ----------------------------------------------------------------------
1c8lA           --------------------------------------------RHLQIIYEINQRFLNRVAAAFPGDVD
1bx3A           -------HPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVIPEALELLETLLPRHLQIIYEINQ
2bfwA           ----------------------------------------------------------------------
2c4mB           LMDEHDMGWEESWAIVSKTFAYTNHTVLTEALEQWDEQIFQQLFWRVWEIIAEIDRRFRLERAADGLDEE
2acvB           ----------------------------------------------------------------------
1ahpA           ----------------------------------------------------------------------
2ecpA           ----------------------------------------------------------------------
3bjxD           ----------------------------------------------------------------------
2c9zA           -----------------RQGMVMAVAETGRPVSCLVADAFIWFAADMAAEMGVAWLPFWTAGP-------
2c1zA           -----------------RQGMVMAVAETGRPVSCLVADAFIWFAADMAAEMG---------VAWLPFWTA
3bjxB           ----------------------------------------------------------------------
3d0rA           --RVLFVSS--PGIGHLFPLIQLAWGFRTAGHDVLIAVAEHAGLEVVDVAPDYSAVKVFEQVAKDNPRFA
2c1xA           ----------------------------------------------------------------------
3d0rB           ----------------------------DRAAAAGLEVVDVAPDYSAVKVFE-QVAKDNPRFAETVATRP
1bc9A           ----------------------------------------------------------------------
1dvgA           ----------------------------------------------------------------------
3d0qA           ----------------------------------------------------------------------
3bppA           ----------ITSYTYDQFD--RYITIAEQDNAEAIRADAMMNIVQRIQQSKIPVIIYVYPPGASAASAG


                         .         .         *         .         .         .         .:140
query           HALCAYLKMIIAALYIVIYHKDTDVILSDSVSASQFVLRHFSKAKLVFYCHFPDRLLTKRDGNLKAFYRN
3c48A           LPTQLAAFTGGMLSFTRREKVTYDLIHSHYWLSGQVGWLLRDLWRIPLIHTAHT--LAAVKNSYDTPESE
3c48B           LPTQLAAFTGGMLSFTRREKVTYDLIHSHYWLSGQVGWLLRDLWRIPLIHTAHTLAAVKT------PESE
3dzcA           QTLNGVTSKILLGMQQVLSSEQPDVVLVHGDTATTFAASLAAYYQQIPVGHVEAGLRTGNI-----YSPW
3c4qB           LPTQLAAFTGGMLSFTRREKVTYDLIHSHYWLSGQVGWLLRDLWRIPLIHTAHTLAAVSDTPESEARR--
3c4qA           EELPTQLAAFTGGMLSFTRREKVTYDLIHSHYWLSGQVGWLLRDLWRIPLIHTAH----TLAAVDTPESE
3beoA           TLIDITTRGL-EGLDKVMKEAKPDIVLVHGDTTTTFIASLAAFYNQIPVGHVEAGLRTWDKYSPYPEE--
3e3lD           VDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRW
2bisA           LRIEDVYGPGWDGLIRKAVTRASVLLLNDLLREEPLLIKKYFKIPAVFTIHRLNKSFYFHEAGLSELAPY
3e3lC           VDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRW
2c4mA           TVHMAWIACYAAYSINGVAALHTEIIKAETLAD--------------WYALWPEKFNNKTNGVTPRRWLR
1e4oA           NEINTRFKTLVEKTWPGDEKVWAKLAVVHDKQVHMAVVGGFANGVAALHSDLVVKDLFPEYHQLWPNKFH
3e3lB           DRL-RRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRW
3cuvA           DRLRR-MSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRW
3e3oA           DRLR-RMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRW
3e3oB           DRLRRM-SLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRW
3e3lA           VDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRW
3e3nC           RRMSLVEEGAVKRINMAHLC----IAGSHAVNGVARIHSEILKKTIFKDFYEPHKFQNKTNGITPRRWLV
3d1jA           SVFTVHNLAYQGMFYAHHMNDIQLPWSFFNIHGLEFNGQISFLKAGLYYADHITAVSPTYAREITEPQFA
1e1yA           RRMSLVEEGAVKRINMAHLC----IAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRW
2atiA           VDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRW
3cuyA           EDAMFRWYAAHPPKQLLDWMRESDVIVFESGIAVAFIELAKRVNPAAKLVY------RASAGLSTINVAS
1a8iA           RFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHLKKTIFKDFYELEPHKFQN
3e3nE           VDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRW
3cv3A           ----------HPPKQLLDWMRESDVIVFESGIAVAFIERVNPAAKLVYRASAGLS---------TINVAS
1b4dA           DRLRRMSL-VEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRW
3ddsA           LDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQ
3ddwB           -----RINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAEL
3e3oD           AAAFPGDVDRLRRMSLVEEGA------VKRINMAHLCIAGSHAVNGVARIHILKKTIFKDFYELEPHKFQ
3dd1B           ---LRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFFSELEPDKFQNKTNGITPRRWLL
3cejA           VDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRW
2bgtA           PSLFKVISEMGLNVDIISLKNGVYTKSFDEVDVNDYLIVVNSKPNLAILSAQKFMAKYKSKIYYLFTDIR
3e3oC           INMAHLCIAGSHAVNGVARIHSE---------------ILKKTIFKDFYELEPHKFQNKTNGITPRRWLV
3copA           LAYQGMFYAHHMNDILPWSFFNIHGLEFNGQISFLKAGLYYADHITAVSPTYAREITEPQFAYGMEGLLQ
2c4mC           WIACYAAYSINGVAALHTEIIKAETLAD-------WYALWPEKFNNKTNGVTPRRWLRMINPGLSDLLTR
2bguA           TKSFDEVDVNDYDRLIVVNSNLA------------ILSAQKFMAKYKSKIYYLFTDIRLPFSQSEEELLI
3ddsB           --------------------------------AKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLL
1c3jA           IISLKNGVTKSFDEVDVNDYDRLIVVNSNLAILSAQKFMAKYKSKIYYLFTDIRLPFSQSAYLYTEEELL
2acvA           -------------------------------------LLNIPGISNQVPSNVLPDACFNKDGGYYKLAER
3cehA           ---------------------------------------VKTKVFKDFSELEPDKFQNKTNGITPRRWLL
1c8lA           RLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLV
1bx3A           RFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHEPHKFQNKTNGITPRRWLV
2bfwA           ----------------------------------------------------------------------
2c4mB           TINRMAPIQHGTVHMAWIACYAAYSINGVAALHTEIIKAETLADWYALWPEKFNNKTNGVTPRRWLRMIN
2acvB           -------------------------------------LLNIPGISNQVPSNVLPDACFNKDGGYYKLAER
1ahpA           ----------------------------------------------------------------------
2ecpA           ----------------------------------------------------------------------
3bjxD           ----------------------------------------------------------------------
2c9zA           -NSLSTHVYIDEIREKIGVSGIQGREDELLNFIPGMSKVRFRDLQEGIVFGNLNSLFSRMLHRMGQVLPK
2c1zA           GPNSLSTHVYIDEIREKIGVSG----------IQGREDELLNFIPGMSKVRFRDLQEGIVFGNLNSLFSR
3bjxB           ----------------------------------------------------------------------
3d0rA           ETVATRPAIDLEEWGVQIAAVNRPLVDGTMALVDDYRPQGATVGLLAADRAGVPAVQRNQSAWRTRGMHR
2c1xA           ----------------------------------------------MSKVRFRDLQEGIVFGNLNSLFSR
3d0rB           AIDLEEWGVQIAAVNRPLVDGTMALV--DDYRPDLVVYEQGATVGLLAADRAGVPAVQRNQSAWRTRGMH
1bc9A           ----------------------------------------------------------------------
1dvgA           ----------------------------------------------------------------------
3d0qA           ----------------------------------------------------------------------
3bppA           TYIALGSHLIAMAPGTSIGACRPILGYSQNGSIIEAPPAITNYFIAYIKSLAQESGRNATIAEEFITKDL


                         +         .         .         .         .         *         .:210
query           IIDWIEEYTTGLADVICVNSNFTKNVVRETFKSLASQELTVLYPSLNTEFFDSIEASDDFGEEIPRGTKY
3c48A           ARRICEQQLVDNADVLAVNTQEEMQDLMHHYDADPDR-ISVVSPGADVELYSPGTERSRRELGIPLHTKV
3c48B           ARRICEQQLVDNADVLAVNTQEEMQDLMHHYD-ADPDRISVVSPGADVELYSPGNDRATERSRRIPLHTK
3dzcA           PEEGNRKLTAALTQYHFAPTDTSRANLLQEN--YNAENIFVTGNTVIDALLAVRTLESQFPMLDASKKLI
3c4qB           ---ICEQQLVDNADVLAVNTQEEMQDLMHHYD-ADPDRISVVSPGADVELYSPGNDRATRRELGIPLHTK
3c4qA           ARRICEQQLVDNADVLAVNTQEEMQDLMHHYDADPDR-ISVVSPGADVELYSPGNDRATERSRRELGITK
3beoA           ---MNRQLTGVMADLHFSPTAKSATNLQKEN--KDESRIFITGNTAIDALKTTVKETYSHPVLEGNNRLV
3e3lD           LVLCNPGLAEIIAERIGEEYISDLDQLRKLLSY---VDDEAFIRDVAKVKQENKLKFAAYLEREYKPNSL
2bisA           PDIDPEHTGGYIADIVTTVSRGYLIDEWGFFRNFEGK-ITYVFNGIDCSFWNESRKKSLLSKFGMDEGVT
3e3lC           LVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHNPNSL
2c4mA           MINPGLSDLLTRLSGSDDWVTDLDELKK--LRSYADDKSVLEELRAIKAANKQDFAEWIQGIEIDPESIF
1e4oA           NVTNGITPRRWIKQCNPALAALLDKSLQKEWANDLDQ-LINLEKFADDAKFLAEFVKVRTGIEINPQAIF
3e3lB           LVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKFAAYLEREYKVHINPNSLF
3cuvA           LVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHNPNSL
3e3oA           LVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNL
3e3oB           LVLCNPGLAEIIAERIGEEYISDLDQLRKLLS-YVDDEAFIRDVAKVKQENKLKFAAYLYKVHINPNSLF
3e3lA           LVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKFAAYLEREYKVHINPNSLF
3e3nC           LCNPGLAEIIAERIGEEYISDLDQLRKLLSYVD--DEAFIRDVAKVKQENKLKFAAYLEREYKVHNPNSL
3d1jA           YGMEGLLQQRHREGRLSGVLNGVD---EKIWSPETDLLLASRYTRDTLEDKAENKRQLQIAMGLKDDKVP
1e1yA           LVLCNPGLAEIIAERIGEEYISDLDQLRKLLSY---VDDEAFIRDVAKVKQENKLKFAAYLEREYNPNSL
2atiA           LLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKIPSSM
3cuyA           YIEREFDRVAPTLDVIALVSPAMAAEVVSRDNV------FHVGHGVDHNLD-------------QLGDPS
1a8iA           KTNGITPRRWLVLCNPGLAEIIAERIGEEYISDL--DQLRKLLSYVDDEAFIRDVAKVKQENKLKNPNSL
3e3nE           LVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHNPNSL
3cv3A           YIEREFDRVAPTLDVIALVSPAMAAEVVSRDN------VFHVGHGVDHNLDQ------------LGDPSP
1b4dA           LVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVD-DEAFIRDVAKVKQENKLKFAAYLYKVHINPNSLF
3ddsA           NKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQ-LTKLHSFLGDDVFLRELAKVKQENKLKNPSSM
3ddwB           IAEKIGEDYVKDLSQLTKLHSFLGDDVFLREL----------AKVKQENKLKFSQFLETEYKVKINPSSM
3e3oD           NKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQ-LRKLLSYVDDEAFIAAYLEREYKVHINPNSLF
3dd1B           LCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVF-LRELAKVKQENKLKFSQFLETEYKVKINPSSM
3cejA           LLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKNPSSM
2bgtA           LPFSQEEELLIKSPIKVISQGINLDIAKAAHKKVDFEYFPIEQYKIHMNDFQLSKPTKK---------TL
3e3oC           LCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLF
3copA           QRHR--------EGRLSGVLNGVDEKIWSPET--DLLLASRYTRDTLEDKAENKRQLQIAMGLKVDDKVP
2c4mC           LSGSDDWVTDLDELKKLRSYADDKSVLE------------ELRAIKAANKQDFAEWILERQGIEIDPESI
2bguA           KSPIKVIS-----QGINLDIAKAAHKKVDNVIEFE--YFPIEQYKIHMNDFQLSKPTKK---------TL
3ddsB           LCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMF
1c3jA           IKSPIKVISQG--------------INLDIAKAAHKKVDNVIEFEYFPIEQYKIHM-NDFQLSKPTKKTL
2acvA           FRDTKGIIVNTFSDLEQSSIDALYDHDEKIPPIYAVG-PLLDLKGQPNPKLDQAQHDLILKWLDEQPDSV
3cehA           LCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPS-SM
1c8lA           LCNPGLAEIIAERIGEEYISDLDQLRKLLSY---VDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINSL
1bx3A           LCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLF
2bfwA           ------------------------------------------------------------------EGVT
2c4mB           PGLSDLLT----RLSGSDDWVTDLDELKKLRSY-ADDKSVLEELRAIKAANKQDFAEWRQGIEIDPESIF
2acvB           FRDTKGIIVNTFSDLEQSSIDALYDHDEKIPPIYAVGPLLDLKGQPNPKLDQAQHDLILKWLDEQPDKSV
1ahpA           ----------------------------------------------------------------------
2ecpA           ----------------------------------------------------------------------
3bjxD           --------------------------------------SSGLVPRGSHTNPAYFPQLSQLDVSGEESTYE
2c9zA           ------------ATAVFINSFEELDDSLTNDL-------KSKLKTYLNIGPFNLITGCLQWLKERKPTSV
2c1zA           MLHRMGQVLPK-ATAVFINSFEELDDSLTNDLK-------SKLKTYLNIGPFNLITGCLQWLKERKPTSV
3bjxB           ----------------------------------------------------------------------
3d0rA           SIASFLTDLMDKHQVSLPEPVATIESFPPSLLLEAEPEGWFMRWVPYGGGAVLGDRLPPVPARPE-----
2c1xA           MLHRMGQVLPK-ATAVFINSFEELDDSLTNDL-------KSKLKTYLNIGPFNLITGCLQWLKERKPTSV
3d0rB           RSIASFLTDLM----DKHQVSLPEPVATIESFPPSLLLEAEPEGWFMRWVPYGGGAVLGDRLPPVPARPE
1bc9A           ----------------------------------------------------------------------
1dvgA           --------------------------------------------------------SQDLSEALKEATKE
3d0qA           ----------------------------------------------------------------------
3bppA           SLTPEEALKYGVIEVVARDINELLKKSNGMKTKIPV----------------------------------


                         .         .         .         +         .         .         .:280
query           VFTSLNRFERKKNIVLALDAFEKLKSNLPADEFSQCHLVIAGGYDLKNPENIEHYDELVEHMKKLELPAD
3c48A           VA-FVGRLQPFKGPQVLIKAVAALFDRDP-----DRNLRVIICGG--------PSDTYRHMAEELGVE-K
3c48B           VVAFVGRLQPFKGPQVLIKAVAALFDRDP-----DRNLRVIIC----------GGPSTYRHMAEELGVEK
3dzcA           LVTGHRRESFGGGFERICQALITTAEQHP-----ECQILYPVHLN---------PNVREPVNKLLKGV-S
3c4qB           VVAFVGRLQPFKGPQVLIKAVAALFDRDP-----DRNLRVIICGG--------PYRHMAEELGVE----K
3c4qA           VVAFVGRLQPFKGPQVLIKAVAALFDRDP-----DRNLRVIICGGPTYRHMAEELG-----------VEK
3beoA           LMTAHRRENLGEPMRNMFRAIKRLVDKHE-----DVQVVYPVH---------MNPVVRETANDILGDY-G
3e3lD           FDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVTVMIGGKAAPGYHMLITAIGDVVNHDPVVGDR-L
2bisA           FMFIGRFDRGQKGVDVLLKAIEILSSKKE-----FQEMRFIIIGKGDPELEGWARSLEEKHG-------N
3e3lC           FDVQVKRIHEYKRQLLNCLHVITLYNRIKNKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDRL
2c4mA           DVQ-IKRLHEYKRQLMNALYVLDLYFRIKEDDIPARTVIFGAKAAPGYVKLINSIADLVNNDPEVSPL-L
1e4oA           DI-QIKRLHEYKRQHLNLLHILALYKEIRENDRVPRVFLFGAKLAKNIIFAINKVADVINNDPLVGDK-L
3e3lB           DV-QVKRIHEYKRQLLNCLHVITLYNRIKKEFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPL
3cuvA           FDVQVKRIHEYKRQLLNCLHVITLYKKEPNKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDRL
3e3oA           FDVQVKRIHEYKRQLLNCLHVITLYNRIKKEFVVPRTVMIGGKAAPGYHMAITAIGDVVNHDPVVGDR-L
3e3oB           DV-QVKRIHEYKRQLLNCLHVITLYNRIKNKFVVPRTVMIGGKMAKMIIKLITAIGDVVNHDPVVGDR-L
3e3lA           DVQ-VKRIHEYKRQLLNCLHVITLYNRIPNKFVVPRTVMIGGKMAKMIIKLITAIGDVVNHDPVVGDR-L
3e3nC           FDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFRTVMIGGKMAKMIIKLITAIGDVVNHDPVVGDR-L
3d1jA           LFAVVSRLTSQKGLDLVLEALPGL-----LEQGGQLALLGAGDPVL--------QEGFLAAAAEYPG---
1e1yA           FDVQVKRIHEYKRQLLNCLHVITLYNKEPNKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDRL
2atiA           FDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNSKL
3cuyA           PYAEGIHAVAVGSMLFDPEFFVVASKAFP-----QVTFHVIGSGMGRHPGY-----------------GD
1a8iA           FDVQVKRIHEYKRQLLNCLHVITLYNREPNKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDRL
3e3nE           FDVQVKRIHEYKRQLLNCLHVITLYNRIKKEFVVPRTVMIGGKMAKMIIKLITAIGDVVNHDPVVGDR-L
3cv3A           YAEGIHAVAVGSMLFD-PEFFVVASKAFP-----QVTFHVIGSGMGRH-----------------PGYGD
1b4dA           DV-QVKRIHEYKRQLLNCLHVITLYNRIKNKFVVPRTVMIGGKMAKMIIKLITAIGDVVNHDPVVGDR-L
3ddsA           FDVQVKRIHEYKRQLLNCLHVITMYNRIPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNSKL
3ddwB           FDVQVKRIHEYKRQLLNCLHVITMYNRIKKDLFVPRTVIIGGKAAPGYHKLITSVADVVNNDPMVGSK-L
3e3oD           DV-QVKRIHEYKRQLLNCLHVITLYNRIKKEFVVPRTVMIGGKAAPGYHKLITAIGDVVNHDPVVGDR-L
3dd1B           FDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLRTVIIGGKAAPGYHKLITSVADVVNNDPMVGSK-L
3cejA           FDVQVKRIHEYKRQLLNCLHVITMYNRIKKKLFVPRTVIIGGKAAPGYHKLITSVADVVNNDPMVGSK-L
2bgtA           DVIYGGSFRSGQRESKMVEFLFDTG----------LNIEFFGNAREK------------QFKNPKYPWTK
3e3oC           DV-QVKRIHEYKRQLLNCLHVITLYNRIKNKFVVPRTVMIGGKMAKMIIKLITAIGDVVNHDPVVGDR-L
3copA           LFAVVSRLTSQKGLDLVLEALPGL-----LEQGGQLALLGAGDPVLQ--------EGFLAAAAEYPGQ--
2c4mC           FDVQIKRLHEYKRQLMNALYVLDLYFRIKEDGLTDRTVIFGAKAAPGYVKLINSIADLVNNDPEVSPL-L
2bguA           DVIYGGSFRSGQRESKMVEFLFDTG----------LNIEFFGNAR-----------EKQFKNPKYPWT-K
3ddsB           DVQV-KRIHEYKRQLLNCLHVITMYNRIKKDLFVPRTVIIGGKAAPGYHKLITSVADVVNNDPMVGSK-L
1c3jA           DVIYGGSFRSGQRESKMVEFLFDTG----------LNIEFFGNAR--------EKQFKNPKYPW----TK
2acvA           VFLCFGSMGVSFGPSQIREIALGLKHSGV-----RFLWSNSAEKK-----------------VFPEGFLE
3cehA           FDVQVKRIHEYKRQLLNCLHVITMYNRIPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNSKL
1c8lA           FDVQVKRIHEYKRQLLNCLHVITLYNRIPNKFVVPRTVMIGGKAAPGYHMMIIKLITAIGDVVNHVGDRL
1bx3A           DV-QVKRIHEYKRQLLNCLHVITLYNKEPNKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDRL
2bfwA           FMFIGRFDRGQKGVDVLLKAIEILSSKKEFQEM---RFIIIGKGDPELEG---------WARSLEEKHGN
2c4mB           DV-QIKRLHEYKRQLMNALYVLDLYFRIKEDGLTDITVIFGAKAAPGYVRAKAIIKLINSIADLVNNDPL
2acvB           VFLCFGSMGVSFGPSQIREIALG-----LKHSGVRFLWSNSAEKKVFPEGFLEWME-----------LEG
1ahpA           FDIQIKRLHEYKRQHLNLLRILALYKENPQADRVPRVFLFGAKAAPGYYLAINKVADVINNDPLVGDK-L
2ecpA           FDIQIKRLHEYKRQHLNLLRILALYKENPQADRVPRVFLFGAKAAPGYYLAINKVADVINNDPLVGDK-L
3bjxD           WVAFGCRVLATFPGYLP--LAWRRSAEAL-----ITRYAEQAADE--------LRERSLLNIGPLPNL-K
2c9zA           VYISFGTVTTPPPAVVALS--EALEAS------RVPFIWSLRDKARV--------HLPEGFLEKTR---G
2c1zA           VYISFGTVTTPPPAVVALS--EALEAS------RVPFIWSLRDKARV-----HLPEGFLEKTR------G
3bjxB           WVAFGCRVLATFPGYL-PLAWRRSAEALI------TRYAEQAA---------DELRERSLLNIGPLPNLK
3d0rA           VAITMGTIELQAFGIGAVEPIIAAAGEVD-----ADFVLALGDLDISPLGTLPRNVRAVGWTPLHTLLRT
2c1xA           VYISFGTVTTPPPAVVALS--EALEAS------RVPFIWSLRDKARV-----HLPEGFLEKTR------G
3d0rB           VAITMGTIELQAFGIGAVEPIIAAAGEVD-----ADFVLALGDLDISPLGTLPRNVRAVGWTPLHTLLRT
1bc9A           ------NMQRNKQVAMGRKKFNMDPKKGI-------QFLIENDLLKNTCEDIAQFLYKGEGLNK-----T
1dvgA           VHIRAENSEFRNKGQVSREGFKLVTAS-LYHIYTALEEEIE---RNKQNPVYAPLYFPEELHRRAALEQD
3d0qA           ----------------------------------------------------------------------
3bppA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           QIVFLHSPSDTQKVNLIRRSRAVLYTPDREHFGIVPVEAMYLGTPVIAVNTGGPCESVRNNETGFLVDQT
3c48A           RIRFLDPRPPSELVAVYRAADIVAVPSFNESFGLVAMEAQASGTPVIAARVGGLPIAVAEGETGLLVDHS
3c48B           RIRFLDPRPPSELVAVYRAADIVAVPSFNESFGLVAMEAQASGTPVIAARVGGLPIAVAEGETGLLVDHS
3dzcA           NIVLIEPQQYLPFVYLMDRAHIIL-----TDSGGIQEEAPSLGKPVLVMRETTERPEAVAAGTVKLVGTN
3c4qB           RIRFLDPRPPSELVAVYRAADIVAVPSFNESFGLVAMEAQASGTPVIAARVGGLPIAVAEGETGLLVDHS
3c4qA           RIRFLDPRPPSELVAVYRAADIVAVPSFNESFGLVAMEAQASGTPVIAARVGGLPIAVAEGETGLLVDHS
3beoA           RIHLIEPLDVIDFHNVAARSYLML-----TDSGGVQEEAPSLGVPVLVLRDTTERPEGIEAGTLKLAGTD
3e3lD           RVIFLENYRVSLAEKVIPAADLSEQISGTEASGTGNMFMLNGALTIGTMDGANVEEAGEENFFIFGMRED
2bisA           VKVITEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIASAVGGLRDIITNETGILVKAGD
3e3lC           RVIFLENYRVSLAEKVIPAADLSEQISGTEASGTGNMFMLNGALTIGTMDGANVEMAEEENFFIFGMRED
2c4mA           KVVFVENYNVSPAEHILPASDVSEQTAGKEASGTSNMKFMMNGALTLGTMDGANVEIVDGEENAYIFARV
1e4oA           KVVFLPDYCVSAAEKLIPAADISEQTAGKEASGTGNMKLALNGALTVGTLDGANVEIAEGEENIFIFGTV
3e3lB           RVIFLENYRVSLAEKVIPAADLSEQTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEAGEENFFIFVED
3cuvA           RVIFLENYRVSLAEKVIPAADLSEQISGTEASGTGNMFMLNGALTIGTMDGANVEEAGEENFFIFGMRED
3e3oA           RVIFLENYRVSLAEKVIPAADLSEQTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEAGEENFFIFVED
3e3oB           RVIFLENYRVSLAEKVIPAADLSEQTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEAGEENFFIFVED
3e3lA           RVIFLENYRVSLAEKVIPAADLSEQISGTEASGTGNMFMLNGALTIGTMDGANVEEAGEENFFIFGMRED
3e3nC           RVIFLENYRVSLAEKVIPAADLSEQISGTEASGTGNMFMLNGALTIGTMDGANVEMAEAGEENFFIFVED
3d1jA           QVGVQIGYHEAFSHRIMGGADVILVPSRFEPCGLTQLYGLKYGTLPLVRRTGGLADTVSDSSLENLADSN
1e1yA           RVIFLENYRVSLAEKVIPAADLSEQTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEGEENFFIFGED
2atiA           KVIFLENYRVSLAEKVIPATDLSEQTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEENLFIFGMRDD
3cuyA           NVIVYGEMKHAQTIGYIKHARFGIAPYASEQVPVYLADSSMKLLQYDFFGLVCPNAVVGPYKSRFGYTGN
1a8iA           RVIFLENYRVSLAEKVIPAADLSEQTAGTEASGTGNMFMLNGALTIGTMDGANVEMAGEENFFIFGMRED
3e3nE           RVIFLENYRVSLAEKVIPAADLSEQTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEAGEENFFIFVED
3cv3A           NVIVYGEMKHAQTIGYIKHARFGIAPYASEQVPVYLADSSMKLLQYDFFGAVCPNAVVGPYKSRFGYTGN
1b4dA           RVIFLENYRVSLAEKVIPAADLSEQTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEGEENFFIFGED
3ddsA           KVIFLENYRVSLAEKVIPATDLSEQTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEENLFIFGMRDD
3ddwB           KVIFLENYRVSLAEKVIPATDLSEQTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEENLFIFGMRDD
3e3oD           RVIFLENYRVSLAEKVIPAADLSEQISTTEASGTGNMFMLNGALTIGTMDGANVEMEEAGEENFFIFVED
3dd1B           KVIFLENYRVSLAEKVIPATDLSEQTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEENLFIFGMRDD
3cejA           KVIFLENYRVSLAEKVIPATDLSEQTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEENLFIFGMRDD
2bgtA           APVFTGKIPMNMVSEKNSQAIAALINYNDNFITLRVWETMASDAVMLIDEEFDTKHRIINDARFYVNN--
3e3oC           RVIFLENYRVSLAEKVIPAADLSEQIAGTEASGTGNMFMLNGALTIGTMDGANVEMAEAGEENFFIFVED
3copA           -VGVQIGYHEAFSHRIMGGADVILVPSRFAPCGLTQLYGLKYGTLPLVRRTGGLADTVSDCSLENLADSN
2c4mC           KVVFVENYNVSPAEHILPASDVSEQTAGKEASGTSNMKFMMNGALTLGTMDGANVEIVDGEENAYIFGRV
2bguA           APVFTGKIPMNMVSEKNSQAIAALINYNDNFITLRVWETMASDAVMLIDEEFDTKHRIINDARF--YVNN
3ddsB           KVIFLENYRVSLAEKVIPATDLSEQTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEENLFIFGMRDD
1c3jA           APVFTGKIPMNMVSEKNSQAIAALINYNDNFITLRVWETMASDAVMLIDEEFDTKHRII-NDARFY-VNN
2acvA           WMELEGKGMICGWAPQVEVLAHKAIGGFVHCGWNSILESMWFGVPILTWPIYAEQQLVKEWGVGLGLRVA
3cehA           KVIFLENYRVSLAEKVIPATDLSEQTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEENLFIFGMRDD
1c8lA           RVIFLENYRVSLAEKVIPAADLSEQTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEGEENFFIFVED
1bx3A           RVIFLENYRVSLAEKVIPAADLSEQTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEGEENFFIFGED
2bfwA           VKVITEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIASAVGGLRDIIT-NETGILVKGD
2c4mB           KVVFVENYNVSPAEHILPASDVSEQISGKEASGTSNMKFMMNGALTLGTMDGANVEIVDGEENAYIFGAV
2acvB           KGMICGWAP-----QVEVLAHKAIGGFVSHCGWNSILESMWFGVPILTWPIYAEQQLVKEWGVGLGLRVA
1ahpA           KVVFLPDYCVSAAEKLIPAADISEQISGKEASGTGNMKLALNGALTVGTLDGANVEIAEGEENIFIFGHT
2ecpA           KVVFLPDYCVSAAEKLIPAADISEQISGKEASGTGNMKLALNGALTVGTLDGANVEIAEGEENIFIFGHT
3bjxD           ERLYAAGFDDGEIEKVRRVLYAFNYGN---PKYLLLITALSESQPVGGAEVSSELRASIPKGHPKGDPLL
2c9zA           YGMVVPWAPQAEVLAHEAVGAFVT-----HCGWNSLWESVAGGVPLICRPFFGDQRLEDVLEIGVRIVFT
2c1zA           YGMVVPWAPQAEVLAHEAVGAFV-----THCGWNSLWESVAGGVPLICRPFFGDQRLEDVLEIGVRIVFT
3bjxB           ERLYAAGFDDGEIEKVRRVLYAFNYGNPKYLLLITALSES--QRPVGGAEVSSELRASIPKGHPKGDPLL
3d0rA           CTAVVHHGG-----------------------GGTVMTAIDAGIPQLLAPDPRDQFQEAVSRRGIGLVTS
2c1xA           YGMVVPWAPQAEVLAHEAVGAFV-----THCGWNSLWESVAGGVPLICRPFFGDQRLEDVLEIGVRIVFT
3d0rB           CTAVVHHGG-----------------------GGTVMTAIDAGIPQLLAPDPRDQFREAVSRRGIGLVTS
1bc9A           AIGDYLGERDEF-----NIQVLHAFVELHEFTDLNLVQALFLWSFRLPGEAQKIDRMMEAQCNNGVFQDT
1dvgA           -LAFWYGPHWQEAIPYTPATQHVKRLHEVGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKALALPSS--
3d0qA           ------------------------------HGGGGTVTAIDAGIPQLLAPDPRDQFQEAVSRRGIGLVTS
3bppA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AEAFAEKMIDLMKDEEMYRRMSEEGPKWVQKVFAFEAFARKLDEIIQSTL
3c48A           PHAWADALATLLDDDETRIRMGEDAVEHART-FSWAATAAQLSSLYNDAI
3c48B           PHAWADALATLLDDDETRIRMGEDAVEHART-FSWAATAAQLSSLYNDAI
3dzcA           QQQICDALSLLLTDPQAYQAMSQAH-----NPYGDGKACQRIADILA---
3c4qB           PHAWADALATLLDDDETRIRMGEDAVEHART-FSWAATAAQLSSLYNDAI
3c4qA           PHAWADALATLLDDDETRIRMGEDAVEHART-FSWAATAAQLSSLYNDAI
3beoA           EETIFSLADELLSDKEAHDKMSKASNPYGDG-RASERIVEAILKHFN---
3e3lD           VDRLDQRGYNAQEYYDRIPELRQIIEQLSSG-FFSPKQPDLFKDIVNMLM
2bisA           PGELANAILKALELSRSDLSKFRENCKKRAMSFSWEKSAERYVKAYTGSI
3e3lC           VDRLDQRGYNAQEYYDRIPELRQIIEQLSSG-FFSPKQPDLFKDIVNMLM
2c4mA           EELPALRESYKPYELYETVPGLKRALDALDNGTLNDNNSGLFYDLKHS--
1e4oA           EQVKAILAKGDPVKWRKKDKVLDAVLKELESGKYSDGDKHAFDQMLHSIG
3e3lB           VDRLDQRGYNAQEYYDRIPELRQIIEQLSSG-FFSPKQPDLFKDIVNMLM
3cuvA           VDRLDQRGYNAQEYYDRIPELRQIIEQLSSG-FFSPKQPDLFKDIVNMLM
3e3oA           VDRLDQRGYNAQEYYDRIPELRQIIEQLSSG-FFSPKQPDLFKDIVNMLM
3e3oB           VDRLDQRGYNAQEYYDRIPELRQIIEQLSSG-FFSPKQPDLFKDIVNMLM
3e3lA           VDRLDQRGYNAQEYYDRIPELRQIIEQLSSG-FFSPKQPDLFKDIVNMLM
3e3nC           VDRLDQRGYNAQEYYDRIPELRQIIEQLSSG-FFSPKQPDLFKDIVNMLM
3d1jA           AWSLLRAIRRAFVLWSRPSLWRFVQRQAMAMDFSWQVAAKSYRELYY---
1e1yA           VDRLDQRGYNAQEYYDRIPELRQIIEQLSSG-FFSPKQPDLFKDIVNM--
2atiA           VAALDKKGYEAKEYYEALPELKLVIDQIDNG-FFSPKQPDLFKDIINMLF
3cuyA           ADSVIAAITQALEAPRVRYRQCLNWSDTTDRVLDPRAYPET---------
1a8iA           VDRLDQRGYNAQEYYDRIPELRQIIEQLSSG-FFSPKQPDLFKDIVNMLM
3e3nE           VDRLDQRGYNAQEYYDRIPELRQIIEQLSSG-FFSPKQPDLFKDIVNMLM
3cv3A           ADSVIAAITQALEAPRVRYRQCLNWSDTTDRVLDPRAYPET---------
1b4dA           VDRLDQRGYNAQEYYDRIPELRQIIEQLSSG-FFSPKQPDLFKDIVNMLM
3ddsA           VAALDKKGYEAKEYYEALPELKLVIDQIDNG-FFSPKQPDLFKDIINMLF
3ddwB           VAALDKKGYEAKEYYEALPELKLVIDQIDNG-FFSPKQPDLFKDIINMLF
3e3oD           VDRLDQRGYNAQEYYDRIPELRQIIEQLSSG-FFSPKQPDLFKDIVNMLM
3dd1B           VAALDKKGYEAKEYYEALPELKLVIDQIDNG-FFSPKQPDLFKDIINMLF
3cejA           VAALDKKGYEAKEYYEALPELKLVIDQIDNG-FFSPKQPDLFKDIINMLF
2bgtA           RAELIDRVNELKHSDVLRKEMLSIQHDILNKTRAKKAEWQDAFKKAID--
3e3oC           VDRLDQRGYNAQEYYDRIPELRQIIEQLSSG-FFSPKQPDLFKDIVNMLM
3copA           AWSLLRAIRRAFVLWSRPSLWRFVQRQAMAMDFSWQVAAKSYRELYYR--
2c4mC           EELPALRESYKPYELYETVPGLKRALDALDNGTLNDNNSGLFYDLKHS--
2bguA           RAELIDRVNELKHSDVLRKEMLSIQHDILNKTRAWQDAFKKAIDL-----
3ddsB           VAALDKKGYEAKEYYEALPELKLVIDQIDNG-FFSPKQPDLFKDIINMLF
1c3jA           RAELIDRVNELKHSDVLRKEMLSIQHDILNKTRAWQDAFKKAIDL-----
2acvA           AEEIEKGLKDLMDKDSIVHKKVQEMKEMSRNAVV-DGGLISVGKLID---
3cehA           VAALDKKGYEAKEYYEALPELKLVIDQIDNG-FFSPKQPDLFKDIINMLF
1c8lA           VDRLDQRGYNAQEYYDRIPELRQIIEQLSSG-FFSPKQPDLFKDIVNMLM
1bx3A           VDRLDQRGYNAQEYYDRIPELRQIIEQLSSG-FFSPKQPDLFKDIVNM--
2bfwA           PGELANAILKALESRSDLSKFRENCKKRAMS-------------------
2c4mB           EELPALRESYKPYELYETVPGLKRALDALDNGTLNDNNSGLFYDLKH---
2acvB           AEEIEKGLKDLMDKDSIVHKKVQEMKEMSNAVVDGGSSLISVGKLID---
1ahpA           VKQVKAILAKGYDPVKWRKKDKVAVLKELESGKYSDGDKHAFDQMLHSIG
2ecpA           VKQVKAILAKGYDPVKWRKKDKVAVLKELESGKYSDGDKHAFDQMLHSIG
3bjxD           PLVDATKASTEVQGLLKRVADLHYHHGPASDFQ-----------------
2c9zA           KSGLMSCFDQILSQEKGKRALRETADRAVGPKGSSTENFITLVDLVSKP-
2c1zA           KSGLMSCFDQILSQEKGKRALRETADRAVGPKGSSTENFITLVDLVSKP-
3bjxB           PLVDATKASTEVQGLLKRVADLHYHHGP----------------------
3d0rA           DKVDADLLRRLIGDESLRTAAREVR-EEMVALPTPAETVRRIVERI----
2c1xA           KSGLMSCFDQILSQEKGKRALRETADRAVGPKGSSTENFITLVDLVS---
3d0rB           DKVDADLLRRLIGDESLRTAAREVR-EEMVALPTPAETVRRIVERI----
1bc9A           CYVLSFAIIMLNHNPNVKDKPTVERFMNRGINDGGDLPEELLRNLYESIK
1dvgA           GEGLASFTFPSIDNPTKFKQLYRARNTLELTPEVKHRVTEEAKTA-----
3d0qA           DKVDADLLRRLIGDESLRTAARE---------------------------
3bppA           --------------------------------------------------