[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cele0:CAA86661.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1dceA.bssp"
#ERROR : Can't open dsspfile "3ciyA.bssp"
#ERROR : Can't open dsspfile "2bm4A.bssp"
#ERROR : Can't open dsspfile "3ciyB.bssp"
#ERROR : Can't open dsspfile "1a9nC.bssp"
#ERROR : Can't open dsspfile "2bm6A.bssp"
#ERROR : Can't open dsspfile "3cigA.bssp"
#ERROR : Can't open dsspfile "3ebbC.bssp"
#ERROR : Can't open dsspfile "3bokA.bssp"
#ERROR : Can't open dsspfile "3cvrA.bssp"
#ERROR : Can't open dsspfile "3d3xA.bssp"

## Summary of PDB Search
:799
    3e-08  20%  1dceA  [a.118.6 - b.7.4 - c.10.2] PROTEIN (RAB
    2e-06  25%  3ciyA  [x.x.x] TOLL-LIKE RECEPTOR 3
    4e-06   9%  2bm4A  [x.x.x] PENTAPEPTIDE REPEAT FAMILY PROTEIN
    1e-05  14%  3ciyB  [x.x.x] TOLL-LIKE RECEPTOR 3
    3e-05  11%  1a9nC  [c.10.2] U2A'
    1e-04  11%  2bm6A  [x.x.x] PENTAPEPTIDE REPEAT FAMILY PROTEIN
    3e-04  13%  3cigA  [x.x.x] TOLL-LIKE RECEPTOR 3
    3e-04  10%  3ebbC  [x.x.x] PHOSPHOLIPASE A2-ACTIVATING PROTEIN
    3e-04   4%  3bokA  [x.x.x] NEUROTOXIN A
    6e-04   8%  3cvrA  [x.x.x] INVASION PLASMID ANTIGEN
    0.001  11%  3d3xA  [x.x.x] TYPE E BOTULINUM TOXIN
:799

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dceA           ----------------------------------------------------------------------
3ciyA           ----------------------------------------------------------------------
2bm4A           ----------------------------------------------------------------------
3ciyB           ----------------------------------------------------------------------
1a9nC           ----------------------------------------------------------------------
2bm6A           ----------------------------------------------------------------------
3cigA           ----------------------------------------------------------------------
3ebbC           ----------------------------------------------------------------------
3bokA           ----------------------------------------------------------------------
3cvrA           ----------------------------------------------------------------------
3d3xA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxQINKIDLMGNKVELQDLELCSNQNLVSFRLGDIDYFPNTNKIQVADVLDTALNRTSRQQLRHLDLS
1dceA           ----------------------------------------------------------------------
3ciyA           ---------------------------------------------------------------LTQLDLS
2bm4A           -----------------WVDCEFTGR------DFRDED--LSRLHTERAMFSECDFSGVNLAESQHRGSA
3ciyB           ----------------------------------------------------------------------
1a9nC           ----------------------------------------------------------------------
2bm6A           -----------------------WVDCEFTGRDFRDED--LSRLHTERAMFSECDFSGVNAESQHRGSAF
3cigA           ----EKLCWELSNTS--IQNLSLANNQLLATSES--TFSGLKWTNLTQLDLSYNNLHDVGNPSLRYLSLE
3ebbC           ----------------------------------------------------------------------
3bokA           ----------------------------------------------------------------------
3cvrA           ---------------------------------------------------------------LGREFRL
3d3xA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GRHRITSNWPTYVARKLPRLESLAFANRSTANETLSQIGASLLNLRFLDISSTCVTDISCISSLRNLEVL
1dceA           ---------------------------------------AALRCLEVLQASDNALENVDGVANLPRLQEL
3ciyA           YNNLHDVGNGSF--SYLPSLRYLSLEYNNIQRLSPRSFY-GLSNLRYLSLKRAFTKSHFSFQWLKYLEYL
2bm4A           FRNCTFERTTLW----HSTFAQCSMLGSVFVACRLRPLTLDDVDFTLAVLGGNDLRGLNLRLRETSLVDT
3ciyB           -----------------------------------------ILDFQHNNLARLWNPGGNFLKGLSHLHIL
1a9nC           -----------------------------------------------VKLTAELIEQAAQYTNAVRDREL
2bm6A           RNCTFERTTLWHSTFAQCSMLGSVFVACRLRPLTLDDVDFTLAVLGGNDLRGLNLTG--CRLRETSLVDT
3cigA           YNNI--QRLSPRSFYGLSNLRYLSLKRAFT-KQSVSLASHPNIDDFSFQWLKYLEYLNMDDNNIPSTKSN
3ebbC           ----------------------------------------------------------------------
3bokA           ----------------------------------------LTEIYTEDNFVKFFKVLNTYLNFDKAVFKI
3cvrA           EILEDIARDKVRTLHFVDEIEVYLAFQTLAEKLQLSTAVYGVSGVTANDLRTAEAVRSREENEFTDWFSL
3d3xA           -----------------------------------------YKYFKLSNLLNDSIYNISEGYNINNLKVN


                         .         .         .         +         .         .         .:280
query           IMYNLNILKGDVTETLSNLTKLRVLDISRKVNTDYLQETSQDAHLDLALGIYNRSVEAIESGTATPWAEL
1dceA           LLCNNRLQQSAAIQPLVSCPRLVLLNLQ------------------------------------------
3ciyA           NMDD-NNIPSTKSNTFTGLVSLKYLSLS------------------------------------------
2bm4A           DLRKCVLRGADLSGARTTGARLDDADLR------------------------------------------
3ciyB           NLES-NGLDEIPVGVFKNLFELKSINLGLNNLNKLEPFIDDQTSLRSLNLQKNLITSVEKDVFGPPFQNL
1a9nC           DLRGYKI--PVIENLGATLDQFDAIDFSDNEIRK--LDGFPLLRRLKTLLVNNNRICRIGEGLDQALPDL
2bm6A           DLRKCVLRGADLSGARTTGARLDDADLR------------------------------------------
3cigA           TFTGLVSLK-YLSLSKTFTSLQTLTNETFVSLAHSP----------------------------------
3ebbC           ----------------------------------------------------------------------
3bokA           NIVP-KVNYTIYDGFNLRNTNLAANFNG------------------------------------------
3cvrA           WGPWHAVLKRTEADRWALAEEQKYRETE------------------------------------------
3d3xA           ---FRGQNANLNPRIITPITGRGLVKKIIR----------------------------------------


                         .         *         .         .         .         .         +:350
query           RAIDMSGLSIVQFGTDRALAFVEKIIEAHPKLEQISLLATPLDSSLIEIPNRNLQVINxxxxxxxxxxxx
1dceA           ----------------------------------------------------------------------
3ciyA           ----------------------------------------------------------------------
2bm4A           ----------------------------------------------------------------------
3ciyB           NSLDMRFNPF-DCTCESISWFVNWINQTHTNISELS--THYLCNTPHHYYGFPLKLFD------------
1a9nC           TELILTNNSLVELGDLDPLASLKSLTYLCILRNPVTNKKHYRLYVIYKVPQ-------------------
2bm6A           ----------------------------------------------------------------------
3cigA           ----------------------------------------------------------------------
3ebbC           ----------------------------------------------------------------------
3bokA           ----------------------------------------------------------------------
3cvrA           ----------------------------------------------------------------------
3d3xA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKECLRLVCISMQQGLNTLPVQIAGSACLYHLCKMKR
1dceA           ----------------------------------------------------------------------
3ciyA           ----------------------------------------------------------------------
2bm4A           ----------------------------------------------------------------------
3ciyB           ----------------------------------------------------------------------
1a9nC           ----------------------------------------------------------------------
2bm6A           ----------------------------------------------------------------------
3cigA           ----------------------------------------------------------------------
3ebbC           ----------------------------------TQILGKLKELNGTAPEEKKLTEDDLILLEKILSLIC
3bokA           ----------------------------------------------------------------------
3cvrA           ----------------------------------------------------------------------
3d3xA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           IKRLSVKEVNNCIERSLDAAEQYRSMTQLQKNVWLTICNDYLLHLDEIDFYRTCKVALDTMLLNRDASVE
1dceA           ----------------------------------------------------------------------
3ciyA           ----------------------------------------------------------------------
2bm4A           ----------------------------------------------------------------------
3ciyB           ----------------------------------------------------------------------
1a9nC           ----------------------------------------------------------------------
2bm6A           ----------------------------------------------------------------------
3cigA           ----------------------------------------------------------------------
3ebbC           NSSSEKPTVQLWKAINCPEDIVFPALDILRLSIKHPSVNENFCNKEGAQF-----SSHLINLLNPKGKPA
3bokA           ----------------------------------------------------------------------
3cvrA           ----------------------------------------------------------------------
3d3xA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           RMTIAIVSIVTPKMRPSEAKILTTETKYVYHLVKIMNDYLEAYTREHRVGHERDNENALYTLKFTLSALW
1dceA           ----------------------------------------------------------------------
3ciyA           ----------------------------------------------------------------------
2bm4A           ----------------------------------------------------------------------
3ciyB           ----------------------------------------------------------------------
1a9nC           ----------------------------------------------------------------------
2bm6A           ----------------------------------------------------------------------
3cigA           ----------------------------------------------------------------------
3ebbC           NQLLALRTFCNCFVGQAGQKL-------------SQRESLSHAIELKSGSNKNIHIALA-------TLAL
3bokA           ----------------------------------------------------------------------
3cvrA           ----------------------------------------------------------------------
3d3xA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           NLTDECPATCKAFLDAGGVQIAFRILKAFDYHGNVQTKVLGILNNLAEVEELHLGQLCKNEYISVLISCL
1dceA           ----------------------------------------------------------------------
3ciyA           ----------------------------------------------------------------------
2bm4A           ----------------------------------------------------------------------
3ciyB           ----------------------------------------------------------------------
1a9nC           ----------------------------------------------------------------------
2bm6A           ----------------------------------------------------------------------
3cigA           ----------------------------------------------------------------------
3ebbC           NYSVCFHKDHNIEGKAQCLSLISTILE-VVQDLEATFRLLVALGTLISDDSNAVQLAKSLGVDSQIKKYS
3bokA           ----------------------------------------------------------------------
3cvrA           ----------------------------------------------------------------------
3d3xA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           DGSFNEVDSKGRYREVERSYFAAGILANLLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dceA           ----------------------------------------------------------------------
3ciyA           ----------------------------------------------------------------------
2bm4A           ----------------------------------------------------------------------
3ciyB           ----------------------------------------------------------------------
1a9nC           ----------------------------------------------------------------------
2bm6A           ----------------------------------------------------------------------
3cigA           ----------------------------------------------------------------------
3ebbC           SVSEPAK-----------VSECCRFILNLL----------------------------------------
3bokA           ----------------------------------------------------------------------
3cvrA           ----------------------------------------------------------------------
3d3xA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dceA           ----------------------------------------------------------------------
3ciyA           ----------------------------------------------------------------------
2bm4A           ----------------------------------------------------------------------
3ciyB           ----------------------------------------------------------------------
1a9nC           ----------------------------------------------------------------------
2bm6A           ----------------------------------------------------------------------
3cigA           ----------------------------------------------------------------------
3ebbC           ----------------------------------------------------------------------
3bokA           ----------------------------------------------------------------------
3cvrA           ----------------------------------------------------------------------
3d3xA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dceA           -----------------------------
3ciyA           -----------------------------
2bm4A           -----------------------------
3ciyB           -----------------------------
1a9nC           -----------------------------
2bm6A           -----------------------------
3cigA           -----------------------------
3ebbC           -----------------------------
3bokA           -----------------------------
3cvrA           -----------------------------
3d3xA           -----------------------------