[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cele0:CAA93431.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2c47A.bssp"
#ERROR : Can't open dsspfile "3ei1A.bssp"
#ERROR : Can't open dsspfile "3dbsA.bssp"
#ERROR : Can't open dsspfile "2c47C.bssp"
#ERROR : Can't open dsspfile "3dk6A.bssp"
#ERROR : Can't open dsspfile "2e2bA.bssp"
#ERROR : Can't open dsspfile "2cgxA.bssp"
#ERROR : Can't open dsspfile "3e87A.bssp"
#ERROR : Can't open dsspfile "2ckpB.bssp"
#ERROR : Can't open dsspfile "3dxnA.bssp"
#ERROR : Can't open dsspfile "3bceA.bssp"
#ERROR : Can't open dsspfile "3dkfA.bssp"
#ERROR : Can't open dsspfile "2bmcF.bssp"
#ERROR : Can't open dsspfile "1apmE.bssp"
#ERROR : Can't open dsspfile "3c9wA.bssp"
#ERROR : Can't open dsspfile "3comB.bssp"
#ERROR : Can't open dsspfile "1cdkA.bssp"
#ERROR : Can't open dsspfile "2c3jA.bssp"
#ERROR : Can't open dsspfile "2e2bB.bssp"
#ERROR : Can't open dsspfile "3da6A.bssp"
#ERROR : Can't open dsspfile "3e93A.bssp"
#ERROR : Can't open dsspfile "3ckwA.bssp"
#ERROR : Can't open dsspfile "2advA.bssp"
#ERROR : Can't open dsspfile "2bmcA.bssp"
#ERROR : Can't open dsspfile "2eb3A.bssp"
#ERROR : Can't open dsspfile "3bhhB.bssp"
#ERROR : Can't open dsspfile "3cg2A.bssp"
#ERROR : Can't open dsspfile "3cqwA.bssp"
#ERROR : Can't open dsspfile "3c5iA.bssp"
#ERROR : Can't open dsspfile "2b5mA.bssp"
#ERROR : Can't open dsspfile "2bkkA.bssp"
#ERROR : Can't open dsspfile "3dndA.bssp"
#ERROR : Can't open dsspfile "3byvA.bssp"
#ERROR : Can't open dsspfile "3csfA.bssp"
#ERROR : Can't open dsspfile "1cmkE.bssp"
#ERROR : Can't open dsspfile "3dkgA.bssp"
#ERROR : Can't open dsspfile "2bfxB.bssp"
#ERROR : Can't open dsspfile "2brmA.bssp"
#ERROR : Can't open dsspfile "3e8cE.bssp"
#ERROR : Can't open dsspfile "3dy7A.bssp"
#ERROR : Can't open dsspfile "3dgkA.bssp"
#ERROR : Can't open dsspfile "3cquA.bssp"
#ERROR : Can't open dsspfile "2bmcB.bssp"
#ERROR : Can't open dsspfile "3e59C.bssp"
#ERROR : Can't open dsspfile "2bvaA.bssp"
#ERROR : Can't open dsspfile "1e90A.bssp"
#ERROR : Can't open dsspfile "3cqzH.bssp"
#ERROR : Can't open dsspfile "2ac5A.bssp"
#ERROR : Can't open dsspfile "2amuA.bssp"
#ERROR : Can't open dsspfile "3dfcB.bssp"
#ERROR : Can't open dsspfile "3dajA.bssp"
#ERROR : Can't open dsspfile "3c5yB.bssp"
#ERROR : Can't open dsspfile "3blrA.bssp"
#ERROR : Can't open dsspfile "3dk6B.bssp"
#ERROR : Can't open dsspfile "3c5yE.bssp"
#ERROR : Can't open dsspfile "3bhhC.bssp"
#ERROR : Can't open dsspfile "3e3pA.bssp"
#ERROR : Can't open dsspfile "3e5aA.bssp"
#ERROR : Can't open dsspfile "2dwbA.bssp"
#ERROR : Can't open dsspfile "2chwA.bssp"
#ERROR : Can't open dsspfile "3dfaA.bssp"
#ERROR : Can't open dsspfile "1e7vA.bssp"
#ERROR : Can't open dsspfile "3c5yA.bssp"
#ERROR : Can't open dsspfile "3cq9B.bssp"
#ERROR : Can't open dsspfile "3daeA.bssp"
#ERROR : Can't open dsspfile "3dlsE.bssp"
#ERROR : Can't open dsspfile "3c4yB.bssp"
#ERROR : Can't open dsspfile "3c5yL.bssp"
#ERROR : Can't open dsspfile "1csnA.bssp"
#ERROR : Can't open dsspfile "2bkkC.bssp"
#ERROR : Can't open dsspfile "3dlsC.bssp"
#ERROR : Can't open dsspfile "3csvA.bssp"
#ERROR : Can't open dsspfile "3bhhD.bssp"
#ERROR : Can't open dsspfile "3daeB.bssp"
#ERROR : Can't open dsspfile "2a1sB.bssp"
#ERROR : Can't open dsspfile "3cs9D.bssp"
#ERROR : Can't open dsspfile "3dplC.bssp"
#ERROR : Can't open dsspfile "3dlsB.bssp"
#ERROR : Can't open dsspfile "3dlsD.bssp"
#ERROR : Can't open dsspfile "1bygA.bssp"
#ERROR : Can't open dsspfile "3dk7B.bssp"
#ERROR : Can't open dsspfile "1e7uA.bssp"
#ERROR : Can't open dsspfile "2c3iB.bssp"
#ERROR : Can't open dsspfile "3cq9D.bssp"
#ERROR : Can't open dsspfile "2bvaB.bssp"
#ERROR : Can't open dsspfile "3dlsA.bssp"
#ERROR : Can't open dsspfile "2cunA.bssp"
#ERROR : Can't open dsspfile "2chxA.bssp"
#ERROR : Can't open dsspfile "2bajA.bssp"
#ERROR : Can't open dsspfile "2ckeA.bssp"
#ERROR : Can't open dsspfile "3dneA.bssp"
#ERROR : Can't open dsspfile "2bakA.bssp"
#ERROR : Can't open dsspfile "3ck8A.bssp"
#ERROR : Can't open dsspfile "3bboU.bssp"
#ERROR : Can't open dsspfile "3bdeA.bssp"

## Summary of PDB Search
:305
    6e-19  25%  2c47A  [x.x.x] CASEIN KINASE 1 GAMMA 2 ISOFORM
    6e-18  10%  3ei1A  [x.x.x] DNA DAMAGE-BINDING PROTEIN 1
    9e-17   9%  3dbsA  [x.x.x] PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE
    1e-14  15%  2c47C  [x.x.x] CASEIN KINASE 1 GAMMA 2 ISOFORM
    1e-14  22%  3dk6A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-13  21%  2e2bA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-12  22%  2cgxA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    4e-12  24%  3e87A  [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
    5e-12  12%  2ckpB  [x.x.x] CHOLINE KINASE ALPHA
    6e-12  16%  3dxnA  [x.x.x] CALMODULIN-LIKE DOMAIN PROTEIN KINASE ISOFORM 3
    2e-11  19%  3bceA  [x.x.x] RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4
    6e-11  18%  3dkfA  [x.x.x] MET PROTO-ONCOGENE
    1e-10  19%  2bmcF  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    3e-10  18%  1apmE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    5e-10  18%  3c9wA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    7e-10  18%  3comB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 4
    8e-10  23%  1cdkA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    1e-09  21%  2c3jA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    2e-09  15%  2e2bB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-09  12%  3da6A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    2e-09  18%  3e93A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-09  17%  3ckwA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 24
    3e-09   9%  2advA  [x.x.x] GLUTARYL 7- AMINOCEPHALOSPORANIC ACID ACYLASE
    4e-09  21%  2bmcA  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    4e-09  14%  2eb3A  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    6e-09  20%  3bhhB  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    7e-09  13%  3cg2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    7e-09  19%  3cqwA  [x.x.x] RAC-ALPHA SERINE/THREONINE-PROTEIN KINASE
    1e-08  10%  3c5iA  [x.x.x] CHOLINE KINASE
    1e-08   6%  2b5mA  [x.x.x] DAMAGE-SPECIFIC DNA BINDING PROTEIN 1
    2e-08   9%  2bkkA  [x.x.x] AMINOGLYCOSIDE 3'-PHOSPHOTRANSFERASE
    4e-08  21%  3dndA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    5e-08  11%  3byvA  [x.x.x] RHOPTRY KINASE
    5e-08   7%  3csfA  [x.x.x] PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE
    6e-08  20%  1cmkE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    7e-08  12%  3dkgA  [x.x.x] MET PROTO-ONCOGENE
    1e-07  18%  2bfxB  [x.x.x] LOC398457 PROTEIN
    2e-07  12%  2brmA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-07  20%  3e8cE  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    6e-07  17%  3dy7A  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE
    6e-07  13%  3dgkA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 1
    7e-07  20%  3cquA  [x.x.x] RAC-ALPHA SERINE/THREONINE-PROTEIN KINASE
    7e-07  18%  2bmcB  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    7e-07   5%  3e59C  [x.x.x] PYOVERDINE BIOSYNTHESIS PROTEIN PVCA
    7e-07  16%  2bvaA  [x.x.x] P21-ACTIVATED KINASE 4
    8e-07  11%  1e90A  [d.15.1 - b.7.1 - a.118.1 - d.144.1] PHOSPHATIDYLINOSITOL
    1e-06  11%  3cqzH  [x.x.x] DNA-DIRECTED RNA POLYMERASES I, II, AND III
    2e-06  19%  2ac5A  [x.x.x] MAP KINASE-INTERACTING SERINE/THREONINE KINASE 2
    2e-06  11%  2amuA  [x.x.x] PUTATIVE SUPEROXIDE REDUCTASE
    2e-06  13%  3dfcB  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 1
    2e-06  14%  3dajA  [x.x.x] SERINE/THREONINE KINASE 6
    2e-06   7%  3c5yB  [x.x.x] RIBOSE/GALACTOSE ISOMERASE
    2e-06  17%  3blrA  [x.x.x] CELL DIVISION PROTEIN KINASE 9
    4e-06  20%  3dk6B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    5e-06   9%  3c5yE  [x.x.x] RIBOSE/GALACTOSE ISOMERASE
    5e-06  22%  3bhhC  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    6e-06  16%  3e3pA  [x.x.x] PROTEIN KINASE, PUTATIVE GLYCOGEN SYNTHASE
    6e-06  21%  3e5aA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    1e-05  19%  2dwbA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    1e-05   9%  2chwA  [x.x.x] PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE
    1e-05  24%  3dfaA  [x.x.x] CALCIUM-DEPENDENT PROTEIN KINASE CGD3_920
    1e-05  11%  1e7vA  [d.15.1 - b.7.1 - a.118.1 - d.144.1] PHOSPHATIDYLINOSITOL
    2e-05   7%  3c5yA  [x.x.x] RIBOSE/GALACTOSE ISOMERASE
    2e-05   9%  3cq9B  [x.x.x] UNCHARACTERIZED PROTEIN LP_1622
    2e-05  22%  3daeA  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    6e-05  32%  3dlsE  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    7e-05  19%  3c4yB  [x.x.x] RHODOPSIN KINASE
    7e-05   6%  3c5yL  [x.x.x] RIBOSE/GALACTOSE ISOMERASE
    7e-05  15%  1csnA  [d.144.1 (1eh4A)] CASEIN KINASE-1
    9e-05  10%  2bkkC  [x.x.x] AMINOGLYCOSIDE 3'-PHOSPHOTRANSFERASE
    1e-04  39%  3dlsC  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    1e-04   8%  3csvA  [x.x.x] AMINOGLYCOSIDE PHOSPHOTRANSFERASE
    1e-04  21%  3bhhD  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    1e-04  22%  3daeB  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    1e-04  10%  2a1sB  [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN
    2e-04  18%  3cs9D  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-04   9%  3dplC  [x.x.x] CULLIN-5
    2e-04  39%  3dlsB  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    2e-04  46%  3dlsD  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    2e-04  20%  1bygA  [d.144.1] PROTEIN (C-TERMINAL SRC KINASE)
    2e-04  18%  3dk7B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    3e-04  10%  1e7uA  [d.15.1 - b.7.1 - a.118.1 - d.144.1] PHOSPHATIDYLINOSITOL
    3e-04  24%  2c3iB  [x.x.x] PROTO-ONCOGENE SERINE THREONINE PROTEIN KINASE
    3e-04  10%  3cq9D  [x.x.x] UNCHARACTERIZED PROTEIN LP_1622
    3e-04  12%  2bvaB  [x.x.x] P21-ACTIVATED KINASE 4
    3e-04  46%  3dlsA  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    4e-04   7%  2cunA  [x.x.x] PHOSPHOGLYCERATE KINASE
    5e-04   8%  2chxA  [x.x.x] PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE
    5e-04  18%  2bajA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    6e-04  13%  2ckeA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    7e-04  18%  3dneA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    7e-04  13%  2bakA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    7e-04  12%  3ck8A  [x.x.x] SUSD
    7e-04  13%  3bboU  [x.x.x] RIBOSOMAL PROTEIN L22
    8e-04   9%  3bdeA  [x.x.x] MLL5499 PROTEIN
:305

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxGSECGKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEV
2c47A           ------------------------FRVGKKIELRLGKNLYT-NEYVAIKLEPIKSRAPQLHLEYRFYKQL
3ei1A           -----------------KPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRP--VKEVGMYGKI
3dbsA           ------------------LEFKCADPTALSNETIGIIFKDLRQDMLILQILRIMESIWETESLDLCLLPY
2c47C           -------------------------RVGKKIELRLGKNLYT-NEYVAIKLEPIKSRAPQLHLEYRFYKQL
3dk6A           -----------------RTDITMKHKLGQFGEVYEG-VWKKYSLTVAVKTLEVEE----FLKEAAVMKEI
2e2bA           ----------------TDITMKHKLGGGQYGEVYEGVWKKYSLT-VAVKTLMEVEEF---LKEAAVMKEI
2cgxA           ----------------EDWDLVQTLGEGAYGEVQLAVNRVTEEA-VAVKIVDMKRCPENIKKEICINKML
3e87A           ----------------NDFDYLKLLGKGTFGKVILVREKATGRY-YAMKILRKEV--IIAKDEVAHTVTE
2ckpB           -------------------LWCKEFLPGAWRGLREDEFHISVIRNMLFQCSLPKVLLRLMVLESVMFAIL
3dxnA           --------------------YQRVKKLGSYGEVLLC--KDKTGAERAIKIIKKSSVTTTSNSGALLDEVA
3bceA           ------------------LKRVKVLGSGAFGTVYKGIWVPE-GETVKIPV-AIKILNETPKANVEFMDEA
3dkfA           ------------------VHFNEVIGRGHFGCVYHGTLKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDF
2bmcF           -----------------DFEIGRPLGKGKFGNVYLAREK-QSKFILALKVLFKAQLEK--AGVEHQLRRE
1apmE           ------------------FDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKV---VKLKQIEHTLNE
3c9wA           ---------------GPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTY--CQRTLREIKI
3comB           -----------------QPEEVFDVLEKLGGSVYKAIHK-ETGQIVAIKQVPVESDLQEIIKEISIMQQC
1cdkA           -----------------QFERIKTLGTGSFGRVMLV-KHKETGNHFAMKILDKQKVVKL-KQIEHTLNEK
2c3jA           ---------------------WDLVQTLGEGEVQLAVNRVT-EEAVAVKIVDMKRE--NIKKEICINKML
2e2bB           ----------------NYDKWEMERTDITMKHKLGGGQYGE--VYEGVWKKYSLTVAVKTLEVEEFLKEA
3da6A           ----------------KRYQNLKPIGSGGIVCAAYDAVL-DRNVAIKKLSRPFQNQTHAKRAYRELVLMK
3e93A           -----------------RYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLL
3ckwA           ----------------------LFTKLEKIGEVFKGIDN-RTQKVVAIKI-IDLEEIEDIQQEITVLSQC
2advA           --------------------------------------------------------------QAPIAAYK
2bmcA           -----------------DFEIGRPLGKGKFGNVYLAREKQS-KFILALKV-LFKAQLEKAGVEHQLRREV
2eb3A           -----------------TEFKKIKVLGSAFGTVYKGLWIP-EGEKVKIPVAIKELREATSPKANKEILDE
3bhhB           ----------------DEYQLYEDIGKSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARICRLL
3cg2A           -----------------WEVPERYQNLSPVGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLL
3cqwA           ----------------NEFEYLKLLGKGTFGKVILV-KEKATGRYYAMKILKKEVIVAKDEVAHTLTENR
3c5iA           ----------------------------------------------------------------------
2b5mA           ---------------------------HFTSAEDLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELF
2bkkA           ----------------EKYRSVKDTEGMSPAKVYKLVGENENLY-LKMTDSRYKGTTYDVEREKDMMLWL
3dndA           -----------------QFERIKTLGTGSFGRVML-VKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKR
3byvA           -----------------TLVRGTVLGQEDPYAYLEATDETGESFEVHVPYFTEPPSNAIKQMKEEVLRLR
3csfA           -----------------KCADPTALSNETIGIIFKHGDD-LRQDMLILQILRIMESIWETESLDLCLLPY
1cmkE           -----------------QFERIKTLGTGSFGRVMLVKHKETGNH-FAMKILDKQK-VVKLKQIEHTLNEK
3dkgA           ---------------------SLIVHFNEVICVYHGTLLDKKIHCAVKSLNRITDI----GEVSQFLTEG
2bfxB           -----------------TIDDFDIGRPLGKGNVYLAREKQNKF-IMALKVLFKSQLEKEGVEHQLRREIE
2brmA           -----------------DWDLVQTLGEGAYGEVQLAVNR-VTEEAVAVKIVDMCP--ENIKKEICINKML
3e8cE           ----------------DQFERIKTLGTGSFGRVMLV-KHMETGNHYAMKILDKQKVVKLKQIEHTLNEKR
3dy7A           ------------------FEKISELGAGNGGVVFKVSHKPSGLVRKLIHLEIKPAIRNQIIRELQVLHEC
3dgkA           -----------------YYDTGEELGSGKFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSREDIERE
3cquA           ----------------NEFEYLKLLGKGTFGKVILVKEK-ATGRYYAMKILKKEVIVAKDEVAHTLTENR
2bmcB           ------------------FEIGRPLGKGKFGNVYLAREK-QSKFILALKVLFKAQ-LEKAGVEHQLRREV
3e59C           ----------------------------------------------------------------------
2bvaA           ----------------PGDPRSYLDNFIKIGIVCIATVRSSGKLVAVKK-----------MDLLFNEVVI
1e90A           -----------------WLEFKCADPTALSNETIGIIFKHGDDLMLILQIIWETESLDLCLLPYGCISTG
3cqzH           ----------------------------------------------------------------------
2ac5A           ----------------VYQLQEDVLGEGAHARVQTCINLITSQEYAVKIIEKQPGHIRSRVFR-----EV
2amuA           --------------------LSDFIKTEDFKKEKHVPVIEAPEK---------VKKDEKVQIVVTVGKEI
3dfcB           -----------------YYDTGEELGSGKFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSREDIERE
3dajA           ----------------EDFDIGRPLGKGKFGNVYLARERQSKFILALKVLFKTQLEKAGVEHQLR---RE
3c5yB           ----------------------------------------------------------------------
3blrA           -----------------KYEKLAKIGQGTFGEVFKARHRKTGQK-VALKKVLMENE--KEGFPITALREI
3dk6B           -----------------KWEMERTDITMKHKEVYEGVWKKYSLT-----VAVKTLEVEEFLKEAAVMKEI
3c5yE           ----------------------------------------------------------------------
3bhhC           ----------------------DEYQLYEDIVVRRCVKL-CTGHEYAAKIKLSARDHQKLEREARICRLL
3e3pA           -----------------DERSRKEMDRFQVE-VQLGKEKSTGMS-VAIKKDPRFRNRELQIMQDLAVLHH
3e5aA           ----------------EDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQ--LEKAGVEHQLRREV
2dwbA           -----------------DFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQL--EKAGVEHQLRREV
2chwA           -----------------WLEFKCADPTALSNETIGIIFKHGDDLMLILQILRIMESIWETESLDLCLLPY
3dfaA           ----------------ERYNIVCMLGKGSFGEVLKCKDR-ITQQEYAVKVINKASAKN--KDTSTILREV
1e7vA           -----------------WLEFKCADPTALSNETIGIIFKHGDDLMLILQIIWETESLDLCLLPYGCISTG
3c5yA           ----------------------------------------------------------------------
3cq9B           ---------------IDAAELQTVKDALVGAIVVKPDQDHTDTQ-LAIKSIFEQLQPDEVHLYGATGGRL
3daeA           ------------GAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAQGRIEREISYLRLL
3dlsE           -----------------KYSTMSPLGSGAFGFVWTAVDKEKNKVKFIKKEKVWIEDPKLVTLEIAILSRV
3c4yB           ---------------WLEAQPMGEDWFLDFRVVFACQMK-ATGKLYACK-KLNKKRLKKRKGYQGAMVEK
3c5yL           ----------------------------------------------------------------------
1csnA           -----------------HYKVGRRIGEGSFGVIFEGTNLLNNQQVAIKFEPRRSDAPQLRDEYRTYKLLA
2bkkC           ----------------EKYRSVKDTEGMSPAKVYKLVGENENLYLKMTDSRYKGTTYDVEREKDMMLLYA
3dlsC           ----------------QKYSTMSPLGSGAFGFVWTAVDKEKNKVKFIKKEKVEDPKLGKVTLEIAIL---
3csvA           -------------DEIRDFLATHGYADWNRTPRYQRLRSPTGA-KAVLDW--------------------
3bhhD           ----------------------DEYQLYEDIVVRRCVKL-CTGHEYAAKIKLSARDHQKLEREARICRLL
3daeB           ----------------GNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAQGRIEREISYLRLL
2a1sB           ---------------HSMDFLLFQFGLCTFKYDYTDSKYITKSFNF-----------YVFPKPFNRSSPD
3cs9D           -------------------ERTDITMKHKLGGGQYGEVYEGVWT-VAVKTLKEDT-----MEVEEFLKEA
3dplC           ---------------KDFTEGTLFSVNQEFSLIKNAKVQKRGKI-NLIGR-----------------LQL
3dlsB           ----------------QKYSTMSPLGSGAFGFVWTAVDKEKNKVKFIKKEWIEDPKLGKVTLEIAIL---
3dlsD           -----------------KYSTMSPLGSGAFGFVWTAVDKEKNK---------------------------
1bygA           -----------------ELKLLQTIGKGEFGDVMLGDYRGNKVA-VKCIKNDAQA----FLAEASVM---
3dk7B           -----------------DITMKHKLGGGQYGEVY-----EGVWKKYSLTVVKTLMEVEEFLKEAAVMKEI
1e7uA           -----------------WLEFKCADPTALSNETIGIIFKHGDDLMLILQIRIMESIWETESLDLCLLPYG
2c3iB           -----------------QYQVGPLLGSGGFGSVYSGIRVSDNLPVA------------------------
3cq9D           ------------------------VKDALVGAIVVKPDQDHTDTQLAIKSIFEQLQPDEVHLYGATGGRL
2bvaB           ------------------RSYLDNFIKIGEGIVCIATVRSSGKL-VAVKKMDL-----LLFNEVVIMRDY
3dlsA           -----------------KYSTMSPLGSGAFGFVWTAVDKEKNK---------------------------
2cunA           -------------------------------------------------------------MEKEIEALM
2chxA           -----------------WLEFKCADPTALSNETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCL
2bajA           -----------------RYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKK----------LSRPFQSIIHA
2ckeA           -----------------FYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVSREEIERE
3dneA           ----------------DQFERIKTLGTGSFGRVMLVKHMETGNHY---AMKILDKQKVVKLKQIEHTLNE
2bakA           -----------------RYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKL---SRPFQSIIHAKRTYREL
3ck8A           -----------------------SPSSQRTEWVYVRLGYDITQYNFFLDQGMTDAETLRQRAEIRFLRAL
3bboU           ----------------------------------------------------------------------
3bdeA           -----------------ASHSLEEKRFLVDAKKILSAIRGVTHFEQLRQISPKIDYHFGFADQAAYTRYN


                         .         .         *         .         .         .         .:140
query           KKQKIVGRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLHNIG
2c47A           SATEGVPQVY------YFGPGKYNAMVLELLGPSLEDLFDLCD-RTFTLKTVLMIAIQLITRMEYVHTKS
3ei1A           AVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMI
3dbsA           GCISTGDKIGMDATTIAKIQQSTVGNTGAFKDEVLNHWLKE-KSPTEEKFQAAVERFVYSCAGYCVATFV
2c47C           SATEGVPVYYFGPGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKP
3dk6A           KHPNLV-----QLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKN
2e2bA           KHPNLV-QLLGVCTRE----PPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKN
2cgxA           NHENVVKFYGHRREG-----NIQYLFLEYCSGGELFDRIE--PDIGMPEPDAQRFFHQLMAGVVYLHGIG
3e87A           SRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRD
2ckpB           AERSLGPKLYGIFPQIPSRRLDTEELSLPDISAEIAEKMATFHGMKMPFNKEPKWLFGTMEKLSTPSPVV
3dxnA           VLKQLDHPNIMKLYEFFEDKRNYYLVMEVYRGGELFDEIIL--RQKFSEVDAAVIMKQVLSGTTYLHKHN
3bceA           LIMASMDHPHL-VRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERR
3dkfA           SHPNVLSLLGICL-----RSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKFLASKK
2bmcF           VEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKR
1apmE           KRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFAEPHARFYAAQIVLTFEYLHSLD
3c9wA           LLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSAN
3comB           DSPHVVKYYG------SYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMR
1cdkA           RILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVL-TFEYLHSLD
2c3jA           NHENVVKFYGHRR-----EGNIQYLFLEYCSGGELFDRIEP--DIGMPEPDAQRFFHQLMAGVVYLHGIG
2e2bB           AVMKEIKHPNLQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKN
3da6A           CVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQV--IQMELDHERMSYLLYQMLCGIKHLHSAG
3e93A           KHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSAD
3ckwA           DSPYVTKYYGSYL------KDTKLWIIMEYLGGGSALDLL--EPGPLDETQIATILREILKGLDYLHSEK
2advA           PRSNEILWDHIYGVDAPSA-----FYGYGWAARSHGDNIL--RLYGEARGKGAEYWGPDYEQTTVWLLTN
2bmcA           EIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGT-VYRELQKLSKFDEQRTATYITELANALSYCHSKR
2eb3A           AYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRR
3bhhB           KHSNIV-RLHDSISEEGFH-----YLVFDLVTGGELFEDIVARE-YYSEADASHCIQQILEAVLHCHQMG
3cg2A           KHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSAD
3cqwA           VLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFF--HLSRERVFSEDRARFYGAEIVSALDYLHSEK
3c5iA           -------------------------------------------KYIKESDKFIKFMKVYSKSDNLANTIV
2b5mA           RPKGES-KDLLFILTAKYN-----ACILEYKSGESIDIITRAH-GNVQDRIGRPSETGIIGIIDPECRMI
2bkkA           EGKLPVQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNKDPRELYDFLKTEKPEEELV
3dndA           ILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFS--HLRRIGRFSEPHARFYAAQIVLTFEYLHSLD
3byvA           LLRGIKNPQKKKMIRVMWVLSRFFLYPRMQSNLQTFGESHSSTHKSLVHHARLQLTLQVIRLLASLHHYG
3csfA           GCISTGDKIGMIEIVKDATTIAKIQQSTVGNTGFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVA
1cmkE           RILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFS-----HLRRIGRFSEPHARFYAAQIVLTFEYL
3dkgA           IMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKFLASKK
2bfxB           IQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQ--KHGRFDEQRSATFMEELADALHYCHERK
2brmA           NHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPE-PDAQRFFHQLMAGVVYLHGIGITHRDI
3e8cE           ILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLR--RIGRFSEPHARFYAAQIVLTFEYLHSLD
3dy7A           NSPYIVGFY-------GAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKH
3dgkA           VSILKEIQHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFLKQILNGVYYLHSLQ
3cquA           VLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGEL--FFHLSRERVFSEDRARFYGAEIVSALDYLHSEK
2bmcB           EIQSHLRHPNI-LRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKR
3e59C           -------------------------------------------------------EIRRIEQVQLPRIAA
2bvaA           MRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTH----TRMNEEQIAAVCLAVLQALSVLHAQG
1e90A           DKIGMI-EIVKDATTIAKIQQSTVGNTGAFKDEVLSHWLKEKCPIEEKFQAAVERFVYSC-AGYCVATFV
3cqzH           -----------------------------------------------------------------LFDDI
2ac5A           EMLYQCQGHRNVLELIEFFEEEDRFYLVFEKMRGGSILSHIHKRRHFNELEASVVVQDVASALDFLHNKG
2amuA           PHPNTTEIRWIKVFFQPD-GDPYVYEVGRYEFNAHGESQGPNIGAVYTEPTVTTVVKGTIIALSYCNILW
3dfcB           VSILKEIQHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFLKQILNGVYYLHSLQ
3dajA           VEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSRFDEQRTATYITELANALSYCHSKR
3c5yB           -------------------------------------------------------------ENSQAAKNA
3blrA           KILQLLKHENVVNLIEICRTSIYLVFDFCEHDLAGLLSNVLVKFTLS---EIKRVMQMLLNGLYYIHRNK
3dk6B           KHPNLV-QLLGVCTREPPFYIITEFMTYGNLLDYLRECNR----QEVSAVVLLYMATQISSAMEYLEKKN
3c5yE           -------------------------------------------------------QGKIALIIEQAAKNA
3bhhC           KHSNIV-RLHDSISEEGFHYLVFDLVTGGELFEDIV------AREYYSEADASHCIQQILEAVLHCHQMG
3e3pA           PNIVQLQSYFYTLGERDRRDIYLNVVMEYVPDTLHRCCRNYYVAPPPILIKVFLFQLIRSIGCLHLPSVN
3e5aA           EIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGT-VYRELQKLSKFDEQRTATYITELANALSYCHSKR
2dwbA           EIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGT-VYRELQKLSKFDEQRTATYITELANALSYCHSKR
2chwA           GCISTGDEIVKDATTIAKIQQSTVGNTGAFKDEVLNHWLKE-KSPTEEKFQAAVERFVYSCAGYCVATFV
3dfaA           ELLKKLDHPNIMKLFEILEDSSSFYIVGELY--TGELFDEIIKRKRFSEHDAARIIKQVFSGITYMHKHN
1e7vA           DKIGMI-EIVKDATTIAKIQQSTVGNTGAFKDEVLSHWLKE-KCPIEEKFQAAVERFVYSCAGYCVATFV
3c5yA           -----------------------------------------------------------IIENSQAAKNA
3cq9B           DHLLANWLVLDPVFRQWAPQI-KLIDKQNSVRFFLPGDYQITKEADKRYLAFVPLPHLTLPDEKYQDAAY
3daeA           RHPHIIKLYD--------VIKSKDEIIMVIEYAGNELFDYIVQRDKMSEQEARRFFQQIISAVEYCHRHK
3dlsE           EHANIIKVLD------------------------------------------------------------
3c4yB           KILAKVHSRFIVSLAYAFETKTDLCLVMTNGGDIRYHIYNVDEDNPGFQPRAIFYTAQIVSGLEHLHQRN
3c5yL           ----------------------------------------------------------------QAAKNA
1csnA           GCTGIPNVYY------FGQEGLHNVLVIDLLGPSLEDLCGRKFSVKTVAMAAKQMLARVQSIHEKSLVYR
2bkkC           ECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDSE-NWEEDTPFKDPRELYDFLKTEKPEEELV
3dlsC           ----------------------------------------------------------------------
3csvA           ----------------------------------------------------------------------
3bhhD           KHSNIV-RLHDSISEEGFHYLVFDLVTGGE------LFEDIVAREYYSEADASHCIQQILEAVLHCHQMG
3daeB           RHPHIIKLYD--------VIKSKDEIIMVIEYAGNELFDYIVQRDKMSEQEARRFFQQIISAVEYCHRHK
2a1sB           VKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQ--EEERQLREQYDIPEDQKKFIDQVVEKIEDLLQSEE
3cs9D           AVMKEIHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKN
3dplC           TTERMREEENEGIVQLRILRTQEAIIQIMKMRKKISNAQLQTELVEILKNMFLPQKKMIKEQIEWLIEHK
3dlsB           ----------------------------------------------------------------------
3dlsD           ----------------------------------------------------------------------
1bygA           ----------------------------------------------------------------------
3dk7B           KHPNLV-QLLGVCTREPPFYIIIEFMTY----GNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKN
1e7uA           CISTGDKIGMIEIVKDAKIQQSTVGNTGAFKDEVLSHWLKEKCPIEEKFQAAVERFVYSC-AGYCVATFV
2c3iB           ----------------------------------------------------------------------
3cq9D           DHLLANWLVLDPVFRQWAPQIKL-IDKQNSVRFFLPGDYQITKEADKRYLAFVPLPHLTLPDEKYQDAAY
2bvaB           QHENVVEMYN--------SYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQG
3dlsA           ----------------------------------------------------------------------
2cunA           RAYYSKDSPKIYVLGGAKVEDSLKVVENVLRRERADLVLTGGLVANVFTLAKGFDLGRKN-VEFMKK---
2chxA           LPYGCISTGVKDATTIAKIQQSTVGNTGAFKDEVLNHWLKE-KSPTEEKFQAAVERFVYSCAGYCVATFV
2bajA           KRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNDHVQFLIYQILRGLKYIHSAD
2ckeA           VSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEATSFIKQILDGVNYLHTKK
3dneA           KRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLD
2bakA           RLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKLTDDHVQFLIYQILRGLKYIHSAD
3ck8A           -------HYWYFLDLFGKAPFKEHFSNDLPVEKKGTELYT---YIQNELNEIEADMYEP-RQAPFGRADK
3bboU           ------------------------RRVIDQIGRSYAETLMILEL--MPYRACYPIFKLIYSAAANSHNKQ
3bdeA           DHPDHVAFVRDRWVPEVEK-----FLEIDYV---------------------------------------


                         +         .         .         .         .         *         .:210
query           FLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKYAPLACHIQREQCR
2c47A           LIYRDVKPENFLVGRPGTKRQHAIHIIDFGLAKEYIDPETKKHIPREHKSLTGTARYMSINTHLGKEQSR
3ei1A           GLRLYDGLFKVIPLDR-----DNKELKAFNIRLEELHVIDV--------KFLYGCQAPTICFVYQDPQGR
3dbsA           LGIGDRHNDNIMITET-----GNLFHIDFGHERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLL
2c47C           ENFLVGRPGQ---------HAIHIIDFGLAKEYIDPETKKH-IPYREHKSLTGTARYMSINTHLGKEQSR
3dk6A           FIHRDLAARNCLV-----GENHLVKVADFGLSRLMTGDT------TAHAGAKFPIKWTAPESLAYNKFSI
2e2bA           FIHRDLAARNCLVGEN-----HLVKVADFGLSRLTYTAHAG---------AKFPIKWTAPESLAYNKFSI
2cgxA           ITHRDIKPEN--------LLLDERDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAE
3e87A           VVYRDIKLENL-----MLDKDGHIKITDFGLCKEG-------ISDGATMKFCGTPEYLAPEVLEDNDYGR
2ckpB           FCHNDCQEGNILLLE------QKLMLIDFEYSSYNYRG-----FDIGNHFCEWMYDYSYEKYPFFRANIR
3dxnA           IVHRDLKPENLLLESKSDA-----LIKIVDFGLSAHFERLG---------TAYYIAPEVLRKKYDEKCDV
3bceA           LVHRDLAARN-----VLVKSPNHVKITDFGLARLLEGDEKEYN------AGKMPIKWMALECIHYRKFTH
3dkfA           FVHRDLAARNCMLDEKFT-----VKVADFGLARDM---------------YKLPVKWMALESLQTQKFTT
2bmcF           VIHRDIKPENLLLGSA-----GELKIADFGWSVT------LDYLPPEMIEGRMHDEKDLWSLGVLCYEFL
1apmE           LIYRDLKPENLLIDQQ----------GYIQVTDFGFAKRVKGRTW-----LCGTPEYLAPEIILSKGYNK
3c9wA           VLHRDLKPSN------------------------------------------------------------
3comB           KIHRDIKAGN-------------ILLNTEGHAKLADFGVAGQLTDMAKRNVIGTPFWMAPEVIQEIGYNC
1cdkA           LIYRDLKPEN-----LLIDQQGYIQVTDFGFAKRVKG----------RTWLCGTPEYLAPEIILSKGYNK
2c3jA           ITHRDIKPENLLLDERDNLKI-----SDFGLATVFRYNN---RERLLNKMCGTLPYVAPELLKRREFHAE
2e2bB           FIHRDLAARN------------------------------------------------------------
3da6A           IIHRDLKPSNIVVKSDCTLKILDFGLARTVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFP
3e93A           IIHRDLKPSNLAV---------------------------------------------------------
3ckwA           KIHRDIKAANVLLSEHGEVKLADFFV--------------------------GTPFWMAPEVIKQSAYDS
2advA           GVPERAQQWYAQQSPD-----FRANLDAFAAGINA---------------YAQQNPDDISPDVRQVLPVS
2bmcA           VIHRDIKPENL-----LLGSAGELKIADFGWSVTLDYLPPEMIE------GRMHDEKVDLWSLGVLCYEF
2eb3A           LVHRDLAARNVLVKTPQHVKIT-----DFGRAKL------------------VPIKWMALESILHRIYTH
3bhhB           VVHRDLKPEN-----LLLASKCKGAAVKLADFGLAIEVQ---GDQQAWFGFAGTPGYLSPEVLRKEAYGK
3cg2A           IIHRDLKPSNL-----AVNEDCELKILDFGLA-RTRWYRAPEIMLNQTVDIWSVGCIMAELLTGRTLFPG
3cqwA           NVVYRDLKLENLMLDKDGHIKITDFGLCKEG-----------IKDGATMKFCGTPEYLAPEVLEDNDYGR
3c5iA           FCHNDLQENNIINTNCLRLID-----FEYSGFNFLATDIAN------FFIETSIDYSVSSYPFFEIDKKK
2b5mA           GLRLYDGLFKVIPLDRDNKEL-----KAFNIRLEELHVIDV-----KFLYGCQAPTICFVYQDPQGRHVK
2bkkA           FSHGDLGDSNIFV-----KDGKVSGFIDLGR-SGRADKWYDIAFCVRSIREDIGEEQYVELFFDLLGIKP
3dndA           LIYRDLKPENLL-----IDQQGYIQVTDFGFAKRV----------KGRTWLCGTPEYLAPEIILSKGYNK
3byvA           LVHTYLRPVD-----IVLDQRGGVFLTGFEHLVRDARVVSSVSRGFEPPELEARRATISYHRDRRTLMTF
3csfA           TFVLGIGDRHNDNIMITETGNLF--HIDFGHLGERVPFVLFLFVMGTSGKKTSPHFQKFQDICVKAYLAL
1cmkE           HSLDLIYRDL-----KPENLLIDQQGYIQVTDFGFAKRVKGRT------WLCGTPEYLAPEIILSKGYNK
3dkgA           FVHRDLAARNCMLDEKFT-----VKVADFGLARLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGA
2bfxB           VIHRDIKPEN--------------LLMGYKGELKIADFGWSVHAPSLRRRMCGTLDYLPPEMIEGKTHDE
2brmA           KPENLLLDER---------------DNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHA
3e8cE           LIYRDLKPENLL-----IDQQGYIQVTDFGFAKRVKGRTWLCGTPE----------YLAPEIILSKGYNK
3dy7A           KIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSM---------------ANGTRSYMSPERLQGTHYSV
3dgkA           IAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKID--------FGNEFKNIFGTPEFVAPEIVNYEPLGL
3cquA           NVVYRDLKLENLMLDKDGHIKITDFGLCKEG-----------IKDGATMKFCGTPEYLAPEVLEDNDYGR
2bmcB           VIHRDIKPENLLLGSAGEL---KIADFGWSVTLDYL-------PPEMIEGRMHDEKVDLWSLGVLCYEFL
3e59C           FIEAGEPIEFVLPAFPAKSPNPGKVLDSRPDMAERLSLSFLNHLCQRIQLFYAPGACSDGRVFGDLVRIG
2bvaA           VIHRDIKSDSI-----LLTHDGRVKLSDFGFCAQVEVPR---------RKLVGTPYWMAPELISRLPYGP
1e90A           LGIGDRHNDNIMISETGNL---------------------------------------------------
3cqzH           FQVSEVDPGRYNKVCKLTLDINVELFPVAAQDSLTVTIASTRRPPQAGDRSLADDYDYVMYGTAYKFEEV
2ac5A           IAHRDLKPENILCEHPNQV---------------------------------------------------
2amuA           ESSQKIT---------------------------------------------------------------
3dfcB           IAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNE--------FKNIFGTPEFVAPEIVNYEPLGL
3dajA           VIHRDIKPENLLLGSNGELKIADFGWSTLDYLPPEMIHDEKVDLWS----------LGVLCYEFLVGMPP
3c5yB           VVHEALTTVAEPLGHKVF---------NYGYTAEDKASLTYVNGLLAGILLN--SGAADFVVTGGTGGSL
3blrA           ILHRDMKAAN------VLITRDGVLKLADFGLARAFSLAPNRYNRVV-----TLWYRPPELLLGERDYGP
3dk6B           FIHRDLAARNCLVGENHLV---------------------------------------------------
3c5yE           VVHEALTTVAEPLGHK---------VFNYGYTAED--KASLTYVNGLLAGILLNSGAADFVVTGGTGGSL
3bhhC           VVHRDLKPEN--LLLASKCKGAAVKLADFGLAIEVQGDQQA------WFGFAGTPGYLSPEVLRKEAYGK
3e3pA           VCHRDIKPHNVLVNEADGTLK-----LCDFGSAKKLSPSEPNVAY-----ICSRYYRAPELIFGNQHYTT
3e5aA           VIHRDIKPENL-----------------------------------------------------------
2dwbA           VIHRDIKPENLLLGSAGEL-----KIADFGWSVHAPSSRTLCGTLDYLPPEIE------------GRHDE
2chwA           LGIGDRHNDNIM-----ITETGNLFHIDFGHERVPFVTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLAL
3dfaA           IVHRDLKPEN------------------------------------------------------------
1e7vA           LGIGDRHNDNIMISETGN-----LFHIDFGHINKERVPFVLTPDFLFVMGTSGKKTSLHFDVCVKAYLAL
3c5yA           VVHEALTT---------VAEPLGHKVFNYGYTAEDKASLTYVNGLLAGILLN--SGAADFVVTGGTGGSL
3cq9B           NAYPISWASNEFSGNTG-----HFSFDAGVLAVIQSRDDSA-----------------------------
3daeA           IVHRDLKPENLLLDEHLNV---------------------------------------------------
3dlsE           ----------------------------------------------------------------------
3c4yB           IIYRDLKPENVLL-----DDDGNVRISDLGLAVELKAGQTK------TKGYAGTPGFMAPELLLGEEYDF
3c5yL           VVHEALTTVA---------EPLGHKVFNYGYTAEDKASLTYVNGLLAGILLNSGAAD--FVVTGGTGGSL
1csnA           DIKPDNFLIGRPNSKNANMIYVVDFGMVKFYRDPVTKQHIPYREKKNLSGTARYMSINTHLGREQSRRDD
2bkkC           FSHGDLGDSNIFVKDGKVSGFIDLGRSGRAD---------------------------------------
3dlsC           ----------------------------------------------------------------------
3csvA           ----------------------------------------------------------------------
3bhhD           VVHRDLKPEN--LLLASKCKGAAVKLADFGLAIEVQGDQQAWFG------FAGTPGYLSPEVLRKEAYGK
3daeB           IVHRDLKPENLLLDEHLNV---------------------------------------------------
2a1sB           NKNLDLEPCTGFQRKL-----IYQTLSWKYPKGIHVETLET--------EKKERYIVISKVDEEEREQEE
3cs9D           FIHRDLAARNC-----LVGENHLVKVADFGLSRLM-----TGDTYTAHAGAKFPIKWTAPESLAYNKFSI
3dplC           YIRRDESDIN------------------------------------------------------------
3dlsB           ----------------------------------------------------------------------
3dlsD           ----------------------------------------------------------------------
1bygA           ----------------------------------------------------------------------
3dk7B           FIHRDLAARN-------------CLVGENHLVKVADFGLSRLMTGDTTAHAGAKFPIKWTAPESLAYNKI
1e7uA           LGIGDRHNDNIMISETGN-----LFHIDFGHINKERVPFVLTPDFLFVMGTSGKKTS-----------LH
2c3iB           ----------------------------------------------------------------------
3cq9D           NAYPISWASNEFSGNT-----GHFSFDAGVLAVIQSRDD-------------------------------
2bvaB           VIHRDIKSDSILLTHDGRVKLSDFGFCAQVEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEM
3dlsA           ----------------------------------------------------------------------
2cunA           KGLLDYVKHAEEIL--DEFYPYIRTPVDFAVDYKGERVE----IDLLSENRGLLHQYQIMDIGKRTAEKY
2chxA           LGIGDRHNDNIM-----ITETGNLFHIDFGHERVPFVLPDFLFVMGTSGKKTSPHFQKFQDICVKAYLAL
2bajA           IIHRDLKPSNLAV-NEDCE----LKILDFGLARHT------------DDEMTGYVATRWYRAPEIMLNNQ
2ckeA           IAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVE--------FKNIFGTPEFVAPEIVNYEPLGL
3dneA           LIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTW---------------LCGTPEYLAPEIILSKGYNK
2bakA           IIHRDLKPSNLAVNEDCELKILDFGVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMA---ELLTGRTLFP
3ck8A           AANWLLRARLY------LNAGVYTGQTDYAKAEEYASK--------------------------------
3bboU           FNKANLIISK------------------------------------------------------------
3bdeA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KDDIESWLYMVVEMTCGRLPWRNLTESDDVGVFKKECKTTRLRCLFGGCPREFTEVFPILDKGKFFDAPE
2c47A           RDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTTPIEVLCENFPEEMATYLRYVRRLDFFEKPD
3ei1A           HVKTYEVSLREKEFNKGPWKQ-------------------------------------------------
3dbsA           RHHTNLLIILFSMMLMTGMPQ-------------------------------------------------
2c47C           RDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTTPIEVLCENFPEEMATYLRYVRRLDFFEKPD
3dk6A           KSDVWAFGVLLWEIATYGMSPYPGIDPSQV----------------------------------------
2e2bA           KSDVWAFGVLLWEIATYGMSPYPGIDLSQV----------------------------------------
2cgxA           PVDVWSCGIVLTAMLAGELPW-------------------------------------------------
3e87A           AVDWWGLGVVMYEMMCGRLPFYNQDHER------------------------------------------
2ckpB           KYPTKKQQLHFISSYLPAFQFENLSTEE------------------------------------------
3dxnA           WSCGVILYILLCGYPPFGGQT-------------------------------------------------
3bceA           QSDVWSYGVTIWELMTFGGKP-------------------------------------------------
3dkfA           KSDVWSFGVLLWELMTRGAPPYPDVNTFDI----------------------------------------
2bmcF           VGKPPFEANTYQETYKRISRVE------------------------------------------------
1apmE           AVDWWALGVLIYEMAAGYPPFFADQPIQ------------------------------------------
3c9wA           ----------------------------------------------------------------------
3comB           VADIWSLGITAIEMAEGKPPYADIHPMR------------------------------------------
1cdkA           AVDWWALGVLIYEMAAGYPPFFADQPIQ------------------------------------------
2c3jA           PVDVWSCGIVLTAMLAGELPW-------------------------------------------------
2e2bB           ----------------------------------------------------------------------
3da6A           GRDYIDQWNKVIEQLGTPCPE-------------------------------------------------
3e93A           ----------------------------------------------------------------------
3ckwA           KADIWSLGITAIELARGEPPH---SELHPMKVLFLIPKNNPPTL----EGNYSKPLKEFVEACLNKEPSF
2advA           GADVVAHAHRLMNFLYVASPGRTLGEGD------------------------------------------
2bmcA           LVGKPPFEANTYQETYKRISRVEFTFPDFV----------------------------------------
2eb3A           QSDVWSYGVTVWELMTFGSKPYDGIPASEI----------------------------------------
3bhhB           PVDIWACGVILYILLVGYPPF-------------------------------------------------
3cg2A           TDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEK--------
3cqwA           AVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTL--------------------------
3c5iA           YISYENRKLFITAYLSNYLPTPKLIDEI------------------------------------------
2b5mA           TYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQE--------------------------
2bkkA           DWEKIKYYILLDEL--------------------------------------------------------
3dndA           AVDWWALGVLIYEMAAGYPPF-------------------------------------------------
3byvA           SFDAWALGLVIYWIWCADLPI-------------------------------------------------
3csfA           RHHTNLLIILFSMMLMTGMPQ-------------------------------------------------
1cmkE           AVDWWALGVLIYEMAAGYPPFFADQPIQ------------------------------------------
3dkgA           PPYPDVNTFDITVYLLQGRRL-------------------------------------------------
2bfxB           KVDLWCAGVLCYEFLVGMPPF-------------------------------------------------
2brmA           EPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDW-----------------------------------
3e8cE           AVDWWALGVLIYEMAAGYPPFFADQPIQ------------------------------------------
3dy7A           QSDIWSMGLSLVEMAVGRYPI-------------------------------------------------
3dgkA           EADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEDEYFSNTSALAKDFIRRLL----VKDPKK
3cquA           AVDWWGLGVVMYEMMCGRLPFYNQDHEK------------------------------------------
2bmcB           VGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHN--------------------------
3e59C           DAHISAYQDALRLMIEEIGATHIGVFNLEDVRAFEAQRDNHEQLRQLLIGGYAEPLESIRETLLAS----
2bvaA           EVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLP--------------------------------
1e90A           ----------------------------------------------------------------------
3cqzH           SKVYYSFGGLLMRLEENAYLLI------------------------------------------------
2ac5A           ----------------------------------------------------------------------
2amuA           ----------------------------------------------------------------------
3dfcB           EADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEDEYFSNTSALAKDFIRRLL----VKDPKK
3dajA           FEAHTYQETYRRISRVEFTFPDFVTEGA------------------------------------------
3c5yB           AANAPGVFCGLVIDPTDAFLFGQINDGNAISPYSKGFGWAAELNLQDVYRKLFDGERGLGYPRERAEIR-
3blrA           PIDLWGAGCIMAEMWTRSPIMQGNTEQH------------------------------------------
3dk6B           ----------------------------------------------------------------------
3c5yE           AANAPGVFCGLVIDPTDAFLFGQINDGN------------------------------------------
3bhhC           PVDIWACGVILYILLVGYPPF-------------------------------------------------
3e3pA           AVDIWSVGCIFAEMMLGEPIF-------------------------------------------------
3e5aA           ----------------------------------------------------------------------
2dwbA           KVDLWSLGVLCYEFLVGKPPFEA-----------------------------------------------
2chwA           RHHTNLLIILFSMMLMTGMPQ-------------------------------------------------
3dfaA           ----------------------------------------------------------------------
1e7vA           RHHTNLLIILFSMMLMTGMP--------------------------------------------------
3c5yA           AANAPGVFCGLVIDPTDAFLF-------------------------------------------------
3cq9B           ----------------------------------------------------------------------
3daeA           ----------------------------------------------------------------------
3dlsE           ----------------------------------------------------------------------
3c4yB           SVDYFALGVTLYEMIAARGPFRARGEKVENKELKQRVLEQAVTY--------------------------
3c5yL           AANAPGVFCGLVIDPTDAFLFG------------------------------------------------
1csnA           LEALGHVFMYFLRGSLPWQGLKAATNKQKYERIGEKKQSTPLRELCAGFPEEFYKYMHYARNLAFDATPD
2bkkC           ----------------------------------------------------------------------
3dlsC           ----------------------------------------------------------------------
3csvA           ----------------------------------------------------------------------
3bhhD           PVDIWACGVILYILLVGYPPFWDEDQ--------------------------------------------
3daeB           ----------------------------------------------------------------------
2a1sB           LNDAVGFSRVIHAIANSGKLV-------------------------------------------------
3cs9D           KSDVWAFGVLLWEIATYGMSPYPGIDLSQV----------------------------------------
3dplC           ----------------------------------------------------------------------
3dlsB           ----------------------------------------------------------------------
3dlsD           ----------------------------------------------------------------------
1bygA           ----------------------------------------------------------------------
3dk7B           KSDVWAFGVLLWEIATYGMSPYPGIDPSQVYELLEKDYRMERPEGCPEKVYEL-----------------
1e7uA           FQKFQDVCVKAYLALRH-----------------------------------------------------
2c3iB           ----------------------------------------------------------------------
3cq9D           ----------------------------------------------------------------------
2bvaB           VDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLV------------------------
3dlsA           ----------------------------------------------------------------------
2cunA           REILMKARIIVANGPMGVFEREEFAIGTVEVFKA------------------------------------
2chxA           RHHTNLLIILFSMMLMTGMPQ--LTSKEDIEYIRDAL---TVGKNEEDAKKYFLDQIEVCRDKGWTVQFN
2bajA           TVDIWSVGCIMAELLTGRTLF-------------------------------------------------
2ckeA           EADMWSIGVITYILLSGASPFLGDTKQETLANITSVSYDFDEEFFSHTSELAKDFIRKLLVK--------
3dneA           AVDWWALGVLIYEMAAGYPPFFADQPIQ------------------------------------------
2bakA           GTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMKMNFANVFIGANPLAVDLLEKMLVLDSDK
3ck8A           ----------------------------------------------------------------------
3bboU           ----------------------------------------------------------------------
3bdeA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YTTIYELLEKAMVNTKSNEFPYDWE
2c47A           YDYLRKLFTDLFDRSGFVFYEYDWA
3ei1A           -------------------------
3dbsA           -------------------------
2c47C           YDYLRKLFTDLFDRSGFVDYEYDWA
3dk6A           -------------------------
2e2bA           -------------------------
2cgxA           -------------------------
3e87A           -------------------------
2ckpB           -------------------------
3dxnA           -------------------------
3bceA           -------------------------
3dkfA           -------------------------
2bmcF           -------------------------
1apmE           -------------------------
3c9wA           -------------------------
3comB           -------------------------
1cdkA           -------------------------
2c3jA           -------------------------
2e2bB           -------------------------
3da6A           -------------------------
3e93A           -------------------------
3ckwA           RPTAKELLKHKFILRNAKKTSYLTE
2advA           -------------------------
2bmcA           -------------------------
2eb3A           -------------------------
3bhhB           -------------------------
3cg2A           -------------------------
3cqwA           -------------------------
3c5iA           -------------------------
2b5mA           -------------------------
2bkkA           -------------------------
3dndA           -------------------------
3byvA           -------------------------
3csfA           -------------------------
1cmkE           -------------------------
3dkgA           -------------------------
2bfxB           -------------------------
2brmA           -------------------------
3e8cE           -------------------------
3dy7A           -------------------------
3dgkA           RMTIQDSLQ----------------
3cquA           -------------------------
2bmcB           -------------------------
3e59C           -------------------------
2bvaA           -------------------------
1e90A           -------------------------
3cqzH           -------------------------
2ac5A           -------------------------
2amuA           -------------------------
3dfcB           RMTIQDSLQ----------------
3dajA           -------------------------
3c5yB           -------------------------
3blrA           -------------------------
3dk6B           -------------------------
3c5yE           -------------------------
3bhhC           -------------------------
3e3pA           -------------------------
3e5aA           -------------------------
2dwbA           -------------------------
2chwA           -------------------------
3dfaA           -------------------------
1e7vA           -------------------------
3c5yA           -------------------------
3cq9B           -------------------------
3daeA           -------------------------
3dlsE           -------------------------
3c4yB           -------------------------
3c5yL           -------------------------
1csnA           YDYLQGLFSKVLERLNTTEDNFDWN
2bkkC           -------------------------
3dlsC           -------------------------
3csvA           -------------------------
3bhhD           -------------------------
3daeB           -------------------------
2a1sB           -------------------------
3cs9D           -------------------------
3dplC           -------------------------
3dlsB           -------------------------
3dlsD           -------------------------
1bygA           -------------------------
3dk7B           -------------------------
1e7uA           -------------------------
2c3iB           -------------------------
3cq9D           -------------------------
2bvaB           -------------------------
3dlsA           -------------------------
2cunA           -------------------------
2chxA           W------------------------
2bajA           -------------------------
2ckeA           -------------------------
3dneA           -------------------------
2bakA           RITAAQALAHA--------------
3ck8A           -------------------------
3bboU           -------------------------
3bdeA           -------------------------