[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cele0:AAA81130.1

[Show Plain Result]


## Summary of Sequence Search
    1::914
   13::119     4e-19  42%  120 aa  PF00567 TUDOR "Tudor domain"
    2::106     2e-09  36%  107 aa  PF00565 SNase "Staphylococcal nuclease homologue"
   18::61      4e-04  43%  107 aa  PF06003 SMN "Survival motor neuron protein (SMN)"
   21::88      2e-07  42%  107 aa  PF00565 SNase "Staphylococcal nuclease homologue"(query 399->473)
    4::77      9e-05  39%  107 aa  PF00565 SNase "Staphylococcal nuclease homologue"(query 554->639)
    1::914

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVYLSNVTAPRLGRRPTDS
PF00567         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------VRLAGIDAPELARR----
PF06003         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ASATPDEPYAWDSREYLRQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQ
PF00567         ----------------------------------------------------------------------
PF00565         --GKPEQPFGEEAKEFLRKLLLGRKVVVEVEGKDRYGRLLATVYVG-----DGKNVNEELVREGLARVRR
PF06003         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GKVADEYSTKLLELQEQAKSAGRGKWNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00567         ----------------------------------------------------------------------
PF00565         YGPRSEYYDELLAAEAEAKKAKKGLWS-------------------------------------------
PF06003         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00567         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------
PF06003         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00567         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------
PF06003         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPFMFQAREFLRKRLLGKKVQIQ
PF00567         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------
PF06003         ----------------------------------------------------------------------
PF00565         ------------------------------------------------PFGEEAKEFLRKLLLGRKVVVE
PF00565         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           IDYVQPKSENFPEKTCATIKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDxxxxxxxxxxxxxxxxx
PF00567         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------
PF06003         ----------------------------------------------------------------------
PF00565         VE-----GKDRYGRLLATVYVGDKNVNEELVREGLARVYRRYG---PRSEYYD-----------------
PF00565         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLGGINCP
PF00567         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------
PF06003         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------
PF00565         ---------------------------------------------------------------LAGIDAP


                         .         .         .         *         .         .         .:630
query           KGARVGPGGVSTGXXXXXXXXXXXXTRKLVLQHEVQLEVESTDKNGNFVGYLYVSPDGNTSRAINLSEAL
PF00567         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------
PF06003         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------
PF00565         ELARRGKPEQPFGEEAKEFL------RKLLLGRKVVVEVEGKDRYGRLLATVYVG-DGK-----NVNEEL


                         .         +         .         .         .         .         *:700
query           VENGLASLHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxI
PF00567         ---------------------------------------------------------------------V
PF00565         ----------------------------------------------------------------------
PF06003         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------
PF00565         VREGLARVY-------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           APGALRFSAQNIEDGPKIEKMTTEMRQALAEHPPLAGSYTTKRGDLCVAKFSQDGQWYRCKVESVRAGQA
PF00567         SPG--EFYVQLVEDAEKLEKLMEELQEFYSSSPP-SPLLTPKVGDLCVALFSEDGKWYRAKVKSLEDGKV
PF00565         ----------------------------------------------------------------------
PF06003         -----------------------------------------KVGDKCQAVWSEDGQYYEATITSIERGTC
PF00565         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           EIVYIDYGNRETIEAVKLAQIPAGFANFPAGVREYNLAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00567         EVFFVDYGNTEVVPLSDLRPLPPEFLTLPPQAIECSLA--------------------------------
PF00565         ----------------------------------------------------------------------
PF06003         VVVYTGYGNEEEV---------------------------------------------------------
PF00565         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00567         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------
PF06003         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxx
PF00567         ----
PF00565         ----
PF06003         ----
PF00565         ----
PF00565         ----