[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cele0:AAF02170.1

[Show Plain Result]


## Summary of Sequence Search
    1::119
    1::64      2e-19  62%   66 aa  PF05180 zf-DNL "DNL zinc finger"
    1::119

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSLSYTCKVCNSREGPKTFAKSSYEKGVVIVTCSGC
PF05180         ----------------------------------MQLTFTCKVCGTRS-TKTISKHAYEKGVVIVQCPGC


                         .         .         *         .         .         .         .:140
query           HNHHIIADNIGWFEDFKGKNIEDHLKTRGExxxxxxxxxxxxxxxxxxx
PF05180         KNRHLIADNLGWFGDKKG-NIEDILAEKGE-------------------