[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cele0:AAN63415.1

[Show Plain Result]


## Summary of Sequence Search
    1::400
   11::161     4e-15  39%  165 aa  PF00534 Glycos_transf_1 "Glycosyl transferases group 1"
    1::400

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00534         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00534         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKY
PF00534         --------------------------------------------------------------------KP


                         .         .         .         +         .         .         .:280
query           VFTSLNRFERKKNIVLALDAFEKLKSNLPADEFSQCHLVIAGGYDLKNPENIEHYDELVEHMKKLELPAD
PF00534         VILFVGRLTPQKGIDLLIEAFAKLL------EGPDVKLVIVGD----GP----YREELEALAEELGLP-D


                         .         *         .         .         .         .         +:350
query           QIVFLHSPSDTQKVNLIRRSRAVLYTPDREHFGIVPVEAMYLGTPVIAVNTGGPCESVRNNETGFLVDQT
PF00534         RVIFLGFVPDEELAELYAAADVFVLPSRYEGFGLVLLEAMACGLPVIASDVGGLPEIVEDGETGFLVDPD


                         .         .         .         .         *         .         .:420
query           AEAFAEKMIDLMKDEEMYRRMSExxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00534         PEALAEAILRLLEDPELRERMGE---------------------------