[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cele0:CAA21529.1

[Show Plain Result]


## Summary of Sequence Search
    1::180
    2::159     8e-29  42%  159 aa  PF06703 SPC25 "Microsomal signal peptidase 25 kDa subunit (SPC25)"
    1::180

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxVKNALDEVVKKILNDKVGWTESHNLMNLRLLISFIGVAFSAFACGYDYYEPFPK
PF06703         ----------------LKNALDDAVKEVLLE-LGYKEDHRLSDIRLILGYIAVAIAIAAFYWDYKYPFPE


                         .         .         *         .         .         .         .:140
query           SKIVLAVCSVSYFICMGILQMYQWYVEKDCIYEATEVDGKQSRKWAWSSEIKAHDDKYTLSAEFKKEGRS
PF06703         SKPVLIACVILYFILSGILTLWTYFVEKGIIFVGKRKD--SGEKLTISSSTKKFSPKYTLTIEYKKSKSA


                         +         .         .         .         .         *         .:210
query           GQGKITKSIGAYIDNDGEIIVPLVKKEVDDLYNRLxxxxx
PF06703         REVEITKSVGKFFDEDGYLVEDLFEKEVEKLLNKL-----