[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cele0:CAA93431.1

[Show Plain Result]


## Summary of Sequence Search
    1::305
    3::212     1e-13  34%  256 aa  PF00069 Pkinase "Protein kinase domain"
    6::254     3e-07  27%  254 aa  PF07714 Pkinase_Tyr "Protein tyrosine kinase"
    1::305

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEV
PF00069         --------------------LLKKLGEGGFGTVYLARDKDTGEL-VAVKIDEKEEERAL--REIRILKRL
PF07714         -----------------------KLGEGGFGKVYKGTLRDGTEV--AVKRLKEGSSQGELEEEVEILSKL


                         .         .         *         .         .         .         .:140
query           KKQKIVGRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLHNIG
PF00069         RHPNIV--RLLDVFEDGD----HLYLVMEYCGGSLFDLKKKGPLSEEE---ARKIARQILRALAYLHSKG
PF07714         RHPNLV-RLLGVCTEGGPLLLVYEYMP----NGSLDDYLRGKERPPLDWKQRLKIALQIARGLEYLHSKK


                         +         .         .         .         .         *         .:210
query           FLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKYAPLACHIQREQCR
PF00069         IIHRDLKPENIL-----LDEDGNVKLIDFGLAKLL------LSSGERLTTVVGTPGYMAPEVLLGGGYTK
PF07714         IIHRDLKARNILLDENLVAKIS-----DFGLARLLYSDDYYHVSTRV----KGPIGWMAPEYLRTGKFTE


                         .         .         .         +         .         .         .:280
query           KDDIESWLYMVVEMTCGRLPWRNLTESDDVGVFKKECKTTRLRCLFGGCPREFTEVFPILDKGKFFDAPE
PF00069         KVDIWSLGVILYELLTGRPPFDGESEEDQLELIEK-----------------------------------
PF07714         KSDVYSFGVLLWELTLGRRPYPGLSNEEVL-----ELVDDGLRLIPEDCPEELYELMLLCWQEDPEDRPT


                         .         *         .         .         .         .         +:350
query           YTTIYELLxxxxxxxxxxxxxxxxx
PF00069         -------------------------
PF07714         FSEVVERL-----------------