[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cele0:CAB01696.1

[Show Plain Result]


## Summary of Sequence Search
    1::245
    1::183     2e-24  40%  194 aa  PF04511 DER1 "Der1-like family"
    1::245

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxIPIVTRYWFLASTIIPLLGRFGFINVQWMFLQWDLVVNKFQFWRPLTALIYYPVTPQTGFH
PF04511         ---------IPPVTRAYLIATVLTSILVSLGLISPYKLYLSPQLVFKKFQIWRLITSFLYFG---PLSLN


                         .         .         *         .         .         .         .:140
query           WLMMCYFLYNYSKALESETYRGRSADYLFMLIFNWFFCSGLCMALDIYFLLEPMVISVLYVWCQVNKDTI
PF04511         FLFNLYFLYRYSSMLEEGSFRGRSADFLYFLLFGGILILLFSLLLGPYFVNLPFLGSALYVWSRRNPNVR


                         +         .         .         .         .         *         .:210
query           VSFWFGMRFPARYLPWVLWGFNAVLRGGGTNELVGILVGHAYFFVALKYPxxxxxxxxxxxxxxxxxxxx
PF04511         VNFFGLFTIKAPYLPWVLLGFSLLLGGSLLVDLLGILVGHLYYFLEDVYP--------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04511         -----------------------------------