[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cele0:CAB01743.1

[Show Plain Result]


## Summary of Sequence Search
    1::166
   19::112     8e-11  36%  112 aa  PF10233 Cg6151-P "Uncharacterized conserved protein CG6151-P"
    1::166

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTLSATCMVAILLQMTAGALV
PF10233         --------------------------------------------------TISVVCIVFGILQIVVGFVV


                         .         .         *         .         .         .         .:140
query           IALEAPFCCQFVDFIEKIARFSESRALWHKAAIYGAMGLIPIFLCIELNTILGSGTIFASGVIYGFMALG
PF10233         LFVEAPFLLRICPTSSKFAEFIDRFTNWMRALLYCLMAVVPLSLCFGLTSLIGAAVFLATGVFYGLAALG


                         +         .         .         .         .         *         .:210
query           KKxxxxxxxxxxxxxxxxxxxxxxxx
PF10233         KQ------------------------