[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cele0:CAB60993.2

[Show Plain Result]


## Summary of Sequence Search
    1::388
    1::70      2e-13  49%   71 aa  PF00076 RRM_1 "RNA recognition motif. (a.k.a. RRM, RBD, or RNP
    1::70      7e-12  46%   71 aa  PF00076 RRM_1 "RNA recognition motif. (a.k.a. RRM, RBD, or RNP(query 15->84)
    1::388

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxIYVGGLDEKVSESILWELMVQAGPVVSVNMPKDRVTANHQGFGFVEFMGEEDADYA
PF00076         ----------------------------------------------------------------------
PF00076         --------------LFVGNLPPDVTEEDLRELFSKYGPVESVRIVRDRETGRSKGFAFVEFESPEDAEKA


                         .         .         *         .         .         .         .:140
query           IKILNMIKLYGKPIxxxxxxxxxxxxxxxxxIFVGNLDPEVDEKLLYDTFSAFGVILQVPKIMRDVDSGT
PF00076         -------------------------------LFVGNLPPDVTEEDLRELFSKYGPVESV-RIVRDRETGR
PF00076         LEELNGKELGGRPI--------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           SKGFAFINFASFEASDTALEAMNGQFLCNRAIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00076         SKGFAFVEFESPEDAEKALEELNGKELGGRPI--------------------------------------
PF00076         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00076         ----------------------------------------------------------------------
PF00076         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00076         ----------------------------------------------------------------------
PF00076         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00076         --------------------------------------
PF00076         --------------------------------------