[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cele0:AAA81130.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2diqA1.bssp"
#ERROR : Can't open dsspfile "1a2tA.bssp"
#ERROR : Can't open dsspfile "2hqxA1.bssp"
#ERROR : Can't open dsspfile "1mhnA.bssp"
#ERROR : Can't open dsspfile "2gf7A2.bssp"
#ERROR : Can't open dsspfile "1itkA2.bssp"
#ERROR : Can't open dsspfile "1a2tA.bssp"
#ERROR : Can't open dsspfile "1a2tA.bssp"
#ERROR : Can't open dsspfile "1a2tA.bssp"

## Summary of PDB Search
:914
    7e-18  24%  2diqA1 [b.34.9.1] TUDOR AND KH DOMAIN-CONTAINING PROTEIN A:8 -- 104
    9e-16  20%  1a2tA  [b.40.1.1] STAPHYLOCOCCAL NUCLEASE
    1e-13  43%  2hqxA1 [b.34.9.1] P100 CO-ACTIVATOR TUDOR DOMAIN A:8 -- 97
    2e-13  40%  1mhnA  [b.34.9.1] SURVIVAL MOTOR NEURON PROTEIN
    4e-07  20%  2gf7A2 [b.34.9.1] JUMONJI DOMAIN-CONTAINING PROTEIN 2A A:897 -- 955
    6e-04  19%  1itkA2 [a.93.1.3] CATALASE-PEROXIDASE A:424 -- 731
    2e-14  16%  1a2tA  [b.40.1.1] STAPHYLOCOCCAL NUCLEASE(query 343->472)
    3e-07  16%  1a2tA  [b.40.1.1] STAPHYLOCOCCAL NUCLEASE(query 758->904)
    4e-07  22%  1a2tA  [b.40.1.1] STAPHYLOCOCCAL NUCLEASE(query 195->326)
:914

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxRGLVKSVLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDS
2diqA1          ----------------------------------------------------------------------
1a2tA           ------------------------PATLIKAIDGDTXKL-----MYKGQPMTFRLLLVDTPETKH-----
2hqxA1          ----------------------------------------------------------------------
1mhnA           ----------------------------------------------------------------------
2gf7A2          ----------------------------------------------------------------------
1itkA2          ------------------------------VLGGNAAVEQAAANAGYDVEIPF--------EPGRVDTDA
1a2tA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ASATPDEPYAWDSREYLRQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQ
2diqA1          ----------------------------------------------------------------------
1a2tA           -PKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGL--AYIYADGKMVNEALVRQGLAKVYV
2hqxA1          ----------------------------------------------------------------------
1mhnA           ----------------------------------------------------------------------
2gf7A2          ----------------------------------------------------------------------
1itkA2          PSFDALKPKVDGVRNYIQDDITRPAEEVLVDNADLLNLTASELLIGGMRSIGA---NYQDTDLGVFTDEP
1a2tA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GKVADEYSTKLLELQEQAKSAGRGKWNxxxxxxxxxxxxxxxxxxxxxxxxxxxIDAVIEMVRDGSTVRA
2diqA1          ----------------------------------------------------------------------
1a2tA           YKPNNTHEQHLRKSEAQAKKEKLNIWS-------------------------------------------
2hqxA1          ----------------------------------------------------------------------
1mhnA           ----------------------------------------------------------------------
2gf7A2          ----------------------------------------------------------------------
1itkA2          ETLTNDFFVNLLDMGTEWE---------------------------------------------------
1a2tA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
1a2tA           ------------------------------------------------------EPATLIKAIDGDTXK-


                         .         .         .         +         .         .         .:280
query           FLLPNFEYITLQLSGVRAPSTRNPNAADXXXXXXXXXXXXXXXXXLLQRDVQIILESTSNQNFVGSIVHP
2diqA1          ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
2hqxA1          ----------------------------------------------------------------------
1mhnA           ----------------------------------------------------------------------
2gf7A2          ----------------------------------------------------------------------
1itkA2          ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
1a2tA           -LMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKM---VENAKKIEVEFDKGQRTGLAYIYAD


                         .         *         .         .         .         .         +:350
query           KGNIAESLLREGYAKCVDWSIGLCTGGAQKLRDAERQAKEKRLRLWxxxxxxxxxxxxxxxxFTGKVVEI
2diqA1          ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
2hqxA1          ----------------------------------------------------------------------
1mhnA           ----------------------------------------------------------------------
2gf7A2          ----------------------------------------------------------------------
1itkA2          ----------------------------------------------------------------------
1a2tA           --------------------------------------------------------------EPATLIKA
1a2tA           ----------------------------------------------------------------------
1a2tA           GKMVNEALVRQGLAK-VAYVYKPNNTHEQHLRKSEAQAKKEKLNIW------------------------


                         .         .         .         .         *         .         .:420
query           VLSDAVVVQKDDGSEVKLHLSSIRLPRESGDDKATGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQ
2diqA1          ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
2hqxA1          ----------------------------------------------------------------------
1mhnA           ----------------------------------------------------------------------
2gf7A2          ----------------------------------------------------------------------
1itkA2          ----------------------------------------------------------------------
1a2tA           IDGDTXKL-MYKGQPMTFRLLLVDTPE-------TKHPKKG-----VEKYGPEASAFTKKMVENAKKIEV
1a2tA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           IDYVQPKSENFPEKTCATIKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYxxxxxxxxxxxxxxxxxx
2diqA1          ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
2hqxA1          ----------------------------------------------------------------------
1mhnA           ----------------------------------------------------------------------
2gf7A2          ----------------------------------------------------------------------
1itkA2          ----------------------------------------------------------------------
1a2tA           EFD-KGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHL------------------
1a2tA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2diqA1          ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
2hqxA1          ----------------------------------------------------------------------
1mhnA           ----------------------------------------------------------------------
2gf7A2          ----------------------------------------------------------------------
1itkA2          ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2diqA1          ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
2hqxA1          ----------------------------------------------------------------------
1mhnA           ----------------------------------------------------------------------
2gf7A2          ----------------------------------------------------------------------
1itkA2          ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2diqA1          ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
2hqxA1          ----------------------------------------------------------------------
1mhnA           ----------------------------------------------------------------------
2gf7A2          ----------------------------------------------------------------------
1itkA2          ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxKIEKMTTEMRQALAEHPPLAGSYTTKRGDLCVAKFSQDGQWYRCKVESVRAGQA
2diqA1          ----------------QLDKLVNEMTQHYENSVPEDLTV--HVGDIVAAPLPTNGSWYRARVLGTENGNL
1a2tA           ----------------------------------------------------------------------
2hqxA1          ----------------QFQKLMENMRNDIASHPPVEGSYAPRRGEFCIAKFV-DGEWYRARVEKVSPAKI
1mhnA           -----------------------------------------KVGDKCSAIWSEDGCIYPATIASIKRETC
2gf7A2          -----------------------------------------TAGQKVISKHK-NGRFYQCEVVRLTETFY
1itkA2          ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
1a2tA           ---------------------------------------------------------EPATLIKAIDGDT
1a2tA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           EIVYIDYGNRETIEAVKLAQIPAGFANFPAGVREYNLALAKLPNEDYVQLTSDAFAQYLFGHSSVFINSE
2diqA1          DLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECSLA--------------------------------
1a2tA           ----------------------------------------------------------------------
2hqxA1          HVFYIDYGNREVLPSTRLGTLSPAFSVLPA----------------------------------------
1mhnA           VVVYTGYGNREEQ---------------------------------------------------------
2gf7A2          EVNFDDGSFSDNL---------------------------------------------------------
1itkA2          ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
1a2tA           XKLMYKGQPMT----FRLL-----------LVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFD
1a2tA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           YKVGTSEYVTVYYDSGNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSRKNIWxxxxxx
2diqA1          ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
2hqxA1          ----------------------------------------------------------------------
1mhnA           ----------------------------------------------------------------------
2gf7A2          ----------------------------------------------------------------------
1itkA2          ----------------------------------------------------------------------
1a2tA           ----------------------------------------------------------------------
1a2tA           KGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPN-NTHEQHLRKSEAQAKKEKLNIW------
1a2tA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxx
2diqA1          ----
1a2tA           ----
2hqxA1          ----
1mhnA           ----
2gf7A2          ----
1itkA2          ----
1a2tA           ----
1a2tA           ----
1a2tA           ----