[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cele0:AAC47965.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1u6gC.bssp"
#ERROR : Can't open dsspfile "1nzeA.bssp"
#ERROR : Can't open dsspfile "2bkuB1.bssp"
#ERROR : Can't open dsspfile "1qbkB.bssp"
#ERROR : Can't open dsspfile "1qgkA.bssp"
#ERROR : Can't open dsspfile "1b3uA.bssp"
#ERROR : Can't open dsspfile "1qbkB.bssp"

## Summary of PDB Search
:2076
    8e-20  10%  1u6gC  [a.118.1.2] TIP120 PROTEIN
    8e-13  15%  1nzeA  [a.24.18.1] OXYGEN-EVOLVING ENHANCER PROTEIN 3
    2e-09  12%  2bkuB1 [a.118.1.1] IMPORTIN BETA-1 SUBUNIT B:1 -- 861
    4e-09  15%  1qbkB  [a.118.1.1] KARYOPHERIN BETA2
    9e-08   9%  1qgkA  [a.118.1.1] PROTEIN (IMPORTIN BETA SUBUNIT)
    6e-07  11%  1b3uA  [a.118.1.2] PROTEIN (PROTEIN PHOSPHATASE PP2A)
    8e-05  12%  1qbkB  [a.118.1.1] KARYOPHERIN BETA2(query 41->504)
:2076

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxEEALEACPEQKRPVFIYEWLRYLDRILPITQREDLKNVQKELQQQLESRLHTVVGPPTRK
1u6gC           -----------------------------------------------------------------KDFRF
1nzeA           ----------TEAAQRAKVSASEIL--NVKQFIDRKAWPSLQNDLRLRASYLRYDLKTVISAK--PKDEK
2bkuB1          ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------PDEQGLQQILQLLKESQSPDTTI-----QR


                         .         .         *         .         .         .         .:140
query           LIARCIGRVYALTGDIVSLNTLLNSCNDTLKVKDESPKAVQSKLAALACLSAVYDSMGRMAGRSIEDTLA
1u6gC           MATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQN--LAVKCLGPLVSKVKEYQVETIVDTLC
1nzeA           KSLQEL---------TSKLFSSIDNLDHAAKIKSPTE-AEKYYGQTVSNINEVLAKLG------------
2bkuB1          ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
1qbkB           TVQQKLEQLNQYPDFNNYLIFVLTKLKS---------EDEPTRSLSGLILKNNVKAHFQNF---PNGVTD


                         +         .         .         .         .         *         .:210
query           IVKNWMSTAVAHSQAHIMNTLTSMVKALGSGDYVTHKKIHSIAKNSLQDRTLCKTPNVKIASLECLTALV
1u6gC           TNMLSDKEQLRDISSIGLKTVIGE-----LPSALAANVCKKITGRLTSAIAKQEDVSVQLEALDIMADML
1nzeA           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
1qbkB           FIKSECLNNIGDSSPLIRATVGILITTIASKGELQNWPDLL---PKLCSLLDSEDYNTCEGAFGALQKIC


                         .         .         .         +         .         .         .:280
query           QFHTPIYTTELEASCTMCIKILEGSTYELRCAVAKFTAQLLATSMKPPPGAVIKAKSNQTVPVRPASVTD
1u6gC           SRQGGLLVNFHPSILTCLLPQLTSPRLAVRKRTIIALGHLVMSCFVDLIEHLLSELSKNDSMSTTRTYIQ
1nzeA           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
1qbkB           EDSAEILDSDRPLNIPKFLQFFKHSSPKIRSHAVACVNQFIISRTQALXLNLFALAGDEEPEVR-KNVCR


                         .         *         .         .         .         .         +:350
query           TLNLLASGFLRGGIGGFLKGSSSTFSTMGRSDIRIGVSICYVEMVREMGSAWLEKHLIAVCCHMVDLASK
1u6gC           CIAAISRQAGHRIGEYLEKIIPLVVKFCNVDDLREYCIQAFESFVRRCPKEVYPHVSTIINICLKYLTYD
1nzeA           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
1qbkB           ALVXLLEVRMDRLLPHXHNIVEYXLQRTQDQDVALEACEFWLTLAEQPICKDVLVRHLPKLIPVLVNGXK


                         .         .         .         .         *         .         .:420
query           CGHLAYTQNASHVSEALTIRRCISFILRQTIGSLLGENAQTLACKHLGVLLSQYVDLVSIGTGDNLXXXX
1u6gC           MSWK---------------VRRAAAKCLDAVVSTRHEMLPEFYKTVSPALISRFKEREEN----------
1nzeA           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
1qbkB           YSDIDIILLKGDVEEDETIEQDIRPRFHRSRTVAQQHDERKCSAAALDVLANVYRDELLPHILPLLKELL


                         .         .         +         .         .         .         .:490
query           XXXXXXXXXAIIVILQEISVLVRQIGTSVMSLFTEATGIMEHIFKCLTHPLASARYAAAWCLRCIATAVP
1u6gC           -----VKADVFHAYLSLLKQTRPVGETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLP
1nzeA           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1qgkA           ----------------------------------------ITILEKTVSPDRLELEAAQKFLERAAVENL
1b3uA           ----------------------------------DSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALG
1qbkB           FHHEWVVKESGILVLGAIAEGCXQGXIPYLP------ELIPHLIQCLSDKKALVRSITCWTLSRYAHWVV


                         *         .         .         .         .         +         .:560
query           NLMTPLIDRCLPRLDQLSSSSRAISGFSMXXXXXXXXXXXXXXXGIPYAKPLKVLDLAEEMLRTSTQQPK
1u6gC           GALTQHIPVLVPGIIFSLNDKSSSSNLKIDALSCLYVILCNHSPQVFHPHVQALVPPVVACV--GDPFYK
1nzeA           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1qgkA           PTFLVELSRVLANPGNSQVARVAAGLQIKNSLTSKDPDIKAQYQQRWLAIDANARREVKNYVLHTLGTE-
1b3uA           V---ERTRSELLPFLTDTIYD-------------------------------------------------
1qbkB           SQPPDTYLKPLXTE--------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           LTIAKLESGWNLIYALIHLGPSVMKEHLPRVIKLWKAAFARSAKEAESENSRGDAFSWQCAMIAQAGALS
1u6gC           ITSEALLVTQQLVKVIRPLDQPSSFDATPYIKDLFTCTIKRLKAADIDQEVKERAISCMGQIICNLGDNL
1nzeA           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1qgkA           TYRPSSASQCVAGIACAEIPVNQWPELIPQLVANVTNPNSTEHMKESTLEAIGYICQDIDPEQLQDKSNE
1b3uA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           VMEAVASQPELSSTNNALDAMKVPIECSLVMMSQVGNLIKSYGNEMRQANSVVXXXXXXXXXXXPHKSFE
1u6gC           GSDLPNTLQIFLERLKNEITRLTTVPLKIDLRPVLGEGVPILASFLRKNQRALKLGTLSALDILIKNYSD
1nzeA           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1qgkA           ILTAIIQGMRKEEPSNNVKLAATNALLKESERHFIMQVVCEATQCPDTRVRVAALQNLVKIMSLYYQYME
1b3uA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           GSYAALLRELVADITLSDNSQSTLTTSLPISQFTGVEKILISPVYDATDYSMVEDLLQTPISSVSLGNIE
1u6gC           SLTAAMIDAVLDELPPLISESDMHVSQMAISFLTTLAKVYPSSLSKISGSILNELIGLVRSPLLQG---G
1nzeA           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1qgkA           TYMGPALFAITIEAMKSDIDEVALQGIEFWSNVCDEEMDLAIEASEAAEQGRPPEHTSKFYAKGALQYLV
1b3uA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           EDLSNLIRASASQIGDTWPENDSEPLTCLNTALLTYGKVFPLVNNKHKVQITEHFWDTIQKSKNAGRKQA
1u6gC           ALSAMLDFFQALVVTGTNNLGYMDLLRMLTGPVYSQTHKQSYYSIAKCVAALTRACPKEGPAVVGQFIQD
1nzeA           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1qgkA           PILTQTLT-------KQDENDDDDDWNPCKAAGVCLMLLATCCEDDIVPHVLPFIKEHIKNPDWRYRDAA
1b3uA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           ILVNALTAKLLSYKTLCEQRGHKLDNETLQRAXXXXXXXXXXXXCPMTRLVGAEALARLSQAVNSPPFVA
1u6gC           VKNSRSTDSIRLLALLSLGEVGHHIDLSGQLELKSVILEAFSSPSEEVKSAASYALGSISVGNLPEYLP-
1nzeA           ----------------------------------------------------------------------
2bkuB1          ---------------------------------------------QNIRLTSETQLKKLSNDNFLQFAGL
1qbkB           ---------------------------------------------TTIQRTVQQKLEQLNQYPDFNNYLI
1qgkA           VMAFGCILEGPEPSQLKPLVIQAMP----------TLIELMKDPSVVVRDTAAWTVGRICELLPEAAIND
1b3uA           -------------------------------------------------------------------GIR
1qbkB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           SIAQYCFDKLNSCKDEINRSGHVLALGCLHRHVGSLGSGQHLNTGVSVVLALAEESKMPKVQTCALVAMA
1u6gC           ------FVLQEITSQPKRQYLLLHSLKEIISSASVVGLKPYVENIWALLLKH-CECAEEGTRNVVAECLG
1nzeA           ----------------------------------------------------------------------
2bkuB1          SSQV----LIDENTKLEGRILAALTLKNELVSKDS----VKTQQFAQRWITQVSPEAKNQIKTNALTALV
1qbkB           FVLTKLKSE-----DEPTRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDS-SPLIRATVGILIT
1qgkA           VYLAPLLQCLIEGLSAEPASNVCWAFSSLQEEPATYCLSSSFELIVQKLLETTPDGHQNNLRSSAYESLM
1b3uA           QLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMA-WLVDHVYAIREAATSNLK
1qbkB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           LIAETGSGMFRVFVETTLSSCLKLLISTPTFVVDVVQGISKCLTALITCVGPELSCPGVIDGVRTSLLAA
1u6gC           KLTLIDPETLLPRLKGYLISGSS----------YARSSVVTAVKFTISD------HPQPIDPLLKNCIGD
1nzeA           ----------------------------------------------------------------------
2bkuB1          LIAAIADIELPHGAWPELMKIMVDNTGAEQPEN-VKRASLLALGYMCESADALVS-----SSNNILIAIV
1qbkB           TIASKGELQNWPDLLPKLCSLLDSE------DYNTCEGAFGALQKICEDSAEILDS----DRPLNIXIPK
1qgkA           EIVKNSAKDCYPAVQKTTLVIMERLQQVLQMESHIQSTSDRIQFNDLQSLLCAKVQHQDALQISDVVMAS
1b3uA           KLVEKFGKEWAHA-----TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMA---
1qbkB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           CAIQLSHSDPFVQAEAISGLQQMHLFAPRYVHMAQLVVDISSLLSSTHLVIRRQSVSCLRQLVQRESKEV
1u6gC           FLKTLEDPDLNVRRVALVTFNSAAHNKPSLILLDTVLPHLYNETKVRKELIREVEMGPFKHTVDDGLDIR
1nzeA           ----------------------------------------------------------------------
2bkuB1          QGAQSTETSKAVRLAALNALADSLIFIKNNMEREGERNYLMQATQAEDIEVQAAAFGCLCKIMSKYYTFM
1qbkB           FLQFFKHSSPKIRSHAVACVNQFIISRTQALHIDSFTENLFALAGDEEPEVRKNVCRALVXLLEVRMDRL
1qgkA           LLRMFQSTAGSGGLMAVSTLVEVLGGEFLKYMEAFKPFLGIGLKNYAEYQVCLAAVGLVGDLCRALQSNI
1b3uA           -----GDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLS-------
1qbkB           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           RNHAQVLVPQGIVDTNKKKFALPESGLEGALFGMLDTEVNKELRCHLQETLISLVQGTSGELLNNWLMLS
1u6gC           KAAFECMYTLLDSCLDRL---DIFEFLNHVEDGLKDHYDIKMLTFLMLVRLSTLCPSAVLQRLDRLVEPL
1nzeA           ----------------------------------------------------------------------
2bkuB1          KPY-------------------------------------------------------------------
1qbkB           LPHXHNIVEYXL----------------------------------------------------------
1qgkA           IPFC-------------------DEVMQLLLENLGNENVHRSVKPQILSVFGDIALAIGGEFKKYLEVVL
1b3uA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           KEILATSNDHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1u6gC           RATCTTKVK-------------------------------------------------------------
1nzeA           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1qgkA           NTLQQASQAQ------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:1330
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1u6gC           ----------------------------------------------------------------------
1nzeA           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:1400
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1u6gC           ----------------------------------------------------------------------
1nzeA           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:1470
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1u6gC           ----------------------------------------------------------------------
1nzeA           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:1540
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1u6gC           ----------------------------------------------------------------------
1nzeA           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:1610
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1u6gC           ----------------------------------------------------------------------
1nzeA           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:1680
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1u6gC           ----------------------------------------------------------------------
1nzeA           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1750
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1u6gC           ----------------------------------------------------------------------
1nzeA           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1820
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1u6gC           ----------------------------------------------------------------------
1nzeA           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1890
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1u6gC           ----------------------------------------------------------------------
1nzeA           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1960
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1u6gC           ----------------------------------------------------------------------
1nzeA           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:2030
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1u6gC           ----------------------------------------------------------------------
1nzeA           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1b3uA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:2100
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1u6gC           ----------------------------------------------
1nzeA           ----------------------------------------------
2bkuB1          ----------------------------------------------
1qbkB           ----------------------------------------------
1qgkA           ----------------------------------------------
1b3uA           ----------------------------------------------
1qbkB           ----------------------------------------------