[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cele0:AAN63415.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1gz5A.bssp"
#ERROR : Can't open dsspfile "2iv7A1.bssp"
#ERROR : Can't open dsspfile "2f9fA1.bssp"
#ERROR : Can't open dsspfile "2bisA1.bssp"
#ERROR : Can't open dsspfile "2bfwA1.bssp"
#ERROR : Can't open dsspfile "1c3jA.bssp"
#ERROR : Can't open dsspfile "1a14N.bssp"
#ERROR : Can't open dsspfile "2nzwA1.bssp"
#ERROR : Can't open dsspfile "1rzuA.bssp"
#ERROR : Can't open dsspfile "1f0kA.bssp"
#ERROR : Can't open dsspfile "1a8iA.bssp"

## Summary of PDB Search
:400
    3e-42   9%  1gz5A  [c.87.1.6] ALPHA-TREHALOSE-PHOSPHATE SYNTHASE
    4e-35  13%  2iv7A1 [c.87.1.8] LIPOPOLYSACCHARIDE CORE BIOSYNTHESIS PROTEIN A:2
    1e-30  33%  2f9fA1 [c.87.1.8] FIRST MANNOSYL TRANSFERASE (WBAZ-1) A:2 -- 167
    2e-22  22%  2bisA1 [c.87.1.8] GLGA GLYCOGEN SYNTHASE A:1 -- 437
    6e-22  23%  2bfwA1 [c.87.1.8] GLGA GLYCOGEN SYNTHASE A:218 -- 413
    1e-16  12%  1c3jA  [c.87.1.1] BETA-GLUCOSYLTRANSFERASE
    8e-15   8%  1a14N  [b.68.1.1] NEURAMINIDASE
    2e-14  13%  2nzwA1 [c.87.1.11] ALPHA1,3-FUCOSYLTRANSFERASE A:1 -- 349
    4e-13  19%  1rzuA  [c.87.1.8] GLYCOGEN SYNTHASE 1
    2e-06  12%  1f0kA  [c.87.1.2] UDP-N-ACETYLGLUCOSAMINE-N-ACETYLMURAMYL-
    3e-04  17%  1a8iA  [c.87.1.4] GLYCOGEN PHOSPHORYLASE B
:400

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxVTILHPDLGIGGAERLIVDAAVGLQDRGHSVRIFTNQYSRSHCFQETLDLDICTVVPWIPRSIFGKG
1gz5A           ------------SGETGNEDQPLKKVKKGNITWASFNLSEQDLDEYYNQFSNAVLWPAFHYRLDLVQFQR
2iv7A1          ---VAFCLYKYFFGGLQRDFXRIASTVAARGHHVRVYTQSWEGDCPKAFELIQVPVKSHTNHGRNAEY--
2f9fA1          ----------------------------------------------------------------------
2bisA1          ----------------------------------------------------------------------
2bfwA1          ----------------------------------------------------------------------
1c3jA           ----------------------------------------------------------------------
1a14N           ----------------------------------------------------------------------
2nzwA1          ----------------------------------------------------------------------
1rzuA           ----------------------------------------------------------------------
1f0kA           --------------------------LMAQGWQVRWLGTADRMEADLVPKHGIEIDFISGLRGKGIKALI
1a8iA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           HALCAYLKMIIAALYIVIYHKDTDVILSDSVSASQFVLRHFSKAKLVFYCHFPDRLLTKRDGNLKAFYRN
1gz5A           PAWDGYLRVLLADKLLPLLQDDDIIWIHDYHLLPFAHELRKRGNRIGFFLHLPTYDTLLEQLCDYDLLGF
2iv7A1          ----------YAWVQNHLKEHPADRVVGFNKXPGLDVYFAADVCYAEKVAQEKGFLYRLTSRYRHYAAFE
2f9fA1          ----------------------------------------------------------------------
2bisA1          -------------------------------------IKKYFKIPAVFTIHLPAFYFHEAGLSELAPYPD
2bfwA1          ----------------------------------------------------------------------
1c3jA           ----------------------------------------------------------------------
1a14N           ----------------------------------------------------------------------
2nzwA1          ----------------------------------------------------------------------
1rzuA           ----------------------------------------------------------------------
1f0kA           AAPLRIFNAWRQARAI-MKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTN---KWLAKI
1a8iA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IIDWIEEYTTGLADVICVNSNFTKNVVRETFKSLASQELTVLYPSLNTEFFDSIEASDDFGEEIPRGTKY
1gz5A           QTENDRLAFLDCLSNLTRVTTRSAKSHTAWGK---AFRTEVYPIGIEPKEIAGPLPPKLAQLKAELKNVQ
2iv7A1          RATFEQGK----STKLXXLTDKQIADFQKHYQ-TEPERFQILPPGIYPDRKYSEQIPNSREIYRQKEQQN
2f9fA1          ----------------------------------------------------------------------
2bisA1          ID--PEHTGGYIADIVTTVS---RGYLIDEWGFFRNFEITYVFNGIDCSFWNEDERKKSLLSKFGMDEGV
2bfwA1          ------------------------------------------------------------------EGVT
1c3jA           ---------------------------------------------------------NDFQLSKPTKKTL
1a14N           ----------------------------------------------------------------------
2nzwA1          ---------------------------------------------------------------------Y
1rzuA           ---------------------------------------------------------------IDDDGSP
1f0kA           ATKVMQAFPGAFPNAEVVGNPV-----RTDVLALPLPQ---------------------QRLAGREGPVR
1a8iA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VFTSLNRFERKKNIVLALDAFEKLKSNLPADEFSQCHLVIAGGYDLKNPENIEHYDELVEHMKKLELPAD
1gz5A           NIFSVERLDYSKGLPERFLAYEALLEKYP-QHHGKIRYTQIAGDVQAYQDIRHQLENEAGRINGKYGQLP
2iv7A1          LLLQVGSDFGRKGVDRSIEALASLPESLR-----HNTLLFVVGQD--------KPRKFEALAEKLGV---
2f9fA1          -WLSVNRIYPEKRIELQLEVFKKLQDE---------KLYIVGWFSKG--------DHAERYARKIKIAPD
2bisA1          TFMFIGRFDRQKGVDVLLKAIEILSSK---KEFQEMRFIIIGKGD-------PELEGWARSLE--EKHGN
2bfwA1          FMFIGRFDRGQKGVDVLLKAIEILSSKKEFQEM---RFIIIGKGDPELEG---------WARSLEEKHGN
1c3jA           DVIYGGSFRSGQRESKMVEFLFDTG----------LNIEFFG-----------NAREKQFKNPKYPWT-K
1a14N           -------------------------------------------------------------FNNLTKGLC
2nzwA1          KLKDNSLYALKKPSHCFKEKHPNLCAVVNDESDPLRGFASFVASNPNAPIRNAFYDAL---NSIEPVTGG
1rzuA           LFCVISRLTWQKGIDLMAEAVDEIVSL-------GGRLVVLGAGDVA----------LEGALLAAASRHH
1f0kA           VLVVGGSQGARILNQTMPQVAAKLGD--------SVTIWHQSGKG--------SQQSVEQAYAEAGQPQH
1a8iA           ------RIHEYKRQLLNCLHVITLYNRIKKEPNKFVVPRTPGYHMAKMIIKITAIGDVVNHDPVVGDR-L


                         .         *         .         .         .         .         +:350
query           QIVFLHSPSDTQKVNLIRRSRAVLYTPDREHFGIVPVEAMYLGTPVIAVNTGGPCESVRNNETGFLVDQT
1gz5A           LYYLNQHFDRKLLXKIFRYSDVGLVTPLRDGXNLVAKEYVAAQDPANPGVLVLSQFAGNELTSALIVNYD
2iv7A1          RSNVHFFSGRNDVSELXAAADLLLHPAYQEAAGIVLLEAITAGLPVLTTAVCGYAHYIADANCGTVIPFS
2f9fA1          NVKFLGSVSEEELIDLYSRCKGLLCTAKDEDFGLTPIEAXASGKPVIAVNEGGFKETVINEKTGYLVNAD
2bisA1          VKVITEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIASAVGGLRD-IITNETGILVKGD
2bfwA1          VKVITEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIASAVGGLRDII-TNETGILVKGD
1c3jA           APVFTGKIPMNMVSEKNSQAIAALINYNDNFITLRVWETMASDAVMLIDEEFDTKH-RIINDARFYVN-N
1a14N           TINSWHIYGKDNAVRIGEDSDVLVTREPYVSCDPDECRFYALTTIRGKHSNGTIHDRSQYRALISWPLSS
2nzwA1          GSVRNTLGNVKNKNEFLSQYKFNLCFENTQGYGYVTIDAYFSHTIPIYWGSPSVAKDFNPKSFVNVHDFK
1rzuA           GRVGVAIGYNEPLSHLMQAGCDAIIIPSREPCGLTQLYALRYGCIPVVARTGGLADTVSKAATGVQFSVT
1f0kA           KVT----EFIDDMAAAYAWADVVVCRSG----ALTVSEIAAAGLPALFVPFQHKALPLEKAGAAKIIEQS
1a8iA           RVIFLENYRVSLAEKVIPAADLSESTAGTEASGTGNMXFMLNGALTIGTMDGANVEMAEGEENFFIFGMR


                         .         .         .         .         *         .         .:420
query           AEAFAEKMIDLMKDEEMYRRMSEEGPKWVQKVFAFEAFARKLDEIIQSTL
1gz5A           RDEVAAALDRALTXSLAERISRHAEXLDVIVKNDINHWQECFISDLKQIV
2iv7A1          QEQLNEVLRKALTQSPLRXAWAENARHYADT-QDLYSLPEKAADIIT---
2f9fA1          VNEIIDAXKKVSKNPDKFKK------------------------------
2bisA1          PGELANAILKALESRSDLSKFRENCKKRAMS-FSWEKSAERYVKAYTGSI
2bfwA1          PGELANAILKALESRSDLSKFRENCKKRAMS-------------------
1c3jA           RAELIDRVNELKHSDVLRKEMLSIQHDILNKTRAWQDAFKKAIDL-----
1a14N           PPTVYNSRVECIGWSSTSCHDGKTRMSICISGPNNNASAV----------
2nzwA1          FDEAIDYIKYLHTHKNAYLDMLYENPLNTLDGKAYFYQNLSFKKILA---
1rzuA           LDGLKQRTVRYYHDPKLWTQMQKLG---MKSDVSWEKSAGLYAALYSQLI
1f0kA           VDAVANTLAGW--SRETLLTMAERARAASIP-DATERVANEVSRVARA--
1a8iA           VEDVDRLDQRGYNAQEYYDRIPE---------------------------