[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cele0:CAA21529.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1t72A.bssp"

## Summary of PDB Search
:180
    4e-04  19%  1t72A  [a.7.12.1] PHOSPHATE TRANSPORT SYSTEM PROTEIN PHOU
:180

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1t72A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEVDGKQSRKWAWSSEIKAHDDKYTLSAEFKKEGRS
1t72A           -----------------------------------ERXGDEAENIAERAILLAEEPPLKPYVNINFXSEI


                         +         .         .         .         .         *         .:210
query           GQGKITKSIGAYIDNDGEIIVPLVKKEVDDLYNRLIRxxx
1t72A           VKEXVNDSVISFIQQDTLLAKKVIEKTVDELYHQLER---