[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cele0:CAA21685.2

[Show Plain Result]

#ERROR : Can't open dsspfile "1fkmA2.bssp"
#ERROR : Can't open dsspfile "1fkmA1.bssp"

## Summary of PDB Search
:411
    2e-07  16%  1fkmA2 [a.69.2.1] PROTEIN (GYP1P) A:443 -- 630
    4e-04  24%  1fkmA1 [a.69.2.1] PROTEIN (GYP1P) A:249 -- 442
:411

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNALRNKREAIDRFLKKHRKEDLSLYID
1fkmA2          ----------------------------------------------------------------------
1fkmA1          -------------------------------------------NSIIQRISKFDNILKDKTIINQ----Q


                         .         .         *         .         .         .         .:140
query           ELRDFAISPGGLVDDEFRAVIWPVLSANLVQNXXXXXXXXXXXXXXXXXXXDFDEEPAYEESEELTLEDL
1fkmA2          ----------------------------------------------------------------------
1fkmA1          DLRQISW---NGIPKIHRPVVWKLLIGYLPVNTKRQEGFLQRKRKE------------YRDSLKHTFSDQ


                         +         .         .         .         .         *         .:210
query           KGHKEWNQVELDVHRTLSRFPPNISDTHRDVLQTELIPLIVRVLSINPRFNYYQGFHDICLTVLLVxxxx
1fkmA2          ----------------------------------------------------------------------
1fkmA1          RDIPTWHQIEIDIPRTNPHIPLYQFKSVQNSLQ--------RILYLHPASGYVQGINDLVTPFFET----


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxVVRELDLLYVILSRVDPSLEQVMRSVELGTMFGLSWPLTWFSHT
1fkmA2          --------------------------ILRQVKNLSQLVKRIDADLYNHFQNEHVEIQFAFRWXNCLLXRE
1fkmA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LKQYQQIVRFFDVFLASSPLLPIYXXXXXXXXXXXXILACEREMPFLHRLLTEMPHELPIDTIIKDSVYL
1fkmA2          F-QXGTVIRXWDTYLSSLNEFHVFVCAAFLIKWSDQLXEXDFQITFLQNPPTKDWTETDIEXLLSEAFIW
1fkmA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SKLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1fkmA2          QSL----------------------------------------------------------
1fkmA1          -------------------------------------------------------------