[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cele0:CAA86661.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1o6sA2.bssp"
#ERROR : Can't open dsspfile "1a9nA.bssp"
#ERROR : Can't open dsspfile "1fs2A2.bssp"
#ERROR : Can't open dsspfile "1g9uA.bssp"
#ERROR : Can't open dsspfile "1dceA3.bssp"
#ERROR : Can't open dsspfile "1xqrA1.bssp"
#ERROR : Can't open dsspfile "1lnsA1.bssp"
#ERROR : Can't open dsspfile "1uf2A.bssp"
#ERROR : Can't open dsspfile "2f5tX2.bssp"
#ERROR : Can't open dsspfile "1pgvA.bssp"
#ERROR : Can't open dsspfile "1fqvA2.bssp"
#ERROR : Can't open dsspfile "1fo1A1.bssp"
#ERROR : Can't open dsspfile "1d0bA.bssp"
#ERROR : Can't open dsspfile "1wlmA1.bssp"
#ERROR : Can't open dsspfile "1a4yA.bssp"
#ERROR : Can't open dsspfile "2fxtA1.bssp"

## Summary of PDB Search
:799
    3e-08  29%  1o6sA2 [c.10.2.1] INTERNALIN A A:36 -- 416
    2e-07  27%  1a9nA  [c.10.2.4] U2A'
    4e-07  10%  1fs2A2 [c.10.1.3] SKP2 A:146 -- 401
    1e-06  14%  1g9uA  [c.10.2.6] OUTER PROTEIN YOPM
    1e-06  19%  1dceA3 [c.10.2.2] PROTEIN (RAB GERANYLGERANYLTRANSFERASE ALPHA
    2e-06  14%  1xqrA1 [a.118.1.21] HSPBP1 PROTEIN A:87 -- 350
    1e-05  11%  1lnsA1 [a.40.2.1] X-PROLYL DIPEPTIDYL AMINOPETIDASE A:1 -- 145
    4e-05   7%  1uf2A  [e.28.1.2] CORE PROTEIN P3
    4e-05   9%  2f5tX2 [d.136.1.5] ARCHAEAL TRANSCRIPTIONAL REGULATOR TRMB X:110 --
    4e-05  12%  1pgvA  [c.10.1.1] TROPOMODULIN TMD-1
    4e-05  19%  1fqvA2 [c.10.1.3] SKP2 A:146 -- 431
    9e-05  19%  1fo1A1 [c.10.2.3] NUCLEAR RNA EXPORT FACTOR 1 A:203 -- 362
    2e-04  14%  1d0bA  [c.10.2.1] INTERNALIN B
    3e-04  11%  1wlmA1 [a.39.1.11] PROTEIN CGI-38 A:8 -- 145
    6e-04  17%  1a4yA  [c.10.1.1] RIBONUCLEASE INHIBITOR
    9e-04  11%  2fxtA1 [d.17.4.13] IMPORT INNER MEMBRANE TRANSLOCASE SUBUNIT TIM44
:799

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxIAELIENDALPEFDHKVIASCSNDIFEVLRQKKKLNHQTLQTMCS
1o6sA2          -------------------------INQIFTDTALAE---KMKTVLGTNVTDTVSQTDLDQVTTLQA---
1a9nA           ----------------------------------------------------------------------
1fs2A2          ----------------------------------------------------------------------
1g9uA           ----------------------------------------------------------------------
1dceA3          ----------------------------------------------------------------------
1xqrA1          ----------------------------------------------------------------------
1lnsA1          ----------------------------------------------------------------------
1uf2A           ----------------------------------------------------------------------
2f5tX2          ----------------------------------------------------------------------
1pgvA           ----------------------------------------------------------------------
1fqvA2          ----------------------------------------------------------------------
1fo1A1          ----------------------------------------------------------------------
1d0bA           ----------------------------------------------------------------------
1wlmA1          ----------------------------------------------------------------------
1a4yA           ----------------------------------------------------------------------
2fxtA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TSRFQINKIDLMGNKVELQDLELCSNQNLVSFRLGDIDYFPNTNKIQVADVLDTALNRTSRQQLRHLDLS
1o6sA2          -DRLGIKSIDGVEYLNNLTQINFSNNQLMNNNQIADITPLANLTNLTGLTLFNNQITDIDLTNLNRLELS
1a9nA           ------------------------------------------------AELIEQAAQYTNAVRDRELDLR
1fs2A2          ----------------------------------------------------------------------
1g9uA           -------------------------------------------------------------SFLKIIDVD
1dceA3          ----------------------------------------------------------------RVLHLA
1xqrA1          ----------------------------------------------------------------------
1lnsA1          -------------------------------------------------------------AELDQLGFR
1uf2A           ----------------------------------------------------------------------
2f5tX2          -------------------------------------------------------------MFRESLYSA
1pgvA           -----------------------------------------------VESCINRLREDDTD--LKEVNIN
1fqvA2          ---------------------------------------------------------------WQTLDLT
1fo1A1          ---------------------------------------------------LKLIMSKRYDGSQQVLDLK
1d0bA           -----------------------------------------------------------------TITVS
1wlmA1          ----------------------------------------------------------------------
1a4yA           ----------------------------------------------------------------------
2fxtA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GRHRITSNWPTYVARKLPRLESLAFANRSTANETLSQIGASLLNLRFLDISSTCVTDISCISSLRNLEVL
1o6sA2          S-NTISDISA---LSGLTSLQQLSFGNQVTDLKPL----ANLTTLERLDISSNKVSDISVLAKLTNLESL
1a9nA           GY-------------KIPVIENL---------------GATLDQFDAIDFSDNEIRKLDGFPLLRRLKTL
1fs2A2          ----------------ITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDQEFFQLNYLQHL
1g9uA           NSLKKLPDLPPSLEFIAPELQNLFLTAIYADNNSLKKLPDLPLSLESIVAGNNILEELPELQNLPFLTTI
1dceA3          HK-DLTVLCHL---EQLLLVTHLDLSHNRL--RALPPALAALRCLEVLQASDNALENVDGVANLPRLQEL
1xqrA1          ----------------------------------------------------------------------
1lnsA1          WSVFWDEKQSPSDMTALQATAELDVIEFLKSSIELDWEIFWNIALQLLDFVPNFDFEI--GKAFEYAKNS
1uf2A           ------------------------------------------IPLSKIGLQDKKLFDINVIKCGSSLRIV
2f5tX2          K-NEVIVVTPSEFFETIREDLIKTLERGVTVSLYIDKIPDLNFFVRQFYKLNHLIGMTKEVVTIQNATFD
1pgvA           NMKRVSKERIRSLIEAACNSKHIEKFSLANTARGLIELIETSPSLRVLNVESNFLTPLRSTLVTQSIVEF
1fqvA2          GKNLHPD-----VTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKL
1fo1A1          GLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDM----SSIVQKAPNLKIL
1d0bA           TP-IKQIFPD----DAFAETIKD---NLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVTKL
1wlmA1          ---------------------------------------AASTDIAGLEESFRKFAIHGDPKASGQEMNG
1a4yA           -------------------------------------------DIQSLDIQCEELSDAELLPLLQQCQVV
2fxtA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IMYNLNILKGDVTETLSNLTKLRVLDISRKVNTDYLQETSQDAHLDLALGIYNRSVEAIESGTATPWAEL
1o6sA2          IATNNQISD---ITPLGILTNLDELSLN------------------------------------------
1a9nA           LVNNNRICRIGLDQALPDLTELILTNLVELGDLDPLASLKSLTYLCI-----------------------
1fs2A2          SLSRCYDIIPETLLELGEIPTLKTLQVFG-----------------------------------------
1g9uA           YADNNLLK--TLPDLPPSLEALNVRDNYLTDLPELPQSLTFLDVSENIFSGLS-----------------
1dceA3          LLCNNRLQQSAAIQPLVSCPRLVLLNLQ------------------------------------------
1xqrA1          ----------------------------------------------------------------------
1lnsA1          NLPQIEAE-MTTENIISAFYYLLCT---------------------------------------------
1uf2A           DEPQVTFIVSYAKDIYDKFMCIEHDSAYEPSLTMHRVRVIYSMLNDYCAKMISEVPYESSFVGELPVKSV
2f5tX2          SIGP-PSFKSTYPEIIFSQYSLIIEIFK------------------------------------------
1pgvA           KADNQRQSVMDMMMAIEENESLLRVGIS------------------------------------------
1fqvA2          QNLSLLRLSDPIVNTLAKNSNLVRLNLSGCSGFSE-----------------------------------
1fo1A1          NLSG-NELKSERELDKIKGLKLEELWLDG-----------------------------------------
1d0bA           FLNGNKLTD---IKPLTNLKNLGWLFLD------------------------------------------
1wlmA1          KNWAKLCKDVDIVFSKVKAKSARVIN--------------------------------------------
1a4yA           RLDDCGLRCKDISSALRVNPALAELNLRSNELGDVG----------------------------------
2fxtA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RAIDMSGLSIxxxxxxxxxxFVEKIIEAHPKLEQISLLATPLDSSLIEIPNRNLQVINTVSRRSIIFALS
1o6sA2          ----------------------------------------------------------------------
1a9nA           ----------------------------------------------------------------------
1fs2A2          ----------------------------------------------------------------------
1g9uA           ----------------------------------------------------------------------
1dceA3          ----------------------------------------------------------------------
1xqrA1          ----------------------------------------------------------------------
1lnsA1          ----------------------------------------------------------------------
1uf2A           TLNKLGDRNM------------------------------------------------------------
2f5tX2          ----------------------------------------------------------------------
1pgvA           ----------------------------------------------------------------------
1fqvA2          ----------------------------------------------------------------------
1fo1A1          ----------------------------------------------------------------------
1d0bA           ----------------------------------------------------------------------
1wlmA1          ----------------------------------------------------------------------
1a4yA           ----------------------------------------------------------------------
2fxtA1          --------------------LIVVMRKITNKVGGFFA-ETESSRVYSQFKLMD-----------------


                         .         .         .         .         *         .         .:420
query           HYANLDRPAFITHALHSVYYQLQSGYDKFSQEELKECLRLVCISMQxxxxxxxxxxxxxxxxxxxxxxxx
1o6sA2          ----------------------------------------------------------------------
1a9nA           ----------------------------------------------------------------------
1fs2A2          ----------------------------------------------------------------------
1g9uA           ----------------------------------------------------------------------
1dceA3          ----------------------------------------------------------------------
1xqrA1          ----------------------------------------------------------------------
1lnsA1          ----------------------------------------------------------------------
1uf2A           ----------------------------------------------------------------------
2f5tX2          ----------------------------------------------------------------------
1pgvA           ----------------------------------------------------------------------
1fqvA2          ----------------------------------------------------------------------
1fo1A1          ----------------------------------------------------------------------
1d0bA           ----------------------------------------------------------------------
1wlmA1          ----------------------------------------------------------------------
1a4yA           ----------------------------------------------------------------------
2fxtA1          --PTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFEAPFNVYA------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1o6sA2          ----------------------------------------------------------------------
1a9nA           ----------------------------------------------------------------------
1fs2A2          ----------------------------------------------------------------------
1g9uA           ----------------------------------------------------------------------
1dceA3          ----------------------------------------------------------------------
1xqrA1          ----------------------------------------------------------------------
1lnsA1          ----------------------------------------------------------------------
1uf2A           ----------------------------------------------------------------------
2f5tX2          ----------------------------------------------------------------------
1pgvA           ----------------------------------------------------------------------
1fqvA2          ----------------------------------------------------------------------
1fo1A1          ----------------------------------------------------------------------
1d0bA           ----------------------------------------------------------------------
1wlmA1          ----------------------------------------------------------------------
1a4yA           ----------------------------------------------------------------------
2fxtA1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSALW
1o6sA2          ----------------------------------------------------------------------
1a9nA           ----------------------------------------------------------------------
1fs2A2          ----------------------------------------------------------------------
1g9uA           ----------------------------------------------------------------------
1dceA3          ----------------------------------------------------------------------
1xqrA1          -----------------------------------------------------------------LELLA
1lnsA1          ----------------------------------------------------------------------
1uf2A           ----------------------------------------------------------------------
2f5tX2          ----------------------------------------------------------------------
1pgvA           ----------------------------------------------------------------------
1fqvA2          ----------------------------------------------------------------------
1fo1A1          ----------------------------------------------------------------------
1d0bA           ----------------------------------------------------------------------
1wlmA1          ----------------------------------------------------------------------
1a4yA           ----------------------------------------------------------------------
2fxtA1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           NLTDECPATCKAFLDAGGVQIAFRILKAFDYHGNVQTKVLGILNNLAEVEELHLGQLCKNEYISVLISCL
1o6sA2          ----------------------------------------------------------------------
1a9nA           ----------------------------------------------------------------------
1fs2A2          ----------------------------------------------------------------------
1g9uA           ----------------------------------------------------------------------
1dceA3          ----------------------------------------------------------------------
1xqrA1          DLCENXDNAADFCQLSGXHLLVGRYLE--AGAAGLRWRAAQLIGTCSQNVAAIQEQVLGLGALRKLLRLL
1lnsA1          ----------------------------------------------------------------------
1uf2A           ----------------------------------------------------------------------
2f5tX2          ----------------------------------------------------------------------
1pgvA           ----------------------------------------------------------------------
1fqvA2          ----------------------------------------------------------------------
1fo1A1          ----------------------------------------------------------------------
1d0bA           ----------------------------------------------------------------------
1wlmA1          ----------------------------------------------------------------------
1a4yA           ----------------------------------------------------------------------
2fxtA1          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           DGSFNEVDSKGRYREVERSYFAAGILANLLTNTDGWESENQRDEACEKLLELIEQxxxxxxxxxxxxxxx
1o6sA2          ----------------------------------------------------------------------
1a9nA           ----------------------------------------------------------------------
1fs2A2          ----------------------------------------------------------------------
1g9uA           ----------------------------------------------------------------------
1dceA3          ----------------------------------------------------------------------
1xqrA1          D---RDACDTVRVK-------ALFAISCLVREQEAGLLQFLRLDGFSVLXRAXQQ---------------
1lnsA1          ----------------------------------------------------------------------
1uf2A           ----------------------------------------------------------------------
2f5tX2          ----------------------------------------------------------------------
1pgvA           ----------------------------------------------------------------------
1fqvA2          ----------------------------------------------------------------------
1fo1A1          ----------------------------------------------------------------------
1d0bA           ----------------------------------------------------------------------
1wlmA1          ----------------------------------------------------------------------
1a4yA           ----------------------------------------------------------------------
2fxtA1          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1o6sA2          ----------------------------------------------------------------------
1a9nA           ----------------------------------------------------------------------
1fs2A2          ----------------------------------------------------------------------
1g9uA           ----------------------------------------------------------------------
1dceA3          ----------------------------------------------------------------------
1xqrA1          ----------------------------------------------------------------------
1lnsA1          ----------------------------------------------------------------------
1uf2A           ----------------------------------------------------------------------
2f5tX2          ----------------------------------------------------------------------
1pgvA           ----------------------------------------------------------------------
1fqvA2          ----------------------------------------------------------------------
1fo1A1          ----------------------------------------------------------------------
1d0bA           ----------------------------------------------------------------------
1wlmA1          ----------------------------------------------------------------------
1a4yA           ----------------------------------------------------------------------
2fxtA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1o6sA2          -----------------------------
1a9nA           -----------------------------
1fs2A2          -----------------------------
1g9uA           -----------------------------
1dceA3          -----------------------------
1xqrA1          -----------------------------
1lnsA1          -----------------------------
1uf2A           -----------------------------
2f5tX2          -----------------------------
1pgvA           -----------------------------
1fqvA2          -----------------------------
1fo1A1          -----------------------------
1d0bA           -----------------------------
1wlmA1          -----------------------------
1a4yA           -----------------------------
2fxtA1          -----------------------------