[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cele0:CAA93431.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1nw1A.bssp"
#ERROR : Can't open dsspfile "1mruA.bssp"
#ERROR : Can't open dsspfile "1nd4A.bssp"
#ERROR : Can't open dsspfile "1b6cB.bssp"
#ERROR : Can't open dsspfile "1ia8A.bssp"
#ERROR : Can't open dsspfile "1yvpA1.bssp"
#ERROR : Can't open dsspfile "2oi8A2.bssp"
#ERROR : Can't open dsspfile "1tklA.bssp"
#ERROR : Can't open dsspfile "1t4hA.bssp"
#ERROR : Can't open dsspfile "1zkeA1.bssp"
#ERROR : Can't open dsspfile "1ckiA.bssp"
#ERROR : Can't open dsspfile "1fo8A.bssp"
#ERROR : Can't open dsspfile "1zelA2.bssp"
#ERROR : Can't open dsspfile "1a06A.bssp"
#ERROR : Can't open dsspfile "1djnA2.bssp"
#ERROR : Can't open dsspfile "1zylA1.bssp"
#ERROR : Can't open dsspfile "1gngA.bssp"
#ERROR : Can't open dsspfile "1r6fA.bssp"
#ERROR : Can't open dsspfile "1apmE.bssp"
#ERROR : Can't open dsspfile "1uwhA.bssp"
#ERROR : Can't open dsspfile "1howA.bssp"
#ERROR : Can't open dsspfile "1v30A.bssp"
#ERROR : Can't open dsspfile "1tkiA.bssp"

## Summary of PDB Search
:305
    1e-13  11%  1nw1A  [d.144.1.8] CHOLINE KINASE (49.2 KD)
    2e-11  24%  1mruA  [d.144.1.7] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB
    8e-11  12%  1nd4A  [d.144.1.6] AMINOGLYCOSIDE 3'-PHOSPHOTRANSFERASE
    2e-10  11%  1b6cB  [d.144.1.7] TGF-B SUPERFAMILY RECEPTOR TYPE I
    4e-10  22%  1ia8A  [d.144.1.7] CHK1 CHECKPOINT KINASE
    8e-10  10%  1yvpA1 [a.118.25.1] 60-KDA SS-A/RO RIBONUCLEOPROTEIN A:5 -- 363
    3e-07  13%  2oi8A2 [a.121.1.1] PUTATIVE REGULATORY PROTEIN SCO4313 A:87 -- 216
    3e-07   6%  1tklA  [d.248.1.1] COPROPORPHYRINOGEN III OXIDASE
    2e-06  20%  1t4hA  [d.144.1.7] SERINE/THREONINE-PROTEIN KINASE WNK1
    2e-06  25%  1zkeA1 [a.30.6.1] HYPOTHETICAL PROTEIN HP1531 A:1 -- 79
    4e-06  16%  1ckiA  [d.144.1.7] CASEIN KINASE I DELTA
    9e-06  10%  1fo8A  [c.68.1.10] ALPHA-1,3-MANNOSYL-GLYCOPROTEIN BETA-1,2-N-
    2e-05  16%  1zelA2 [d.377.1.1] HYPOTHETICAL PROTEIN RV2827C A:83 -- 294
    6e-05  34%  1a06A  [d.144.1.7] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE
    1e-04  19%  1djnA2 [c.3.1.1] TRIMETHYLAMINE DEHYDROGENASE A:490 -- 645
    2e-04  13%  1zylA1 [d.144.1.6] HYPOTHETICAL PROTEIN YIHE A:4 -- 328
    2e-04  16%  1gngA  [d.144.1.7] GLYCOGEN SYNTHASE KINASE-3 BETA
    2e-04  10%  1r6fA  [e.46.1.1] VIRULENCE-ASSOCIATED V ANTIGEN
    2e-04  25%  1apmE  [d.144.1.7] CAMP-DEPENDENT PROTEIN KINASE
    4e-04  17%  1uwhA  [d.144.1.7] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    5e-04  30%  1howA  [d.144.1.7] SERINE/THREONINE-PROTEIN KINASE YMR216C
    5e-04   5%  1v30A  [d.269.1.1] HYPOTHETICAL UPF0131 PROTEIN PH0828
    6e-04  42%  1tkiA  [d.144.1.7] TITIN
:305

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxQLPVGSECGKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEV
1nw1A           -----------------ESVIFTLLSERHLGPKLYGIFSGGRLEEYIPSRPLSCHEISLAHMSTKIAKRV
1mruA           -----------------RYELGEILGFGGMSEVHLARDLRLHRAVKVLRADLARDPSFYLRFEAQNAAAL
1nd4A           --------------------RLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLSSHLAPAEKVSI
1b6cB           -----------------TIVLQESIGKGRFGEVWRGKWR-GEEVAVKIFSSREERSWFREAEQTVMLRHE
1ia8A           -----------------DWDLVQTLGEGAYGEVQLAVNRVT-EEAVAVKI------VDMKRCPENIKKEI
1yvpA1          ------------------YIEEKKLGQENAEALLRLIEDGKGCE-VVQEIKTFSQEGRAAKQEPTLFALA
2oi8A2          ----------------------------------------------------------------------
1tklA           ---------------KADHKNLRLPEDPKTGLPVTD-GVKFFACGLSMVIHPVNPHAPTTHLNYRYFETW
1t4hA           ----------------------IEIGRGSFKTVYKGLDTETTVEVAWCELKLTKSERQRFKEEAEXLKGL
1zkeA1          ----------------------------------------------------------------------
1ckiA           ----------------NRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ
1fo8A           ----------------------------------------------------------------------
1zelA2          ----------------------------------------------------------------------
1a06A           -----------------IYDFRDVLGTGAFSEVILAEDKRTQKL-VAIKC--------------------
1djnA2          ----------------------------------------------------------------------
1zylA1          ----------------------------------------------------------------------
1gngA           --------QGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDS-GELVAIKKVLQDKRFKNRELQIMRKLDH
1r6fA           ----------------------------------------------------------------------
1apmE           -------------AQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVV--KLKQIEHTLNEK
1uwhA           ----------------GQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTA-------PTPQQLQAFKNE
1howA           ----------------ARYILVRKLGWGHFSTVWLAKDM-------------------------------
1v30A           ----------------------------------------------------------------------
1tkiA           -----------------KYMIAEDLGRGEFGIVHRC----------------------------------


                         .         .         *         .         .         .         .:140
query           KKQKIVGRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLHNIG
1nw1A           AKVHQLEVPIWKEPDYLCEALQRWLKQLTGTAEHRFDLPEECGVSVNCLDLARELEFLRAHISLSKSPVT
1mruA           NHPAIVAVYDTGEAETPAGP--LPYIVMEYVGVTLRDIVHT--EGPMTPKRAIEVIADACQALNFSHQNG
1nd4A           MADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQGLAPAELFARLKARMPDGEDLV
1b6cB           NILGFI-AADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGKLALSTASGLAHLHMEIVGTQGKPA
1ia8A           CINKMLNHENVVKFYGHRREGNIQYLFLEYC-SGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVYLHGIG
1yvpA1          VCSQCSDIKTKQAAFRAVPEVCRIPTHLFTFGMKCGMWGRALRKAVSDWYNTKDALNLAMAVTKYKQRNG
2oi8A2          ----------------------------------------------------AGLAHALRAALDDPQRYF
1tklA           NQDGTPQTWWFGGGADLTPSYLYEEDGQLFHQLHKDALDKHDTALYPRFKKWCDEYFYITHRKETRGIGG
1t4hA           QHPNIV--RFYDSWESTVKGKKCIVLVTELXTSGTLK-TYLKRFKVXKIKVLRSWCRQILKGLQFLRTPP
1zkeA1          ------------------------EMLLKLANLSLGDIEIKRGSMDMPKGVNEAFFTQLSEEVERLKELI
1ckiA           GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEY--------IHSK
1fo8A           -------PILVIACDRSTVRRCL-DKLLHYRSAELFPIIV---SQDCGHEETAQVIASYGSAVTHIRQPD
1zelA2          -----------------------------------------------------------------LPLRS
1a06A           ----------------------------------------------------------------------
1djnA2          ------------------------EQVMDGKKKGKRVVILNAYFMAPSLAEKLATAGHEVTIVSGVHLAN
1zylA1          ------------------------------------------------------LIAAVTAHWREDFTVL
1gngA           CNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFG
1r6fA           ----------------------------------------------------------------------
1apmE           RILQAVNFPFLVKLEFSFKDNSNLYMVMEYV-AGGEMFSHLRRIGRFAEPHARFYAAQIVLTFEYLHSLD
1uwhA           VGVLRKTRHVNILLFMGYSTAPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKS
1howA           ----------------------------------------------------------------------
1v30A           ----------------------------------------------------------------------
1tkiA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           FLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKYAPLACHIQREQCR
1nw1A           FCHNDLQEGNILLPKRLV-----LIDFEYASYNYRAFDFANHFI-----EWTIDYDIDEAPFYKIQTENF
1mruA           IIHRDVKPANIMISATNAV-----KVMDFGIARAI------------------TAQYLSPEQARGDSVDA
1nd4A           VTHGDACLPNIMV-----ENGRFSGFIDCGRLGVADRY--------------------------------
1b6cB           IAHRDLKSKNILVKKN-GTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFK
1ia8A           ITHRDIKPENLLLDERDNL-----KISDFGLATVFRYNNRERLLNKMCGTLP---YVAPELLKRREFHAE
1yvpA1          WSHKDLLRLSHIKPANEGLTMVAKYVSKGWKEVQEAYKE---KELSPETEKVLKYLEATERVKRTKDELE
2oi8A2          LIFGTPVPGYRAPDDITEIAAE---TXAVIVDACAAGTDGAFDAHLDTHRQ-----WADRP--APSSAHR
1tklA           IFFDDYDERDP-----QEILKMVEDCFDAFLPSYLTIVK------RRKDMPYTKEEQQWQAIRRGRYVEF
1t4hA           IIHRDLKCDNIFITGPTGS---------------------------------------------------
1zkeA1          NALNKIKKGL------------------------------------------------------------
1ckiA           NFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSR
1fo8A           LSNIAVQPDHR----KFQGYYKIARHYRWALGQIF-----------------------------------
1zelA2          WLARDQNAGFMLAGASAA-----WHLGYLDRQPDGRIPI---WLPPAKRLPDGLASYVSVVRIP------
1a06A           ----------------------------------------------------------------------
1djnA2          YMHFTLEYPNMMRRLHELH----VEELGDHFCSRIEPGRMEIYNIWGDGSKRT--YRGP--GVSPRDANS
1zylA1          RLHGDCHAGNILW-----RDGPMFVDLDDARNGPAVQDLWMLLN-----GDKAEQRMQLIEAYEEFSEFD
1gngA           ICHRDIKPQNLLLDPDTAV----LKLCDFGSAKQL------VRGEPNVSXICSRYYRAPELIFGATDYTS
1r6fA           -----------------------------------------------------ELRAFMAVMHFSLTADR
1apmE           LIYRDLKPENLLIDQQGYI---------------------------------------------------
1uwhA           IIHRDLKSNNIFLHEDLTVKIGDFGLATVLSGSIL------------------WMAPEVIRMQDKNPYSF
1howA           ----------------------------------------------------------------------
1v30A           ---------------------------GKPLHWYLKGAKFLGED----WIEGYQLYFEYLPYAVKGKGKL
1tkiA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KDDIESWLYMVVEMTCGRLPWRNLTESDDVGVFKKECKTTRLRCLFGGCPREFTEVFPILDKGKFFDAPE
1nw1A           PENDQMLEFFLNYLREQGNTREN-----------------------------------------------
1mruA           RSDVYSLGCVLYEVLTGEPPFTGDSPVS------------------------------------------
1nd4A           ----------------------------------------------------------------------
1b6cB           RADIYAMGLVFWEIARRCSIGGIHEDYQ------------------------------------------
1ia8A           PVDVWSCGIVLTAMLAGELPWDQPSDS-------------------------------------------
1yvpA1          IIHLIDEYRLVREHLLTIHLK-------------------------------------------------
2oi8A2          ALSFWSRLHGVLLELAGQFTGXGFDSAL------------------------------------------
1tklA           NLIYDRGTQFGLRTPGSRVESILMSLPEHASW--------------------------------------
1t4hA           ----------------------------------------------------------------------
1zkeA1          ----------------------------------------------------------------------
1ckiA           RDDLESLGYVLMYFNLGSLPWQGLKYER----ISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPD
1fo8A           ----------------------------------------------------------------------
1zelA2          ----------------------------------------------------------------------
1a06A           ----------------------------------------------------------------------
1djnA2          HRWIEF---DSLVLVTGR----------------------------------------------------
1zylA1          TAEIGLIEPLRAMRLVYYLAW-------------------------------------------------
1gngA           SIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPN-------------------
1r6fA           IDDDIL--KVIVDSMNHHGDARSKLREEELKIYSAEINKHTINIHDKSINLMDKNLYGYTDEEIFKASAE
1apmE           ----------------------------------------------------------------------
1uwhA           QSDVYAFGIVLYELMTGQLPYSNINRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPL
1howA           ----------------------------------------------------------------------
1v30A           KVEVYEVDKETFERINEIEIG-------------------------------------------------
1tkiA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YTTIYELLEKAMVNTKSNEFPYDWE
1nw1A           -------------------------
1mruA           -------------------------
1nd4A           -------------------------
1b6cB           -------------------------
1ia8A           -------------------------
1yvpA1          -------------------------
2oi8A2          -------------------------
1tklA           -------------------------
1t4hA           -------------------------
1zkeA1          -------------------------
1ckiA           YSYLRQLFRNLFHRQGSYDYVFDWN
1fo8A           -------------------------
1zelA2          -------------------------
1a06A           -------------------------
1djnA2          -------------------------
1zylA1          -------------------------
1gngA           -------------------------
1r6fA           YKILEKMPQTTIQVDSEKKIVSIKD
1apmE           -------------------------
1uwhA           FPQILASIEL---------------
1howA           -------------------------
1v30A           -------------------------
1tkiA           -------------------------