[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cele0:CAB01696.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2ic8A1.bssp"

## Summary of PDB Search
:245
    1e-07  18%  2ic8A1 [f.51.1.1] PROTEIN GLPG A:91 -- 272
:245

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxIPIVTRYWFLASTIIPLLGRFGFINVQWMFLQWDLVVNKFQFWRPLTALIYYPVTPQTGFH
2ic8A1          ---------AGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFPTLKFEFWRYFTHALMH----FSLMH


                         .         .         *         .         .         .         .:140
query           WLMMCYFLYNYSKALESETYRGRSADYLFMLIFNWFFCSGLCMALDIYFLLEPMVISVLYVWCQVNKDTI
2ic8A1          ILFNLLWWWYLGGAVEKRLGSGKLIVITLISALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQ


                         +         .         .         .         .         *         .:210
query           VSFWFGMRFPARYLPWVLWGFNAVLRGGGTNELVGILVGHAYFFVALKxxxxxxxxxxxxxxxxxxxxxx
2ic8A1          SGIYLQRGLIIFALIWIVAGWFDLFGMSMANGIAGLAVGLAMAFVDSL----------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ic8A1          -----------------------------------