[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cglu2:BAF52967.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ei1A.bssp"
#ERROR : Can't open dsspfile "2zjtA.bssp"
#ERROR : Can't open dsspfile "1kijA.bssp"
#ERROR : Can't open dsspfile "1s16A.bssp"
#ERROR : Can't open dsspfile "3fofD.bssp"
#ERROR : Can't open dsspfile "3foeD.bssp"
#ERROR : Can't open dsspfile "3foeC.bssp"
#ERROR : Can't open dsspfile "3fofC.bssp"
#ERROR : Can't open dsspfile "1kznA.bssp"
#ERROR : Can't open dsspfile "1aj6A.bssp"
#ERROR : Can't open dsspfile "1s14B.bssp"
#ERROR : Can't open dsspfile "1s14A.bssp"
#ERROR : Can't open dsspfile "3cwvA.bssp"
#ERROR : Can't open dsspfile "2rgrA.bssp"
#ERROR : Can't open dsspfile "1bgwA.bssp"
#ERROR : Can't open dsspfile "3cwvB.bssp"
#ERROR : Can't open dsspfile "1pvgB.bssp"
#ERROR : Can't open dsspfile "1pvgA.bssp"
#ERROR : Can't open dsspfile "1bjtA.bssp"
#ERROR : Can't open dsspfile "1qzrB.bssp"
#ERROR : Can't open dsspfile "1qzrA.bssp"
#ERROR : Can't open dsspfile "1zxnD.bssp"
#ERROR : Can't open dsspfile "1zxnB.bssp"
#ERROR : Can't open dsspfile "1zxnA.bssp"
#ERROR : Can't open dsspfile "1zxmB.bssp"
#ERROR : Can't open dsspfile "1zxmA.bssp"

## Summary of PDB Search
:684
    2e-80  44%  1ei1A  [d.122.1 - d.14.1] DNA GYRASE B
    2e-76  78%  2zjtA  [x.x.x] DNA GYRASE SUBUNIT B
    3e-64  43%  1kijA  [d.122.1 - d.14.1] DNA GYRASE SUBUNIT B
    2e-59  38%  1s16A  [d.122.1 - d.14.1] TOPOISOMERASE IV SUBUNIT B
    2e-49  55%  3fofD  [x.x.x] DNA TOPOISOMERASE 4 SUBUNIT B
    6e-48  55%  3foeD  [x.x.x] DNA TOPOISOMERASE 4 SUBUNIT B
    1e-47  55%  3foeC  [x.x.x] DNA TOPOISOMERASE 4 SUBUNIT B
    2e-46  54%  3fofC  [x.x.x] DNA TOPOISOMERASE 4 SUBUNIT B
    1e-34  48%  1kznA  [d.122.1] DNA GYRASE SUBUNIT B
    3e-32  44%  1aj6A  [x.x.x] GYRASE
    9e-25  42%  1s14B  [d.122.1] TOPOISOMERASE IV SUBUNIT B
    4e-20  40%  1s14A  [d.122.1] TOPOISOMERASE IV SUBUNIT B
    1e-19  29%  3cwvA  [x.x.x] DNA GYRASE, B SUBUNIT, TRUNCATED
    4e-14  31%  2rgrA  [x.x.x] DNA TOPOISOMERASE 2
    1e-12  37%  1bgwA  [x.x.x] TOPOISOMERASE
    2e-10  29%  3cwvB  [x.x.x] DNA GYRASE, B SUBUNIT, TRUNCATED
    6e-07  28%  1pvgB  [d.122.1 - d.14.1] DNA TOPOISOMERASE II
    6e-07  28%  1pvgA  [d.122.1 - d.14.1] DNA TOPOISOMERASE II
    1e-06  36%  1bjtA  [x.x.x] TOPOISOMERASE II
    3e-05  28%  1qzrB  [d.122.1 - d.14.1] DNA TOPOISOMERASE II
    3e-05  28%  1qzrA  [d.122.1 - d.14.1] DNA TOPOISOMERASE II
    6e-04  27%  1zxnD  [x.x.x] DNA TOPOISOMERASE II, ALPHA ISOZYME
    6e-04  27%  1zxnB  [x.x.x] DNA TOPOISOMERASE II, ALPHA ISOZYME
    6e-04  27%  1zxnA  [x.x.x] DNA TOPOISOMERASE II, ALPHA ISOZYME
    6e-04  27%  1zxmB  [x.x.x] DNA TOPOISOMERASE II, ALPHA ISOZYME
    6e-04  27%  1zxmA  [x.x.x] DNA TOPOISOMERASE II, ALPHA ISOZYME
:684

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxYDASSITILEGLEAVRKRPGMYIGSTGPRGLHHLIWEVVDNSVDEAMAGHATKVEVTLLEXXX
1ei1A           --------DSSSIKVLKGLDAVRKRPGMYIGDTDDTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNS
2zjtA           ----------------------------------------------------------------------
1kijA           -----------AIRVLKGLEGVRHRPAMYIGGTGVEGYHHLFKEILDNAVDEALAGYATEILVRLNEDGS
1s16A           -------YNADAIEVLTGLEPVRRRPGMYTDTTRP---NHLGQEVIDNSVDEALAGHAKRVDVILHADQS
3fofD           ----------------------------------------------------------------------
3foeD           ----------------------------------------------------------------------
3foeC           ----------------------------------------------------------------------
3fofC           ----------------------------------------------------------------------
1kznA           -----------------GLDAVRKRPGMYIGDTDDTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNS
1aj6A           --------------VLKGLDAVRKRPGMYIGDTDDTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNS
1s14B           -------------------EPVRRRPGMYTDTTRP---NHLGQEVIDNSVDEALAGHAKRVDVILHADQS
1s14A           --------------------------------------NHLGQEVIDNSVDEALAGHAKRVDVILHADQS
3cwvA           ------------------VENVRKRPGMYCGDVGEYGLHHLVYFLLDVAYEEARRGECRDVVLEVGGDGS
2rgrA           ----------------------------------------------------------------------
1bgwA           ----------------------------------------------------------------------
3cwvB           ------------------VENVRKRPGMYCGDVGEYGLHHLVYFLLDVAYEEARRGECRDV---------
1pvgB           ------------------LEHILKRPDTYIGSVETQGLFKIFDEILVNAADNKVRDPSKRIDVNIAEEHT
1pvgA           ------------------LEHILKRPDTYIGSVETQGLFKIFDEILVNAADNKVRDPSKRIDVNIAEEHT
1bjtA           ----------------------------------------------------------------------
1qzrB           ------------------LEHILKRPDTYIGSVETQGLFKIFDEILVNAADNKVRDPSMKIDVNIAEEHT
1qzrA           ------------------LEHILKRPDTYIGSVETQGLFKIFDEILVNAADNKVRDPSMKIDVNIAEEHT
1zxnD           ------------------LEHILLRPDTYIGSTFVPGLYKIFDEILVNAADNKQRDPKMSIRVTIPENNL
1zxnB           ------------------LEHILLRPDTYIGSTFVPGLYKIFDEILVNAADNKQRDPKMSIRVTIPENNL
1zxnA           ------------------LEHILLRPDTYIGSTFVPGLYKIFDEILVNAADNKQRDPKMSIRVTIPENNL
1zxmB           ------------------LEHILLRPDTYIGSTFVPGLYKIFDEILVNAADNKQRDPKMSIRVTIPENNL
1zxmA           ------------------LEHILLRPDTYIGSTFVPGLYKIFDEILVNAADNKQRDPKMSIRVTIPENNL


                         .         .         *         .         .         .         .:140
query           XXXXXXXRGIPVDMHPSGAPTVQVVMTQLHAGGKFDSDSYAVSGGLHGVGISVVNALSTRVEADIKLHGK
1ei1A           VSVQDDGRGIPTGIHPEGVSAAEVIMTVLHAGGKFDDNSYKXXXXXXXXXXXXXNALSQKLELVIQREGK
2zjtA           ----------------------------------------------------------------------
1kijA           LTVEDNGRGIPVDLMPEGKPAVEVIYNTLHSGGKFEQGAYKVSGGLHGVGASVVNALSEWTVVEVFREGK
1s16A           LEVIDDGRGMPVDIHPEGVPAVELILCRLHAGGKFSNKNYQFSGGLHGVGISVVNALSKRVEVNVRRDGQ
3fofD           ----------------------------------------------------------------------
3foeD           ----------------------------------------------------------------------
3foeC           ----------------------------------------------------------------------
3fofC           ----------------------------------------------------------------------
1kznA           VSVQDDGRGIPTGI---GVSAAEVIMTVLHA---------------HGVGVSVVNALSQKLELVIQREGK
1aj6A           VSVQDDGRGIPTGI----VSAAEVIMTVLHAGGKF-------XXXXXXXXXXXXNALSQKLELVIQHEGK
1s14B           LEVIDDGRGMPVDIHPEGVPAVELILC-----------------------ISVVNALSKRVEVNVRRDGQ
1s14A           LEVIDDGRGMPVDIHPEGVPAVELILC-----------------------ISVVNALSKRVEVNVRRDGQ
3cwvA           IALFCTSRTVTAE---------NLVRVATGAGGRPPGDGWGWDSML-----VVSLALSSRYQVDIWADGR
2rgrA           ----------------------------------------------------------------------
1bgwA           ----------------------------------------------------------------------
3cwvB           -----------------------------------------------------------RYQVDI-WDGR
1pvgB           IEVKNDGKGIPIEIHNKENIYIPEIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFTADLNV-GQ
1pvgA           IEVKNDGKGIPIEIHNKENIYIPEIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFTADLNV-GQ
1bjtA           ----------------------------------------------------------------------
1qzrB           IEVKNDGKGIPIEIHNKENIYIEMIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFTADLNV-GQ
1qzrA           IEVKNDGKGIPIEIHNKENIYIEMIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFTADLNV-GQ
1zxnD           ISIWNNGKGIPVVEHKVEKMYVPLIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETKMFKQ
1zxnB           ISIWNNGKGIPVVEHKVEKMYVPLIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETKMFKQ
1zxnA           ISIWNNGKGIPVVEHKVEKMYVPLIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETKMFKQ
1zxmB           ISIWNNGKGIPVVEHKVEKMYVPLIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETKMFKQ
1zxmA           ISIWNNGKGIPVVEHKVEKMYVPLIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETKMFKQ


                         +         .         .         .         .         *         .:210
query           HWYQNFEKSVPDELIEGGNARGTGTTIRFWPDAEIXXXXXXXXXXISRRLQEMAFLNKGLTITLTDNRXX
1ei1A           IHRQIYEHGVPQALAVTGETEKTGTMVRFWPSLETFTNVTEFEYEIAKRLRELSFLDSGVSIRLRDKRDG
2zjtA           ----------------------------------------------------------------------
1kijA           HHRIAFSRGEVTERVVGEAPRGTGTRVTFKPDPEIFGNLRFDPSKIRARLREVAYLVAGLKLVFQDRQHG
1s16A           VYFENGEKVQDLQVVGTCGKRNTGTSVHFWPDETFFDSPRFSVSRLTHVLKAKAVLCPGVEITFK-----
3fofD           ----------------------------------------------------------------------
3foeD           ----------------------------------------------------------------------
3foeC           ----------------------------------------------------------------------
3fofC           ----------------------------------------------------------------------
1kznA           IHRQIYEHGVPQPLAVTGETEKTGTMVRFWPSLETFTNVTEFEYEIAKRLRELSFLNSGVSIRLRDKR--
1aj6A           IHRQIYEHGVPQPLAVTGETEKTGTMVRFWPSLETFTNVTEFEYEIAKRLRELSFLNSGVSIRLRDKR--
1s14B           VYFENGEKVQDLQVVGTCGKRNTGTSVHFWPDETFFDSPRFSVSRLTHVLKAKAVLCPGVEITFKD----
1s14A           VYFENGEKVQDLQVVGTCGKRNTGTSVHFWPDETFFDSPRFSVSRLTHVLKAKAVLCPGVEITFKD----
3cwvA           QWRVMGEHGHP----QGEGAAVTGVRVHFVPDATIFEVLAFDRARLSRRCNELAALAPGLRVSFADLQRG
2rgrA           ----------------------------------------------------------------------
1bgwA           ----------------------------------------------------------------------
3cwvB           QWRVMGEHGHPQGMEPMPVSAERGVRVHFVPDATIFEVLAFDRARLSRRCNELAALAPGLRVSFADLQRG
1pvgB           KYVQKWENN-------------------------------------------------------------
1pvgA           KYVQKWENN-------------------------------------------------------------
1bjtA           ----------------------------------------------------------------------
1qzrB           KYVQKWENNM------------------------------------------------------------
1qzrA           KYVQKWENNM------------------------------------------------------------
1zxnD           TWMDNMGRAGEMELKPFNGE--DYTCITFQPDLKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNK--
1zxnB           TWMDNMGRAGEMELKPFNGE--DYTCITFQPDLKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNK--
1zxnA           TWMDNMGRAGEMELKPFNGE--DYTCITFQPDLKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNK--
1zxmB           TWMDNMGRAGEMELKPFNGE--DYTCITFQPDLKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNK--
1zxmA           TWMDNMGRAGEMELKPFNGE--DYTCITFQPDLKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNK--


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXXXXXXXXXSLDEIDNETELVEETTDAXXXXXXXXXXXIFHYPNGLEDYVQYLNRSKTNI
1ei1A           KEDH---------------------------------------------FHYEGGIKAFVEYLNKNKTPI
2zjtA           ----------------------------------------------------------------------
1kijA           K------------------------------EE---------------VFLDKGGVASFAKALAEGEDLL
1s16A           ---------------------DEINNTEQR-------------------WCYQDGLNDYLAEAVNGLPTL
3fofD           ----------------------------------------------------------------------
3foeD           ----------------------------------------------------------------------
3foeC           ----------------------------------------------------------------------
3fofC           ----------------------------------------------------------------------
1kznA           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1s14B           ----------------------------------------------------------------------
1s14A           ----------------------------------------------------------------------
3cwvA           -------------------------------ERT--------------LWHLPGGVAQWAHVLTEARPQL
2rgrA           ----------------------------------------------------------------------
1bgwA           ----------------------------------------------------------------------
3cwvB           -------------------------------ERT--------------LWHLPGGVAQWAHVLTEARPQL
1pvgB           ----------------------------------------------------------------------
1pvgA           ----------------------------------------------------------------------
1bjtA           ----------------------------------------------------------------------
1qzrB           ----------------------------------------------------------------------
1qzrA           ----------------------------------------------------------------------
1zxnD           ----------------------------------------------------------------------
1zxnB           ----------------------------------------------------------------------
1zxnA           ----------------------------------------------------------------------
1zxmB           ----------------------------------------------------------------------
1zxmA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           HPSIVSFEAKGDDHEVEVAMQWNSSYKESVHTFANTINTREGGTHEEGFRSALTSLMNRYAREHKLLKEK
1ei1A           HPNIFYFSTEKDGIGVEVALQWNDGFQENIYCFTNNIPQRDGGTHLAGFRAAMTRTLNAYMDKEGYSKKA
2zjtA           ----------------------------------------------------------------------
1kijA           YEKPFLIRGTHGEVEVEVGFLHTQGYNAEILTYANMIPTRDGGTHLTAFKSAYSRALNQYAKKAGLNKEK
1s16A           PEKPFIGNFAGDTEAVDWALLWLPEGGELLESYVNLIPTMQGGTHVNGLRQGLLDAMREFC-EYRNILPR
3fofD           ----------------------------------------------------------------------
3foeD           ----------------------------------------------------------------------
3foeC           ----------------------------------------------------------------------
3fofC           ----------------------------------------------------------------------
1kznA           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1s14B           ----------------------------------------------------------------------
1s14A           ----------------------------------------------------------------------
3cwvA           HPEPVVFDFTWDGLRVQCALQWCEDEDSTLLSFANAVRTVRHGAHVKGVTQALRGAL------AKLSGET
2rgrA           ----------------------------------------------------------------------
1bgwA           ----------------------------------------------------------------------
3cwvB           HPEPVVFDFTWDGLRVQCALQWCEDEDSTLLSFANAVRTVRHGAHVKGVTQALRGAL------AKLSGET
1pvgB           ----------------------------------------------------------------------
1pvgA           ----------------------------------------------------------------------
1bjtA           ----------------------------------------------------------------------
1qzrB           ----------------------------------------------------------------------
1qzrA           ----------------------------------------------------------------------
1zxnD           ----------------------------------------------------------------------
1zxnB           ----------------------------------------------------------------------
1zxnA           ----------------------------------------------------------------------
1zxmB           ----------------------------------------------------------------------
1zxmA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           EANLTGDDCREGLSAVISVRVGDPQFEGQTKTKLGNTEIKSFVQRMANEHIGHWLEANPAEAKVIINKAV
1ei1A           KVSATGDDAREGLIAVVSVKVPDPKFSSQTKDKLVSSEVKSAVEQQMNELLAEYLLENPTDAKIVVGKII
2zjtA           ----------------------------------------------------------------------
1kijA           GPQPTGDDLLEGLYAVVSVKLPNPQFEGQTKGKLLNPEAGTAVGQVVYERLLEILEENPRIAKAV-----
1s16A           GVKLSAEDIWDRCAYVLSVKMQDPQFAGQTKERLSSRQCAAFVSGVVKDAFILWLNQNVQAAELLAEMAI
3fofD           ----------------------------------------------------------------------
3foeD           ----------------------------------------------------------------------
3foeC           ----------------------------------------------------------------------
3fofC           ----------------------------------------------------------------------
1kznA           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1s14B           ----------------------------------------------------------------------
1s14A           ----------------------------------------------------------------------
3cwvA           RGAFPWARVAQGLTAIVAVSGPRRQFAGPTKELLAIPGLEEAIRKQLQPLFIELLREHPVTPALLARR--
2rgrA           ----------------------------------------------------------------------
1bgwA           ----------------------------------------------------------------------
3cwvB           RGAFPWARVAQGLTAIVAVSGPRRQFAGPTKELLAIPGLEEAIRKQLQPLFIELLREHPVTPALLARR--
1pvgB           ----------------------------------------------------------------------
1pvgA           ----------------------------------------------------------------------
1bjtA           ----------------------------------------------------------------------
1qzrB           ----------------------------------------------------------------------
1qzrA           ----------------------------------------------------------------------
1zxnD           ----------------------------------------------------------------------
1zxnB           ----------------------------------------------------------------------
1zxnA           ----------------------------------------------------------------------
1zxmB           ----------------------------------------------------------------------
1zxmA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GSAQARLAAxxxxxxxxxxxxxxxxxxxxxxxxxRSKDPEKSELYIVEGDSAGGSAKSGRDSMFQAILPL
1ei1A           ----------------------------------------------------------------------
2zjtA           -------------------------------------DPRKSELYVVEGD------------MFQAILPL
1kijA           ----------------------------------------------------------------------
1s16A           SSAQRRMRA-------------------------------------------------------------
3fofD           -------------------------------------NPAKNELYLVEGDSAGGSAKQGRDRKF--ILPL
3foeD           ----------------------------------QSKNPAKNELYLVEGDSAGGSAKQGRDRKF--ILPL
3foeC           ----------------------------------QSKNPAKNELYLVEGDSAGGSAKQGRDRKF--ILPL
3fofC           -------------------------------------NPAKNELYLVEGDSAGGSAKQDR----KFILPL
1kznA           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1s14B           ----------------------------------------------------------------------
1s14A           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
2rgrA           -----------------------------------TKEGYKCTLVLTEGDXXXXXXXXXXXXXYYGCYPL
1bgwA           -----------------------------------TKEGYKCTLVLTEGDXXXXXXXXXXXXXYYGCYPL
3cwvB           ----------------------------------------------------------------------
1pvgB           ----------------------------------------------------------------------
1pvgA           ----------------------------------------------------------------------
1bjtA           -----------------------------------TKEGYKCTLVLTEGDXXXXXXXXXXXXXYYGCYPL
1qzrB           ----------------------------------------------------------------------
1qzrA           ----------------------------------------------------------------------
1zxnD           ----------------------------------------------------------------------
1zxnB           ----------------------------------------------------------------------
1zxnA           ----------------------------------------------------------------------
1zxmB           ----------------------------------------------------------------------
1zxmA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           RGKILNVEKARLDKVLKNAEVQAIITALGTGIHDEFDINKLRYHKIVLMADADVDGQHIATLLLTLLFRF
1ei1A           ----------------------------------------------------------------------
2zjtA           RGK---------DRVLKNTEVQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDGQHISXXXXXXXFRF
1kijA           ----------------------------------------------------------------------
1s16A           ----------------------------------------------------------------------
3fofD           R--VINTAKAKMADILKNEEINTMIYTIGAGVG-----------KIIIMTDADTDGAHIQTLLLTFFYRY
3foeD           R--VINTAKAKMADILKNEEINTMIYTIGAGVG-----------KIIIMTDADTDGAHIQTLLLTFFYRY
3foeC           R--VINTAKAKMADILKNEEINTMIYTIGAGVG-----------KIIIMTDADTDGAHIQTLLLTFFYRY
3fofC           RGKVINTAKAKMADILKNEEINTMIYTIGAGVG-----------KIIIMTDADTDGAHIQTLLLTFFYRY
1kznA           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1s14B           ----------------------------------------------------------------------
1s14A           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
2rgrA           RGKMLNVREASADQILKNAEIQAIKKIMGLQHRKKYDTKSLRYGHLMIMTDQDHDGSHIKGLIINFLSSF
1bgwA           RGKMLNVREASADQILKNAEIQAIKKIMGLQHRKKYDTKSLRYGHLMIMTDQDHDGSHIKGLIINFL---
3cwvB           ----------------------------------------------------------------------
1pvgB           ----------------------------------------------------------------------
1pvgA           ----------------------------------------------------------------------
1bjtA           RGKMLNVREA-----LKNAEIQAIKKIMGLQHRKKYDTKSLRYGHLMIMTDSHIKG--------------
1qzrB           ----------------------------------------------------------------------
1qzrA           ----------------------------------------------------------------------
1zxnD           ----------------------------------------------------------------------
1zxnB           ----------------------------------------------------------------------
1zxnA           ----------------------------------------------------------------------
1zxmB           ----------------------------------------------------------------------
1zxmA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           MPDLVAEGHVYLAQPPLYKLKWQRGEPGFAYSDEERDEQLNEGLAAGRKINKDDGIQRYKGLGEMNASEL
1ei1A           ----------------------------------------------------------------------
2zjtA           MRPLIENGHVFLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLKAGKKINKEDGIQRYKGLGEMDAKEL
1kijA           ----------------------------------------------------------------------
1s16A           ----------------------------------------------------------------------
3fofD           MRPLVEAGHVYIALPPLYKMKGKKEEVAYAWTDGELEEL------------KGATLQRYKGLGEMNADQL
3foeD           MRPLVEAGHVYIALPPLYKMKGKKEEVAYAWTDGELEEL------------KGATLQRYKGLGEMD--QL
3foeC           MRPLVEAGHVYIALPPLYKMSKGKGKEAYAWTDGELEEL------------KGATLQRYKGLGEMD--QL
3fofC           MRPLVEAGHVYIALPPLYKMSKGKGEEVAAWTDGELEEL------------KGATLQRYKGLGEMD--QL
1kznA           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1s14B           ----------------------------------------------------------------------
1s14A           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
2rgrA           LGLLDIQGFLLEFITPIIKVSITKPTKNIAFYNMPDYEKWRE-----EESHKFTWKQKYKGLGTSLAQEV
1bgwA           ----------------------------------------------------------------------
3cwvB           ----------------------------------------------------------------------
1pvgB           ----------------------------------------------------------------------
1pvgA           ----------------------------------------------------------------------
1bjtA           ----------------------------------------------------------------------
1qzrB           ----------------------------------------------------------------------
1qzrA           ----------------------------------------------------------------------
1zxnD           ----------------------------------------------------------------------
1zxnB           ----------------------------------------------------------------------
1zxnA           ----------------------------------------------------------------------
1zxmB           ----------------------------------------------------------------------
1zxmA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           WETTMDPTVRILRRVDITDAQRADELFSILMGDDVVARRSFITRNxxxxxxxxx
1ei1A           ------------------------------------------------------
2zjtA           WETTMDPSVRVLRQVTLDDAAAADELFSILM-----------------------
1kijA           ------------------------------------------------------
1s16A           ------------------------------------------------------
3fofD           WETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDN---------
3foeD           WETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDN---------
3foeC           WETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDN---------
3fofC           WETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDN---------
1kznA           ------------------------------------------------------
1aj6A           ------------------------------------------------------
1s14B           ------------------------------------------------------
1s14A           ------------------------------------------------------
3cwvA           ------------------------------------------------------
2rgrA           RESNLDRHLKIFHSLQGNDKDYIDLAFSKKKADD--------------------
1bgwA           ------------------------------------------------------
3cwvB           ------------------------------------------------------
1pvgB           ------------------------------------------------------
1pvgA           ------------------------------------------------------
1bjtA           ------------------------------------------------------
1qzrB           ------------------------------------------------------
1qzrA           ------------------------------------------------------
1zxnD           ------------------------------------------------------
1zxnB           ------------------------------------------------------
1zxnA           ------------------------------------------------------
1zxmB           ------------------------------------------------------
1zxmA           ------------------------------------------------------