[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cglu2:BAF53009.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1w74A.bssp"
#ERROR : Can't open dsspfile "2a2nC.bssp"
#ERROR : Can't open dsspfile "2a2nA.bssp"
#ERROR : Can't open dsspfile "1xwnA.bssp"
#ERROR : Can't open dsspfile "2k7nA.bssp"
#ERROR : Can't open dsspfile "2rmcA.bssp"
#ERROR : Can't open dsspfile "2fu0A.bssp"
#ERROR : Can't open dsspfile "1c5fK.bssp"
#ERROR : Can't open dsspfile "1c5fI.bssp"
#ERROR : Can't open dsspfile "1c5fG.bssp"
#ERROR : Can't open dsspfile "1a58A.bssp"
#ERROR : Can't open dsspfile "1a33A.bssp"
#ERROR : Can't open dsspfile "3bt8A.bssp"
#ERROR : Can't open dsspfile "1xo7A.bssp"
#ERROR : Can't open dsspfile "2haqA.bssp"
#ERROR : Can't open dsspfile "2eslA.bssp"
#ERROR : Can't open dsspfile "2hq6A.bssp"
#ERROR : Can't open dsspfile "2b71A.bssp"
#ERROR : Can't open dsspfile "1zkcB.bssp"
#ERROR : Can't open dsspfile "1zkcA.bssp"
#ERROR : Can't open dsspfile "1xyhA.bssp"
#ERROR : Can't open dsspfile "2wfiA.bssp"
#ERROR : Can't open dsspfile "2ojuB.bssp"
#ERROR : Can't open dsspfile "2ojuA.bssp"
#ERROR : Can't open dsspfile "2poyA.bssp"
#ERROR : Can't open dsspfile "2pluA.bssp"
#ERROR : Can't open dsspfile "1h0pA.bssp"
#ERROR : Can't open dsspfile "2gw2A.bssp"
#ERROR : Can't open dsspfile "1cynA.bssp"
#ERROR : Can't open dsspfile "2wfjA.bssp"
#ERROR : Can't open dsspfile "1iipA.bssp"
#ERROR : Can't open dsspfile "1ihgA.bssp"
#ERROR : Can't open dsspfile "1istA.bssp"
#ERROR : Can't open dsspfile "2he9A.bssp"
#ERROR : Can't open dsspfile "2qerA.bssp"
#ERROR : Can't open dsspfile "2poeA.bssp"
#ERROR : Can't open dsspfile "2cfeA.bssp"
#ERROR : Can't open dsspfile "1qngA.bssp"
#ERROR : Can't open dsspfile "2wlwA.bssp"
#ERROR : Can't open dsspfile "1m9eB.bssp"
#ERROR : Can't open dsspfile "1m9eA.bssp"
#ERROR : Can't open dsspfile "1m9dB.bssp"
#ERROR : Can't open dsspfile "1bckA.bssp"
#ERROR : Can't open dsspfile "1awqA.bssp"
#ERROR : Can't open dsspfile "2alfA.bssp"
#ERROR : Can't open dsspfile "1qnhB.bssp"
#ERROR : Can't open dsspfile "1qnhA.bssp"
#ERROR : Can't open dsspfile "2hqjA.bssp"
#ERROR : Can't open dsspfile "1dywA.bssp"
#ERROR : Can't open dsspfile "3bkpA.bssp"
#ERROR : Can't open dsspfile "1z81A.bssp"
#ERROR : Can't open dsspfile "3k2cC.bssp"
#ERROR : Can't open dsspfile "3k2cB.bssp"
#ERROR : Can't open dsspfile "3k2cA.bssp"
#ERROR : Can't open dsspfile "2nulA.bssp"
#ERROR : Can't open dsspfile "1mzwA.bssp"
#ERROR : Can't open dsspfile "1lopA.bssp"
#ERROR : Can't open dsspfile "2z6wA.bssp"
#ERROR : Can't open dsspfile "2ck1A.bssp"
#ERROR : Can't open dsspfile "1awsA.bssp"
#ERROR : Can't open dsspfile "1zmfA.bssp"
#ERROR : Can't open dsspfile "2r99A.bssp"
#ERROR : Can't open dsspfile "3bo7D.bssp"
#ERROR : Can't open dsspfile "3bo7B.bssp"
#ERROR : Can't open dsspfile "3bo7A.bssp"
#ERROR : Can't open dsspfile "3bo7C.bssp"
#ERROR : Can't open dsspfile "2c3bA.bssp"
#ERROR : Can't open dsspfile "2c3bB.bssp"
#ERROR : Can't open dsspfile "1clhA.bssp"
#ERROR : Can't open dsspfile "1j2aA.bssp"

## Summary of PDB Search
:190
    5e-68  80%  1w74A  [b.62.1] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE A
    6e-29  48%  2a2nC  [x.x.x] PEPTIDYLPROLYL ISOMERASE DOMAIN AND WD REPEAT
    6e-29  48%  2a2nA  [x.x.x] PEPTIDYLPROLYL ISOMERASE DOMAIN AND WD REPEAT
    7e-27  54%  1xwnA  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE LIKE 1
    7e-27  54%  2k7nA  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE-LIKE 1
    2e-24  47%  2rmcA  [b.62.1] CYCLOPHILIN C
    2e-24  41%  2fu0A  [x.x.x] CYCLOPHILIN, PUTATIVE
    2e-24  49%  1c5fK  [b.62.1] PROTEIN (PEPTIDYLPROLYL ISOMERASE CYP-1)
    2e-24  49%  1c5fI  [b.62.1] PROTEIN (PEPTIDYLPROLYL ISOMERASE CYP-1)
    2e-24  49%  1c5fG  [b.62.1] PROTEIN (PEPTIDYLPROLYL ISOMERASE CYP-1)
    2e-24  49%  1a58A  [b.62.1 (1c5fA)] CYCLOPHILIN
    2e-24  49%  1a33A  [b.62.1 (1c5fE)] PEPTIDYLPROLYL ISOMERASE
    4e-23  55%  3bt8A  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE
    9e-23  53%  1xo7A  [b.62.1] CYCLOPHILIN
    1e-22  54%  2haqA  [x.x.x] CYCLOPHILIN
    1e-22  56%  2eslA  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE C
    2e-22  47%  2hq6A  [x.x.x] SEROLOGICALLY DEFINED COLON CANCER ANTIGEN 10
    1e-21  49%  2b71A  [x.x.x] CYCLOPHILIN-LIKE PROTEIN
    1e-20  47%  1zkcB  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE LIKE 2
    1e-20  47%  1zkcA  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE LIKE 2
    2e-20  38%  1xyhA  [x.x.x] CYCLOPHILIN-LIKE PROTEIN PPIL3B
    2e-20  37%  2wfiA  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE G
    2e-20  38%  2ojuB  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE-LIKE 3
    2e-20  38%  2ojuA  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE-LIKE 3
    4e-20  49%  2poyA  [x.x.x] 20K CYCLOPHILIN, PUTATIVE
    4e-20  49%  2pluA  [x.x.x] 20K CYCLOPHILIN, PUTATIVE
    5e-20  53%  1h0pA  [b.62.1] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE 5
    5e-20  37%  2gw2A  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE G
    5e-20  50%  1cynA  [b.62.1] CYCLOPHILIN B
    9e-20  36%  2wfjA  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE G
    2e-19  42%  1iipA  [b.62.1 - a.118.8] CYCLOPHILIN 40
    2e-19  42%  1ihgA  [b.62.1 - a.118.8] CYCLOPHILIN 40
    6e-19  47%  1istA  [b.62.1] CYCLOPHILIN A
    2e-18  39%  2he9A  [x.x.x] NK-TUMOR RECOGNITION PROTEIN
    2e-18  46%  2qerA  [x.x.x] CYCLOPHILIN-LIKE PROTEIN, PUTATIVE
    2e-18  46%  2poeA  [x.x.x] CYCLOPHILIN-LIKE PROTEIN, PUTATIVE
    2e-18  55%  2cfeA  [x.x.x] ALLERGEN
    5e-18  47%  1qngA  [b.62.1] CYCLOPHILIN
    6e-18  49%  2wlwA  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE
    6e-18  39%  1m9eB  [b.62.1] CYCLOPHILIN A
    6e-18  39%  1m9eA  [b.62.1] CYCLOPHILIN A
    6e-18  39%  1m9dB  [b.62.1] CYCLOPHILIN A
    6e-18  39%  1bckA  [b.62.1] CYCLOPHILIN A
    6e-18  39%  1awqA  [b.62.1] CYCLOPHILIN A
    1e-17  39%  2alfA  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE A
    2e-17  46%  1qnhB  [b.62.1] CYCLOPHILIN
    2e-17  46%  1qnhA  [b.62.1] CYCLOPHILIN
    2e-17  52%  2hqjA  [x.x.x] CYCLOPHILIN
    9e-17  43%  1dywA  [b.62.1] CYCLOPHILIN 3
    3e-16  44%  3bkpA  [x.x.x] CYCLOPHILIN
    3e-16  34%  1z81A  [x.x.x] CYCLOPHILIN
    6e-16  41%  3k2cC  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE
    6e-16  41%  3k2cB  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE
    6e-16  41%  3k2cA  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE
    8e-16  41%  2nulA  [x.x.x] PEPTIDYLPROLYL ISOMERASE
    1e-15  36%  1mzwA  [b.62.1] U-SNRNP-ASSOCIATED CYCLOPHILIN
    2e-15  40%  1lopA  [b.62.1] CYCLOPHILIN A
    1e-14  39%  2z6wA  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE
    6e-14  48%  2ck1A  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE E
    2e-13  38%  1awsA  [b.62.1] CYCLOPHILIN A
    4e-13  42%  1zmfA  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE E
    4e-13  42%  2r99A  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE E
    1e-11  38%  3bo7D  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE, CYCLOPHILIN-
    1e-11  38%  3bo7B  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE, CYCLOPHILIN-
    2e-11  38%  3bo7A  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE, CYCLOPHILIN-
    3e-11  38%  3bo7C  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE, CYCLOPHILIN-
    2e-09  40%  2c3bA  [x.x.x] PPIASE
    2e-09  45%  2c3bB  [x.x.x] PPIASE
    5e-08  33%  1clhA  [x.x.x] CYCLOPHILIN
    8e-08  33%  1j2aA  [b.62.1] CYCLOPHILIN B
:190

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxSLDVVMMGVMTSKTATAILHTNRGDITIDLFGNHAPETVANFVGLAQGTKEYQAQNAQGDSEG
1w74A           --------------------TATATLHTNRGDIKIALFGNHAPKTVANFVGLAQGTKDYSTQNASGGPSG
2a2nC           ----------------------SAIIHTSMGDIHTKLFPVECPKTVENFCV---------------HSRN
2a2nA           ----------------------SAIIHTSMGDIHTKLFPVECPKTVENFCV---------------HSRN
1xwnA           -------------------------LETSMGIIVLELYWKHAPKTCKNFAELARRG--------------
2k7nA           -------------------------LETSMGIIVLELYWKHAPKTCKNFAELARRG--------------
2rmcA           ------------------------------GRIVIGLFGNVVPKTVENFVALATGEKGYG----------
2fu0A           ----------------------SAIIYTTMGDIHISLFYKECKKTVQNF---------------SVHSIN
1c5fK           ------------------------------GRIVMELYNDIAPRTCNNFLMLCTG----MAGTGKISGKP
1c5fI           ------------------------------GRIVMELYNDIAPRTCNNFLMLCTG----MAGTGKISGKP
1c5fG           ------------------------------GRIVMELYNDIAPRTCNNFLMLCTG----MAGTGKISGKP
1a58A           ------------------------------GRIVMELYNDIAPRTCNNFLMLCTG----MAGTGKISGKP
1a33A           ------------------------------GRIVMELYNDIAPRTCNNFLMLCTG----MAGTGKISGKP
3bt8A           ------------------------------GRITIGLFGKDAPLTTENFRQLCTG------------EHG
1xo7A           ------------------------------GRVVIGLFGNDVPKTVENFKQLASG------ENGFG----
2haqA           ------------------------------GRITIGLFGKDAPLTTENFRQLCTG------------EHG
2eslA           ------------------------------GRIVIGLFGKVVPKTVENFVALATGEKGYG----------
2hq6A           ------------------------LLKTTAGDIDIELWSKEAPKACRNFIQLCLEA--------------
2b71A           -------------------------IYTNLGDFEVELYWYHSPKTCLNFYTLC---------------EM
1zkcB           -------------------------LHTNKGDLNLELHCDLTPKTCENFIRLCK--KHY-----------
1zkcA           -------------------------LHTNKGDLNLELHCDLTPKTCENFIRLCK--KHY-----------
1xyhA           -------------------------LHTDVGDIKIEVFCERTPKTCENFLALCASN--------------
2wfiA           -----------------------AINNQPAGRVVFELFSDVCPKTCENFRCLCTGEK-----GTGKSTQK
2ojuB           -------------------------LHTDVGDIKIEVFCERTPKTCENFLALCASN--------------
2ojuA           -------------------------LHTDVGDIKIEVFCERTPKTCENFLALCASN--------------
2poyA           -----------------------SIGQTPAGRITMELFADKVPITAENFRALCTGEK------GMGQSGK
2pluA           -----------------------SIGQTPAGRITMELFADKVPITAENFRALCTGEK------GMGQSGK
1h0pA           ------------------------------GRIVIGLFGKTVPKTATNFIELAKKPK------------G
2gw2A           -----------------------AINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKG----TGKSTQKP
1cynA           ------------------------------GRVIFGLFGKTVPKTVDNFVALATGEKGFG----------
2wfjA           -----------------------AINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKG----TGKSTQKP
1iipA           ------------------------------GRIVLELFADIVPKTAENFRALCTGEKGI------GPTTG
1ihgA           ------------------------------GRIVLELFADIVPKTAENFRALCTGEKGI------GPTTG
1istA           ------------------------------GRVVFKLYNDIVPKTAENFRALCTGEKGFG----------
2he9A           ------------------------------GRIMFQLFSDICPKTCKNFLCLCSXXXXXXXXXXXXXXXX
2qerA           ---------------------------TNYGDLKFELFCSQCPKACKNFLAL---------------SAS
2poeA           ---------------------------TNYGDLKFELFCSQCPKACKNFLAL---------------SAS
2cfeA           ------------------------------GTIKFKLFDDVVPKTAANFRALCTGEKGFG----------
1qngA           -----------------------SIDNSNAGRIIFELFSDITPRTCENFRALCTGEK------IGSRGKN
2wlwA           ------------------------------GRVSFELFADKVPKTAENFRALSTGEKGFG----------
1m9eB           ------------------------------GRVSFELFADKVPKTAENFRALSTGEKGFG----------
1m9eA           ------------------------------GRVSFELFADKVPKTAENFRALSTGEKGFG----------
1m9dB           ------------------------------GRVSFELFADKVPKTAENFRALSTGEKGFG----------
1bckA           ------------------------------GRVSFELFADKVPKTAENFRALSTGEKGFG----------
1awqA           ------------------------------GRVSFELFADKVPKTAENFRALSTGEKGFG----------
2alfA           ------------------------------GRVSFELFADKVPKTAENFRALSTGEKGFG----------
1qnhB           -----------------------SIDNSNAGRIIFELFSDITPRTCENFRALCTGEK------IGSRGKN
1qnhA           -----------------------SIDNSNAGRIIFELFSDITPRTCENFRALCTGEK------IGSRGKN
2hqjA           ------------------------------GRIVMELYADTVPKTAENFRALCTGEK------GKGRSGK
1dywA           ------------------------------GRIVMELYDDVVPKTAGNFRALCTG------ENGIGKSGK
3bkpA           ------------------STRGKVVLHTSLGDLDVELWARECPLACRNFVQLCL--------------EG
1z81A           ------------------------------GKFKFELFQNIVPKTSENFRQFCTG--EYKVNNLPVG---
3k2cC           ------------------------------GRIVMKLEDDIVPKTAKNFRTLCERPK------------G
3k2cB           ------------------------------GRIVMKLEDDIVPKTAKNFRTLCERPK------------G
3k2cA           ------------------------------GRIVMKLEDDIVPKTAKNFRTLCERPK------------G
2nulA           --------------------------HTNHGDIVIKTFDDKAPETVKNFLDYCR--------------EG
1mzwA           ------------------------------GRMKIELFADVVPKTAENF-------RQFCTGEFRKDGVP
1lopA           --------------------------HTNHGDIVIKTFDDKAPETVKNFLDYCR--------------EG
2z6wA           ------------------------------GRVVLELKADVVPKTAENFRALCTGEKGFG----------
2ck1A           ------------------------------GRIVMELRSDIVPRTAENFRALCTGERGFG----------
1awsA           ------------------------------GRVSFELFADKVPKTAENFRALSTGEKGFG----------
1zmfA           ----------------------------------------------------------------------
2r99A           ----------------------------------------------------------------------
3bo7D           ---------------------------TTQGSLNIELHADMAPRACDSFLRLCAVK--------------
3bo7B           ---------------------------TTQGSLNIELHADMAPRACDSFLRLCAVK--------------
3bo7A           ---------------------------TTQGSLNIELHADMAPRACDSFLRLCAVK--------------
3bo7C           ---------------------------TTQGSLNIELHADMAPRACDSFLRLCAVK--------------
2c3bA           -------SMSQVFFDVEYAPVGTA--ETKVGRIVFNLFDKDVPKTAKNFRELCKRPA------------G
2c3bB           ---------------------------TKVGRIVFNLFDKDVPKTAKNFRELCKRPA------------G
1clhA           ------------------------LLTTSAGNIELELDKQKAPVSVQNFVDYVNSG--------------
1j2aA           ------------------------LLTTSAGNIELELDKQKAPVSVQNFVDYVNSG--------------


                         .         .         *         .         .         .         .:140
query           PFYNGSVFHRVIDGFMIQXXXXXXXXXXXXXYTFADEFHPELRFDRAYLLAMANAGPGTNGSQFFITVTP
1w74A           PFYDGAVFHRVIQGFMIQXXXXXXXXXXXXXYKFADEFHPELQFDKPYLLAMANAGPGTNGSQFFITVGK
2a2nC           GYYNGHTFHRIIKGFMIQTGDPTGTGMGGESIEFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVP
2a2nA           GYYNGHTFHRIIKGFMIQTGDPTGTGMGGESIEFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVP
1xwnA           -YYNGTKFHRIIKDFMIQXXXXXXXXXXXASIQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAP
2k7nA           -YYNGTKFHRIIKDFMIQXXXXXXXXXXXASIQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAP
2rmcA           --YKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDELKHYGIGWVSMANAGPDTNGSQFFITLTK
2fu0A           GYYNNCIFHRVIKHFMVQTGDPSGDGTGGESIEFEDEFFDHLNHSKPFMVSMANCGPNTNGSQFFITTVP
1c5fK           LHYKGSTFHRVIKNFMIQXXXXXXXXXXXXESIYGGMFDDEMKHDEPFVVSMANKGPNTNGSQFFITTTP
1c5fI           LHYKGSTFHRVIKNFMIQXXXXXXXXXXXXESIYGGMFDDEMKHDEPFVVSMANKGPNTNGSQFFITTTP
1c5fG           LHYKGSTFHRVIKNFMIQXXXXXXXXXXXXESIYGGMFDDEMKHDEPFVVSMANKGPNTNGSQFFITTTP
1a58A           LHYKGSTFHRVIKNFMIQXXXXXXXXXXXXESIYGGMFDDEMKHDEPFVVSMANKGPNTNGSQFFITTTP
1a33A           LHYKGSTFHRVIKNFMIQXXXXXXXXXXXXESIYGGMFDDEMKHDEPFVVSMANKGPNTNGSQFFITTTP
3bt8A           FGYKDSIFHRVIQNFMIQXXXXXXXXXXXXKSIYGEKFADENLNVKHFVLSMANAGPNTNGSQFFITTAP
1xo7A           --YKGSIFHRVIRNFMIQXXXXXXXXXXXXKSIYGTRFDDENLKIKHFVVSMANAGPNSNGSQFFVTTAP
2haqA           FGYKDSIFHRVIQNFMIQXXXXXXXXXXXXKSIYGEKFADENLNVKHFVLSMANAGPNTNGSQFFITTAP
2eslA           --YKGSKFHRVIKDFMIQXXXXXXXXXXXXVSIYGETFPDELKHYGIGWVSMANAGPDTNGSQFFITLTK
2hq6A           -YYDNTIFHRVVPGFIVQXXXXXXXXXXXESIPFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGR
2b71A           GFYDNTIFHRVIPNFVIQXXXXXXXXXXXXSIYFEDEINKELKHTGAGILSMSNNGPNTNSSQFFITLAP
1zkcB           --YDGTIFHRSIRNFVIQXXXXXXXXXXXESYPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRS
1zkcA           --YDGTIFHRSIRNFVIQXXXXXXXXXXXESYPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRS
1xyhA           -YYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGK
2wfiA           PLHYKSLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDEVKHNKEFLLSMANRGKDTNGSQFFITTKP
2ojuB           -YYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGK
2ojuA           -YYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGK
2poyA           PLYTGSFFHRIIPQFMIQXXXXXXXXXXXXESIYG-KFRDEYTHDAPFLLSMANAGPNTNGSQFFITTVP
2pluA           PLYTGSFFHRIIPQFMIQXXXXXXXXXXXXESIYG-KFRDEYTHDAPFLLSMANAGPNTNGSQFFITTVP
1h0pA           EGYPGSKFHRVIADFMIQXXXXXXXXXXXXXSIYGEKFADELKHYGAGWLSMANAGADTNGSQFFITTVK
2gw2A           LHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDEVKHNAAFLLSMANRGKDTNGSQFFITTKP
1cynA           --YKNSKFHRVIKDFMIQXXXXXXXXXXXXKSIYGERFPDELKHYGPGWVSMANAGKDTNGSQFFITTVK
2wfjA           LHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDEVKHNKEFLLSMANRGKDTNGSQFFITTKP
1iipA           KHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDEYKHDKEGLLSMANAGSNTNGSQFFITTVP
1ihgA           KHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDEYKHDKEGLLSMANAGSNTNGSQFFITTVP
1istA           --YAGSPFHRVIPDFMLQXXXXXXXXXXXXKSIYGGKFPDEKHHDRPGLLSMANAGPNTNGSQFFITTVP
2he9A           X----STFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDELKHDRAFLLSMANRGKHTNGSQFFITTKP
2qerA           GYYKNTIFHKNIKGFIIQXXXXXXXXXXXESIYFDDEIYPELKYDRRGILSMASASPNTNGSQFFITYSS
2poeA           GYYKNTIFHKNIKGFIIQXXXXXXXXXXXESIYFDDEIYPELKYDRRGILSMASKGPNTNGSQFFITYSS
2cfeA           --YAGSHFHRVIPDFMLQXXXXXXXXXXXXKSIYGAKFADELKHNKPGLLSMANAGPNTNGSQFFITTVV
1qngA           LHYKNSIFHRIIPQFMCQXXXXXXXXXXXXESIYGRSFTDEMKHDQPGLLSMANAGPNTNSSQFFITLVP
2wlwA           --YKGSCFHRIIPGFMCQXXXXXXXXXXXXKSIYGEKFEDELKHTGPGILSMANAGPNTNGSQFFICTAK
1m9eB           --YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDELKHTGPGILSMANAGPNTNGSQFFICTAK
1m9eA           --YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDELKHTGPGILSMANAGPNTNGSQFFICTAK
1m9dB           --YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDELKHTGPGILSMANAGPNTNGSQFFICTAK
1bckA           --YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDELKHTGPGILSMANAGPNTNGSQFFICTAK
1awqA           --YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDELKHTGPGILSMANAGPNTNGSQFFICTAK
2alfA           --YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDELKHTGPGILSMANAGPNTNGSQFFICTAK
1qnhB           LHYKNSIFHRIIPQFMCQXXXXXXXXXXXXESIYGRSFTDEMKHDQPGLLSMANAGPNTNSSQFLITLVP
1qnhA           LHYKNSIFHRIIPQFMCQXXXXXXXXXXXXESIYGRSFTDEMKHDQPGLLSMANAGPNTNSSQFLITLVP
2hqjA           PLYKSSVFHRVIPNFMIQXXXXXXXXXXXXESIYGTTFRDESFSGKAGCLSMANAGPNTNGSQFFICTAA
1dywA           PLFKGSKFHRIIPNFMIQXXXXXXXXXXXXESIYGEKF-PDENFKEKHVLSMANAGPNTNGSQFFLCTVK
3bkpA           -YYVNTIFHRVVKDFIVQXXXXXXXXXXXXXXXFDVETHPRLKFRYRGLVGVANLG--TNGNQFFITLAR
1z81A           --YKNTIFHRVIKEFMIQGGDFINHNGSGSLSIYGEKFDDEIKHDKEGLLSMANSGPNTNGCQFFITTKK
3k2cC           EGYKGSTFHRIIPGFMVQGGDYTAHNGTGGRSIYGEKFPDELKHTKEGILSMANCGAHTNGSQFFITLGK
3k2cB           EGYKGSTFHRIIPGFMVQGGDYTAHNGTGGRSIYGEKFPDELKHTKEGILSMANCGAHTNGSQFFITLGK
3k2cA           EGYKGSTFHRIIPGFMVQGGDYTAHNGTGGRSIYGEKFPDELKHTKEGILSMANCGAHTNGSQFFITLGK
2nulA           -FYNNTIFHRVINGFMIQGGFEPGMKQKATKEPIKNEANNGLKNTRGTLAMARTQAPHSATAQFFINVVD
1mzwA           IGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADELRHSAPGLLSMANSGPSTNGCQFFITCSK
1lopA           -FYNNTIFHRVINGFMIQGGFEPGMKQKATKEPIKNEANNGLKNTRGTLAMARTQAPHSATAQFFINVVD
2z6wA           --YKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDELKHVGPGVLSMANAGPNTNGSQFFICTIK
2ck1A           --YHNCCFHRVIPQFMCQXXXXXXXXXXXXXSIYGRKFDDELRHEGFGVLSMANSGPNTNGSQFFICTTK
1awsA           --YKGSCFHRIIPGFC-QGGDFTRHNGTGGKSIYGEKFEDELKHTGPGILS-ANAGPNTNGSQFFICTAK
1zmfA           --FKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDELKHTGPGLLSMANSGPNTNGSQFFLTCDK
2r99A           --FKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDELKHTGPGLLSMANSGPNTNGSQFFLTCDK
3bo7D           -YFDDTIFHRCIRNFMIQGGRAELRQPQQSPRSFEDEFDNRLVHQGIGVLSMANDGKHSNLSEFFITFKS
3bo7B           -YFDDTIFHRCIRNFMIQGGRAELRQPQQSPRSFEDEFDNRLVHQGIGVLSMANDGKHSNLSEFFITFKS
3bo7A           -YFDDTIFHRCIRNFMIQGGRAELRQPQSPRSIFEDEFDNRLVHQGIGVLSMANDGKHSNLSEFFITFKS
3bo7C           -YFDDTIFHRCIRNFMIQGGRAELRQPSKKQSPFEDEFDNRLVHQGIGVLSMANDGKHSNLSEFFITFKS
2c3bA           EGYRESTFHRIIPNFMIQGGDSR-------------------KHDKKGILSMA---------QFFITTAV
2c3bB           EGYRESTFHRIIPNFMIQGG------------------------DKKGILSMA--------SQFFITTAV
1clhA           -FYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVAD
1j2aA           -FYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVAD


                         +         .         .         .         .         *         .:210
query           TPHLNNAHTIFGEVTDAESQKVVDAIATTATDRYDRPADAVVIESVEITA
1w74A           TPHLNRRHTIFGEVIDAESQRVVEAISKTATDGNDRPTDPVVIESITIS-
2a2nC           TPWLDNKHTVFGRVT--KGMEVVQRISNVKVNKTDKPYEDVSIINITV--
2a2nA           TPWLDNKHTVFGRVT--KGMEVVQRISNVKVNKTDKPYEDVSIINITV--
1xwnA           TQWLDGKHTIFGRV--CQGIGMVNRVGMVETNSQDRPVDDVKI-------
2k7nA           TQWLDGKHTIFGRV--CQGIGMVNRVGMVETNSQDRPVDDVKI-------
2rmcA           PTWLDGKHVVFGKVLD--GMTVVHSIELQATDGHDRPTDCTIVNSGKI--
2fu0A           CPWLDFKHTVFGKVT--QGSKIVLDIEKVRTDKRDKPLEDIKILNIKI--
1c5fK           APHLNNIHVVFGKV--VSGQEVVTKIEYLKTNSKNRPADVVILNCGEL--
1c5fI           APHLNNIHVVFGKV--VSGQEVVTKIEYLKTNSKNRPADVVILNCGEL--
1c5fG           APHLNNIHVVFGKV--VSGQEVVTKIEYLKTNSKNRPADVVILNCGEL--
1a58A           APHLNNIHVVFGKV--VSGQEVVTKIEYLKTNSKNRPADVVILNCGEL--
1a33A           APHLNNIHVVFGKV--VSGQEVVTKIEYLKTNSKNRPADVVILNCGEL--
3bt8A           TPWLDGAHVVFGKVLD--GMDVVLRIEKTKTNSHDRPVKPVKI-------
1xo7A           TPWLDGRHVVFGKV--VEGMDVVKKVENTKTGLNDKPKKAVKI-------
2haqA           TPWLDGRHVVFGKVLD--GMDVVLRIEKTKTNSHDRPVKPVKI-------
2eslA           PTWLDGKHVVFGKVID--GMTVVHSIELQATDGHDRP-------------
2hq6A           ADELNNKHTIFGKVTGDTVYNML-RLSEVDIDDDERPHNPHKIKSCEV--
2b71A           LPHLDGKHTIFARV--SKNMTCIENIASVQTTATNKP-------------
1zkcB           CAYLDKKHTIFGRVVGGFD--VLTAMENVESDKTDRPKEEIRIDATTV--
1zkcA           CAYLDKKHTIFGRVVGGFD--VLTAMENVESDKTDRPKEEIRIDATTV--
1xyhA           QPHLDMKYTVFGKVIDG-LETLDELEKLPVNEKTYRPLNDVHIKDITIHA
2wfiA           TPHLDGHHVVFGQV--ISGQEVVREIENQKTDAASKPFAEVRILS-----
2ojuB           QPHLDMKYTVFGKVIDG-LETLDELEKLPVNEKTYRPLNDVHIKDITIHA
2ojuA           QPHLDMKYTVFGKVIDG-LETLDELEKLPVNEKTYRPLNDVHIKDITIHA
2poyA           CPWLDGKHVVFGKV--LEGMEVVKSIEKCGSQN-GKPTKSVCI-------
2pluA           CPWLDGKHVVFGKV--LEGMEVVKSIEKCGSQN-GKPTKSVCI-------
1h0pA           TPWLDGRHVVFGKI--LEGMDVVRKIEQTEKLPGDRPKQDVII-------
2gw2A           TPHLDGHHVVFGQV--ISGQEVVREIENQKTDAASKPFAEVRILS-----
1cynA           TAWLDGKHVVFGKV--LEGMEVVRKVESTKTDSRDKPLKDVII-------
2wfjA           TPHLDGHHVVFGQV--ISGQEVVREIENQKTDAASKPFAEVRILS-----
1iipA           TPHLDGKHVVFGQV------------------------------------
1ihgA           TPHLDGKHVVFGQV------------------------------------
1istA           CPWLDGKHVVFGEVVD--GYDIVKKVESLGSPSGATKARIVVAKSGEL--
2he9A           APHLDGVHVVFGLV--ISGFEVIEQIENLKTDAASRPADVRVID------
2qerA           LPQLNGEYVIFGKLID--GFETLNTLENCPSDKSHKP-------------
2poeA           LPQLNGEYVIFGKLID--GFETLNTLENCPSDKSHKP-------------
2cfeA           TSWLDGKHVVFGEVID--GMNVVKAI------------------------
1qngA           CPWLDGKHVVFGKVIE----------------------------------
2wlwA           TEWLDGKHVVFGKV--KEGMNIVEAM------------------------
1m9eB           TEWLDGKHVVFGKV--KEGMNIVEAM------------------------
1m9eA           TEWLDGKHVVFGKV--KEGMNIVEAM------------------------
1m9dB           TEWLDGKHVVFGKV--KEGMNIVEAM------------------------
1bckA           TEWLDGKHVVFGKV--KEGMNIVEAM------------------------
1awqA           TEWLDGKHVVFGKV--KEGMNIVEAM------------------------
2alfA           TKWLDGKHVVFGAV--KEGMNIVEAM------------------------
1qnhB           CPWLDGKHVVFGKVIE----------------------------------
1qnhA           CPWLDGKHVVFGKVIE----------------------------------
2hqjA           TPWLDGKHVVFGRVID----------------------------------
1dywA           TEWLDGKHVVFGRV--VEGLDVVKAVESNGSQSGKPVKDCMIAD------
3bkpA           ADVLNNAYTLFGKVTGHTLYNLM-KFNDLEVGKEDRPMTPPFIKSVDV--
1z81A           CEWLDGKNVVFGRIIDNDSLLLLKKIENVSVTPY----------------
3k2cC           TQWLDEKHVVFGEV--VEGMDVVHKIA-----------------------
3k2cB           TQWLDEKHVVFGEV--VEGMDVVHKIA-----------------------
3k2cA           TQWLDEKHVVFGEV--VEGMDVVHKIA-----------------------
2nulA           NDFLNFSYCVFAEVVD--GMDVVDKIKGVATGRQDVPKEDVIIESVTVS-
1mzwA           CDWLDGKHVVFGKIID--GLLVMRKIENVPTGPNNKPKLPVVI-------
1lopA           NDFLNFSYCVFAEVVDGMDE--VDKIKGVATGRQDVPKEDVIIESVTVS-
2z6wA           TDWLDGKHVVFGHVIE----------------------------------
2ck1A           CDWLDGKHVVFGRVVDGQN-------------------------------
1awsA           TEWLDGKHVVFGKVKE----------------------------------
1zmfA           TDWLDGKHVVFGEVTE----------------------------------
2r99A           TDWLDGKHVVFGEVTE----------------------------------
3bo7D           CEHLNNKHTIFGRV------------------------------------
3bo7B           CEHLNNKHTIFGRV------------------------------------
3bo7A           CEHLNNKHTIFGRV------------------------------------
3bo7C           CEHLNNKHTIFGRV------------------------------------
2c3bA           TSWLDGKHVVFGEVADEKSYSVVKEI------------------------
2c3bB           TSWLDGKHVVFGEVADEKSYSVVKEI------------------------
1clhA           NAFLDHGYAVFGKV--VKGMDVADKISQVPTPYQNVPSKPVVILSAKV--
1j2aA           NAFLDHGYAVFGKV--VKGMDVADKISQVPT-------------------